


| Basic Information | |
|---|---|
| Family ID | F075319 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTGTRLTDIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVE |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.64 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.546 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (16.807 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.269 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.756 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 5.88% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 0.84 |
| PF00924 | MS_channel | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.55 % |
| All Organisms | root | All Organisms | 34.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10218640 | Not Available | 575 | Open in IMG/M |
| 3300001834|ACM2_1032189 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 616 | Open in IMG/M |
| 3300005837|Ga0078893_10006314 | Not Available | 523 | Open in IMG/M |
| 3300006026|Ga0075478_10263219 | Not Available | 515 | Open in IMG/M |
| 3300006029|Ga0075466_1192652 | Not Available | 508 | Open in IMG/M |
| 3300006166|Ga0066836_10197728 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300006334|Ga0099675_1055923 | Not Available | 621 | Open in IMG/M |
| 3300006869|Ga0075477_10055171 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300006869|Ga0075477_10226297 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 759 | Open in IMG/M |
| 3300006870|Ga0075479_10119639 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300006902|Ga0066372_10947723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 525 | Open in IMG/M |
| 3300007231|Ga0075469_10173977 | Not Available | 581 | Open in IMG/M |
| 3300007283|Ga0066366_10322646 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 659 | Open in IMG/M |
| 3300007623|Ga0102948_1248345 | Not Available | 542 | Open in IMG/M |
| 3300008012|Ga0075480_10038648 | Not Available | 2855 | Open in IMG/M |
| 3300009076|Ga0115550_1263998 | Not Available | 560 | Open in IMG/M |
| 3300009086|Ga0102812_10667757 | Not Available | 572 | Open in IMG/M |
| 3300009433|Ga0115545_1138947 | Not Available | 854 | Open in IMG/M |
| 3300009435|Ga0115546_1323466 | Not Available | 525 | Open in IMG/M |
| 3300009440|Ga0115561_1110760 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300009440|Ga0115561_1231947 | Not Available | 693 | Open in IMG/M |
| 3300009440|Ga0115561_1356526 | Not Available | 536 | Open in IMG/M |
| 3300009472|Ga0115554_1221541 | Not Available | 762 | Open in IMG/M |
| 3300009476|Ga0115555_1135232 | Not Available | 1041 | Open in IMG/M |
| 3300009481|Ga0114932_10136736 | All Organisms → Viruses → Predicted Viral | 1512 | Open in IMG/M |
| 3300009495|Ga0115571_1321294 | Not Available | 614 | Open in IMG/M |
| 3300009507|Ga0115572_10784205 | Not Available | 513 | Open in IMG/M |
| 3300009550|Ga0115013_11432027 | Not Available | 515 | Open in IMG/M |
| 3300010300|Ga0129351_1326000 | Not Available | 578 | Open in IMG/M |
| 3300010318|Ga0136656_1166618 | Not Available | 748 | Open in IMG/M |
| 3300010368|Ga0129324_10053408 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300012919|Ga0160422_10326622 | Not Available | 947 | Open in IMG/M |
| 3300012928|Ga0163110_10103428 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300012936|Ga0163109_10429985 | Not Available | 967 | Open in IMG/M |
| 3300012936|Ga0163109_10702322 | Not Available | 740 | Open in IMG/M |
| 3300012936|Ga0163109_10867542 | Not Available | 659 | Open in IMG/M |
| 3300016739|Ga0182076_1581658 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 555 | Open in IMG/M |
| 3300016771|Ga0182082_1398295 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 783 | Open in IMG/M |
| 3300017697|Ga0180120_10339255 | Not Available | 596 | Open in IMG/M |
| 3300017713|Ga0181391_1049817 | Not Available | 990 | Open in IMG/M |
| 3300017713|Ga0181391_1102543 | Not Available | 646 | Open in IMG/M |
| 3300017714|Ga0181412_1115441 | Not Available | 622 | Open in IMG/M |
| 3300017714|Ga0181412_1147999 | Not Available | 529 | Open in IMG/M |
| 3300017717|Ga0181404_1097629 | Not Available | 721 | Open in IMG/M |
| 3300017726|Ga0181381_1113800 | Not Available | 568 | Open in IMG/M |
| 3300017734|Ga0187222_1038425 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300017735|Ga0181431_1115113 | Not Available | 601 | Open in IMG/M |
| 3300017735|Ga0181431_1115345 | Not Available | 600 | Open in IMG/M |
| 3300017737|Ga0187218_1020705 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300017738|Ga0181428_1162451 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 522 | Open in IMG/M |
| 3300017744|Ga0181397_1183601 | Not Available | 527 | Open in IMG/M |
| 3300017752|Ga0181400_1047166 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300017755|Ga0181411_1056565 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300017755|Ga0181411_1149423 | Not Available | 672 | Open in IMG/M |
| 3300017760|Ga0181408_1141850 | Not Available | 619 | Open in IMG/M |
| 3300017771|Ga0181425_1017791 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300017776|Ga0181394_1096470 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 947 | Open in IMG/M |
| 3300017782|Ga0181380_1098750 | Not Available | 1013 | Open in IMG/M |
| 3300017956|Ga0181580_10835053 | Not Available | 578 | Open in IMG/M |
| 3300017968|Ga0181587_10164029 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1559 | Open in IMG/M |
| 3300017969|Ga0181585_11062608 | Not Available | 514 | Open in IMG/M |
| 3300018080|Ga0180433_10433335 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300018413|Ga0181560_10561006 | Not Available | 517 | Open in IMG/M |
| 3300018418|Ga0181567_10698294 | Not Available | 648 | Open in IMG/M |
| 3300018420|Ga0181563_10810310 | Not Available | 511 | Open in IMG/M |
| 3300018775|Ga0188848_1017217 | Not Available | 778 | Open in IMG/M |
| 3300020055|Ga0181575_10689379 | Not Available | 521 | Open in IMG/M |
| 3300020177|Ga0181596_10113360 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300020247|Ga0211654_1031199 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 834 | Open in IMG/M |
| 3300020247|Ga0211654_1052646 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 618 | Open in IMG/M |
| 3300020281|Ga0211483_10258358 | Not Available | 579 | Open in IMG/M |
| 3300020314|Ga0211522_1062327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 633 | Open in IMG/M |
| 3300020336|Ga0211510_1074675 | Not Available | 801 | Open in IMG/M |
| 3300020395|Ga0211705_10095268 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300020395|Ga0211705_10354551 | Not Available | 544 | Open in IMG/M |
| 3300020410|Ga0211699_10330584 | Not Available | 597 | Open in IMG/M |
| 3300020410|Ga0211699_10445315 | Not Available | 514 | Open in IMG/M |
| 3300020419|Ga0211512_10183427 | Not Available | 964 | Open in IMG/M |
| 3300020428|Ga0211521_10153826 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300020430|Ga0211622_10121954 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300020437|Ga0211539_10377282 | Not Available | 590 | Open in IMG/M |
| 3300020438|Ga0211576_10291004 | Not Available | 851 | Open in IMG/M |
| 3300020445|Ga0211564_10439647 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 640 | Open in IMG/M |
| 3300020454|Ga0211548_10225102 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 911 | Open in IMG/M |
| 3300020468|Ga0211475_10160623 | Not Available | 1143 | Open in IMG/M |
| 3300020469|Ga0211577_10764817 | Not Available | 560 | Open in IMG/M |
| 3300020472|Ga0211579_10637986 | Not Available | 596 | Open in IMG/M |
| 3300020475|Ga0211541_10228075 | Not Available | 913 | Open in IMG/M |
| 3300021347|Ga0213862_10347907 | Not Available | 528 | Open in IMG/M |
| 3300021365|Ga0206123_10240004 | Not Available | 791 | Open in IMG/M |
| 3300021371|Ga0213863_10309642 | Not Available | 659 | Open in IMG/M |
| 3300021791|Ga0226832_10126277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 955 | Open in IMG/M |
| 3300021958|Ga0222718_10529660 | Not Available | 564 | Open in IMG/M |
| 3300022068|Ga0212021_1124908 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 527 | Open in IMG/M |
| 3300022921|Ga0255765_1232345 | Not Available | 785 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10261658 | Not Available | 738 | Open in IMG/M |
| 3300023087|Ga0255774_10260937 | Not Available | 855 | Open in IMG/M |
| 3300023110|Ga0255743_10023858 | All Organisms → Viruses → Predicted Viral | 4069 | Open in IMG/M |
| 3300023110|Ga0255743_10274004 | Not Available | 885 | Open in IMG/M |
| 3300023172|Ga0255766_10025869 | Not Available | 4150 | Open in IMG/M |
| 3300023294|Ga0222670_1003341 | All Organisms → Viruses → Predicted Viral | 4584 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10281493 | Not Available | 725 | Open in IMG/M |
| 3300025138|Ga0209634_1059059 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
| 3300025570|Ga0208660_1116866 | Not Available | 570 | Open in IMG/M |
| 3300025590|Ga0209195_1133320 | Not Available | 520 | Open in IMG/M |
| 3300025632|Ga0209194_1104327 | Not Available | 714 | Open in IMG/M |
| 3300025653|Ga0208428_1097024 | Not Available | 834 | Open in IMG/M |
| 3300025770|Ga0209362_1269297 | Not Available | 544 | Open in IMG/M |
| 3300025771|Ga0208427_1073359 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300025869|Ga0209308_10190565 | Not Available | 915 | Open in IMG/M |
| 3300025869|Ga0209308_10435940 | Not Available | 515 | Open in IMG/M |
| 3300026257|Ga0208407_1146540 | Not Available | 719 | Open in IMG/M |
| 3300026270|Ga0207993_1145815 | Not Available | 619 | Open in IMG/M |
| 3300028194|Ga0257106_1052027 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300031646|Ga0302133_10534980 | Not Available | 509 | Open in IMG/M |
| 3300032278|Ga0310345_11544584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 649 | Open in IMG/M |
| 3300032360|Ga0315334_10432276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1119 | Open in IMG/M |
| 3300032820|Ga0310342_103329454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 532 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.81% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 12.61% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.24% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.72% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.68% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.68% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.84% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.84% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.84% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.84% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.84% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.84% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001834 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2g | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026270 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102186401 | 3300000117 | Marine | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCLQAEFAGIMSE |
| ACM2_10321892 | 3300001834 | Marine Plankton | MGTRLTDIVFDRHEDHLYEDERAMRLTPYVMAERCLQVEAWGIIKDAQ |
| Ga0078893_100063141 | 3300005837 | Marine Surface Water | MGTRLKADIIFDRHEDFLYEDSRAMKLTPYVMSERCLQ |
| Ga0075478_102632192 | 3300006026 | Aqueous | MTGTRLTDIIMDRHEDFLYEDSRAMKLTPYVMSERCLQVE |
| Ga0075466_11926521 | 3300006029 | Aqueous | MGTRLADIVFDRNDDFLYEDDRAMKLTPYVMAERCLQVEMSNI |
| Ga0066836_101977281 | 3300006166 | Marine | MGTRLKEIIIDKHEDLLYEDERAMKLTHYVMAERC |
| Ga0099675_10559231 | 3300006334 | Marine | MGTRLKDIIFDRHEDHLYEDERAMRLTPYVMAERCLQVEAVKIYDDY |
| Ga0075477_100551711 | 3300006869 | Aqueous | MGTRLIDIVLDRHEDHLYEDSRAMRLTPYVMAERCLQVEISNI |
| Ga0075477_102262973 | 3300006869 | Aqueous | MGTRLADIIFDRQEDFLYEDERAMRLTPYVMAERCLQ |
| Ga0075479_101196394 | 3300006870 | Aqueous | MGTRLTDIILDRHEDFLYEDSRDMRLTPYVMAERCLQAEFAGIMS |
| Ga0066372_109477233 | 3300006902 | Marine | MGTRLKEIIFDKHDDLLYEDERAMKLTHYVMAERCL |
| Ga0075469_101739771 | 3300007231 | Aqueous | MTGTRLLDIVMDRNEDFLYEDSRAMKLTPYVMSERCIQVEV |
| Ga0066366_103226461 | 3300007283 | Marine | MGTRLKEIIFDKHEDLLYEDERAMKLTHYVMAERC |
| Ga0102948_12483452 | 3300007623 | Water | MGNRLADIIFDRHEEHLYEDNRAMKLTPYVMAERCLQVE |
| Ga0075480_1003864810 | 3300008012 | Aqueous | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCL |
| Ga0115550_12639982 | 3300009076 | Pelagic Marine | MTGTRLADIIMDRHEDFLYEDSRAMKLTPYVMSERCIQVEASNIYKDYK |
| Ga0102812_106677571 | 3300009086 | Estuarine | MTGTRLIDVVMDRHEDHLYEDSRAMRLTPYVMAERCLQAEF |
| Ga0115545_11389471 | 3300009433 | Pelagic Marine | MTGTRLLDIVMDRNEDFLYEDSRAMRLTPYVMSER |
| Ga0115546_13234662 | 3300009435 | Pelagic Marine | MTGTRLTEIIMDRHEDFLYEDSREMKRTPYVMSER |
| Ga0115561_11107605 | 3300009440 | Pelagic Marine | MGTRLADVIFDRHEDHLYEDSRAMKLTPYVMSERCLQVEI |
| Ga0115561_12319471 | 3300009440 | Pelagic Marine | MTGTRLLDIVMDRNEDFLYEDSRAMRLTPYVMSERCIQAEV |
| Ga0115561_13565261 | 3300009440 | Pelagic Marine | MTGTRLIDIVMDRHEDHLYEDSRAMRLTPYVMAERCLQA |
| Ga0115554_12215411 | 3300009472 | Pelagic Marine | MGTRLIDIVLDREEDFLYEDERAMRLTPYVMAERC |
| Ga0115555_11352321 | 3300009476 | Pelagic Marine | MTGTRLADIIMDRHEDHLYEDSRAMRLTPYVMAERCLQ |
| Ga0114932_101367364 | 3300009481 | Deep Subsurface | MGTRLADIIFDRTEDFLYEDERAMKLTPYVMSERCLQVEIRTSI* |
| Ga0115571_13212941 | 3300009495 | Pelagic Marine | MTGARLIDIVMDRHEDHLYEDSRAMRLTPYVMAERCLQAEFAGIM |
| Ga0115572_107842052 | 3300009507 | Pelagic Marine | MTGTRLADIIMDRHEDHLYEDERAMRLTPYVMAERCVQSEFVGIM |
| Ga0115013_114320272 | 3300009550 | Marine | MGTRLKDIVFDRHEDFLYEDNRAMKLAPYVMAERCLQVEAVKIYDDYK |
| Ga0129351_13260002 | 3300010300 | Freshwater To Marine Saline Gradient | MGTRLADIILDRHEDHLYEDERAMRLTPYVMAERCLQVEINS |
| Ga0136656_11666183 | 3300010318 | Freshwater To Marine Saline Gradient | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCLQAEFAGI |
| Ga0129324_100534081 | 3300010368 | Freshwater To Marine Saline Gradient | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCLQAEFAG |
| Ga0160422_103266223 | 3300012919 | Seawater | MGTRLIDIVFDRYEDHLYEDDRAMRLTPYVMAERCLQV |
| Ga0163110_101034289 | 3300012928 | Surface Seawater | MGTRLIDIVFDRHEDFLYEDNRAMKLTPYVMAERCLQVE |
| Ga0163109_104299851 | 3300012936 | Surface Seawater | MGTRLKDIVFDRHEDHLYEDERAMRLTPYVMAERCLQ |
| Ga0163109_107023221 | 3300012936 | Surface Seawater | MTGTRLTEVIYDRHEDFLYEDSRAMKLTPYVMSERCLQ |
| Ga0163109_108675421 | 3300012936 | Surface Seawater | MGTKLKDIIFDRHEDHLYEDERAMRLTPYVMAERCLQVE |
| Ga0182076_15816581 | 3300016739 | Salt Marsh | MGTRLIDIVLDRQEDFLYEDERAMRLTPYVMAERCLQ |
| Ga0182082_13982953 | 3300016771 | Salt Marsh | MGTRLADIILDREEDFLYEDERAMKLTPYVMAERL |
| Ga0180120_103392552 | 3300017697 | Freshwater To Marine Saline Gradient | MTGTRLTEIIMDRHEDFLYEDSRAMKLTPYVMSERCI |
| Ga0181391_10498174 | 3300017713 | Seawater | MGTRLADVIFDRHEDFLYEDSRAMKLTPYVMSERCLQVEA |
| Ga0181391_11025432 | 3300017713 | Seawater | MTGTRLTDIVMDRHEDFLYEDSRAMKLTPYVMSERCLQVEIS |
| Ga0181412_11154413 | 3300017714 | Seawater | MGVRLTDIVFDRHEDFLYEDDRAMKLTSYVMAERCIQVEVAKIYND |
| Ga0181412_11479991 | 3300017714 | Seawater | MTGTRLADIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVEISNIYKDYK |
| Ga0181404_10976291 | 3300017717 | Seawater | MTGTRLLDIVMDRNEDFLYEDSRAMKLTPYVMSERCIQAE |
| Ga0181381_11138002 | 3300017726 | Seawater | MTGTRLKDIVFDRQEDHLYEDARAMRLTPYVMSERCLQVEMSNIYQD |
| Ga0187222_10384255 | 3300017734 | Seawater | MGTRLADIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVEISNIYKDYK |
| Ga0181431_11151131 | 3300017735 | Seawater | MTGTRLADIIMDRQEDFLYEDSRAMKLTPYVMSERC |
| Ga0181431_11153451 | 3300017735 | Seawater | MTGTRLAEVIYDRHEDFLYEDSRAMKLTPYVMSERC |
| Ga0187218_10207051 | 3300017737 | Seawater | MTGTRLTDIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVE |
| Ga0181428_11624511 | 3300017738 | Seawater | MGVRLTDIVFDRHEDFLYEDDRAMKLTSYVMAERCIQ |
| Ga0181397_11836012 | 3300017744 | Seawater | MTGTRLADIIFDRHEDFLYEDSRAMKLTPYVMSERCVQVEISNIY |
| Ga0181400_10471665 | 3300017752 | Seawater | MTGTRLTDIIMDRHEDFLYEDSRAMKLTPYVMSERCIQV |
| Ga0181411_10565654 | 3300017755 | Seawater | MTGTRLTDIVMDRHEDFLYEDSRAMKLTPYVMSER |
| Ga0181411_11494233 | 3300017755 | Seawater | MTGTRLAEVIYDRHEDFLYEDSRAMKLTPYVMSERCLQV |
| Ga0181408_11418501 | 3300017760 | Seawater | MGVRLTDIVFDRHEDFLYEDDRAMKLTSYVMAERCIQVEVAKIYN |
| Ga0187220_11865593 | 3300017768 | Seawater | MGTRLLDIVFDKNDDLLYEDDRAMKLSHYVMAERCLQAEMK |
| Ga0181425_10177911 | 3300017771 | Seawater | MGTRLADIIFDRTEDFLYEDERAMKLTPYVMAERCLQVE |
| Ga0181394_10964703 | 3300017776 | Seawater | MGKRLKDIIFDRHEDFLYEDDRAMKLTPYVMAERCVQVEV |
| Ga0181380_10987504 | 3300017782 | Seawater | MTGTRLAEVIYDRHEDFLYEDSRAMKLTPYVMSERCLQVEISNIY |
| Ga0181580_108350532 | 3300017956 | Salt Marsh | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCVQSEFVGIMDEYR |
| Ga0181587_101640291 | 3300017968 | Salt Marsh | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERC |
| Ga0181585_110626082 | 3300017969 | Salt Marsh | MGTRLTDIIMDRHEDHLYEDERAMRLTPYVMAERCVQSEFVGIM |
| Ga0180433_104333351 | 3300018080 | Hypersaline Lake Sediment | MGTRLADIILDRQEDFLYEDERAMKLTPYVMAERCLQVE |
| Ga0181560_105610062 | 3300018413 | Salt Marsh | MGTRLTDIVFDRHEDHLYEDERAMRLTPYVMAERCLQVEMKNIYE |
| Ga0181567_106982943 | 3300018418 | Salt Marsh | MGTRLADIILDREEDFLYEDERAMKLTPYVMAERLTQW |
| Ga0181563_108103101 | 3300018420 | Salt Marsh | MTGTRLTDIIMDRHEDHLYEDSRAMRLTPYVMAERCLQSE |
| Ga0188848_10172172 | 3300018775 | Freshwater Lake | MGNRLTDIIFDRHEEHLYEDNRAMKLTPYVMAERCLQV |
| Ga0181575_106893791 | 3300020055 | Salt Marsh | MGTRLTDIVFDRHEDHLYEDDRAMRLTPYVMAERCLQVEAVKIYDDYKK |
| Ga0181596_101133605 | 3300020177 | Salt Marsh | MGTRLIDIVLDRHEDHLYEDERAMRLTPYVMAERCLQVEINSIFSDG |
| Ga0211654_10311993 | 3300020247 | Marine | MGTRLTTDIQDRHTDFLYEDSRAMKLTPYVMSERCLQVE |
| Ga0211654_10526462 | 3300020247 | Marine | MGNRLTDIVFDRHADHLYEDERAMKLTPYVMSERCLQVE |
| Ga0211483_102583582 | 3300020281 | Marine | MGTKLKDIIFDRQEDHLYEDDRAMRLTPYVMAERCLQVEMKNIYEDYN |
| Ga0211522_10623271 | 3300020314 | Marine | MGTRLAEIISDRHEDLLYEDSRAMKLTSYVMAERCLQ |
| Ga0211510_10746751 | 3300020336 | Marine | MGQRLKDIIFDRHEDFLYEDNRAMKLTPYVMAERCLQ |
| Ga0211705_100952681 | 3300020395 | Marine | MGTRLKDIIFDRHEDHLYEDDRAMRLTPYVMAERCLQVEIKNIFK |
| Ga0211705_103545512 | 3300020395 | Marine | MGTRLKDIIFDRHEDHLYEDERAMSLTPYVMAERCLQVEIKNI |
| Ga0211699_103305841 | 3300020410 | Marine | MAIPGLTGTRLTDIIFDRHEDFLYEDSRAMKLTPYVMS |
| Ga0211699_104453152 | 3300020410 | Marine | MGTRLKDIIFDRSEDQLYEDERAMRLTPYVMAERCLQVE |
| Ga0211512_101834271 | 3300020419 | Marine | MTGTRLTDIIMDRHEDFLYEDSRAMKLTPYVMSERCLQVEISDIYKD |
| Ga0211521_101538261 | 3300020428 | Marine | MGISGLTGTRLTDIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVE |
| Ga0211622_101219545 | 3300020430 | Marine | MGTRLKDIIFDRHEDHLYEDERAMRLTPYVMAERCL |
| Ga0211539_103772822 | 3300020437 | Marine | MGTRLTDIIFDRHEDHLYEDERAMRLTPYVMAERCIQVEVASIFNDK |
| Ga0211576_102910043 | 3300020438 | Marine | MTGTRLTDIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVEISNIY |
| Ga0211564_104396473 | 3300020445 | Marine | MGTRLADIVFDRHEDFLYEDERAMKLTPYVMSERCLQVEAAKIYNDKAEGD |
| Ga0211548_102251021 | 3300020454 | Marine | MGTRLADIIFDRTEDFLYEDERAMKLTPYVMAERCLQVEIKNIYLD |
| Ga0211475_101606231 | 3300020468 | Marine | MGTRLKDIVFDRSEDHLYEDERAMRLTPYVMSERCLQVEA |
| Ga0211577_107648171 | 3300020469 | Marine | MTGTRLIDIVMDRHEDHLYEDSRAMRLTPYVMSERCIQVEAS |
| Ga0211579_106379861 | 3300020472 | Marine | MTGTRLADIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVEISNIY |
| Ga0211541_102280754 | 3300020475 | Marine | MGTRLKDIVFDRHEDHLYEDERAMRLTPYVMSERC |
| Ga0213862_103479072 | 3300021347 | Seawater | MGTRLTDIVFDRHEDHLYEDERAMRLTPYVMAERCLQVEAVK |
| Ga0206123_102400041 | 3300021365 | Seawater | MTGTRLIDIVMDRHEDFLYEDSRAMKLTPYVMSERCIQVEISN |
| Ga0213863_103096423 | 3300021371 | Seawater | MGTRLADIIMDRHEDHLYEDSRAMRLTPYVMAERCLQAEFAGIMSE |
| Ga0226832_101262771 | 3300021791 | Hydrothermal Vent Fluids | MGTRLKDIIFDKNEDLLYEDERAMALTHYVMAERCIQVQMKDIH |
| Ga0222718_105296601 | 3300021958 | Estuarine Water | MMGTRLADIILDREEDFLYEDERAMKLTPYVMAERLTQWE |
| Ga0212021_11249081 | 3300022068 | Aqueous | MGTRLADIIFDRQEDFLYEDERAMRLTPYVMAERCLQV |
| Ga0255765_12323451 | 3300022921 | Salt Marsh | MGTRLTDIIMDRHEDHLYEDERAMRLTPYVMAERCVQSEFVGIMDE |
| (restricted) Ga0233427_102616581 | 3300022933 | Seawater | MTGTRLTDIIFDRNDDFLYEDSRAMKLTPYVMSERCL |
| Ga0255774_102609373 | 3300023087 | Salt Marsh | MGTRLKDIIFDRHEDLLWQDEHAMSLTPYVMAERCLQVEAWKI |
| Ga0255743_100238581 | 3300023110 | Salt Marsh | MGTRLKDIIFDRHEDLLWQDEHAMSLTPYVMAERCLQVEAWKIYDS |
| Ga0255743_102740041 | 3300023110 | Salt Marsh | MGTRLKDIIFDRHEDHLYEDDRAMRLTPYVMAERCL |
| Ga0255766_1002586912 | 3300023172 | Salt Marsh | MGRRLIDIVFDRESDYLYVDDRNMNLTPYVMAERCVQAEFAGIME |
| Ga0222670_100334114 | 3300023294 | Saline Water | MGTRLADIVFDRNEDFLYEDDRAMKLTPYVMAERCLQVESWQILTSAKDG |
| (restricted) Ga0233444_102814933 | 3300024264 | Seawater | MTGTRLLDIVMDRNEDFLYEDSRAMKLTPYVMSERC |
| Ga0209634_10590591 | 3300025138 | Marine | MGTRLADIVFDRNDDFLYEDDRAMKLTPYVMAERCL |
| Ga0208660_11168662 | 3300025570 | Aqueous | MTGTRLLDIVMDRNEDFLYEDSRAMKLTPYVMSERCIQVEVVKI |
| Ga0209195_11333202 | 3300025590 | Pelagic Marine | MTGTRLADIIMDRHEDFLYEDSRAMKLTPYVMSERC |
| Ga0209194_11043273 | 3300025632 | Pelagic Marine | MTGTRLIDIVMDRHEDHLYEDSRAMRLTPYVMAERCLQ |
| Ga0208428_10970244 | 3300025653 | Aqueous | MTGTRLLDVVMDRNEDFLYEDSRAMKLTPYVMAER |
| Ga0209362_12692972 | 3300025770 | Marine | MTGTRLADIIFDRHEDFLYEDSRAMKLTPYVMSERCLQVE |
| Ga0208427_10733591 | 3300025771 | Aqueous | MGTRLADIIFDRQEDFLYEDERAMRLTPYVMAERC |
| Ga0209308_101905651 | 3300025869 | Pelagic Marine | MTGTRLTDIVFDRHEDFLYEDSRAMKLTPYVMSERCLQVEAVKIYDD |
| Ga0209308_104359402 | 3300025869 | Pelagic Marine | MGTRLKDIVFDRHEDQLYQDEHAMSLTPYVMAERCLQIEAWK |
| Ga0208407_11465401 | 3300026257 | Marine | MGTRLKDIVFDRHEDHLYEDERAMKLTPYVMSERCLQV |
| Ga0207993_11458152 | 3300026270 | Marine | MTGTRLTDIVFDRHEDFLYEDSRAMKLTPYVMAERCIQVEAWKIYDDEK |
| Ga0257106_10520275 | 3300028194 | Marine | MGKKLGKIIFDRMKDNLYQDDRGMTLTPYVMAERCLQVEV |
| Ga0302133_105349802 | 3300031646 | Marine | MTGTRLTDIIFDRNEDFLYEDSRAMKLTPYVMSERCVQIEVAKIFKD |
| Ga0310345_115445841 | 3300032278 | Seawater | MGTRLKDIIFDKHDDLLYEDERAMNLTHYVMAERCLQA |
| Ga0315334_104322761 | 3300032360 | Seawater | MGTRLKDIIFDKQEDLLYEDERAMNLTHYVMAERCLQ |
| Ga0310342_1033294541 | 3300032820 | Seawater | MGTRLADIIMDRHEDFLYEDSRAMRLTPYVMAERCL |
| ⦗Top⦘ |