


| Basic Information | |
|---|---|
| Family ID | F075315 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAEAKV |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 96.64 % |
| % of genes near scaffold ends (potentially truncated) | 99.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.92 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (43.697 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00565 | SNase | 15.13 |
| PF00004 | AAA | 9.24 |
| PF01223 | Endonuclease_NS | 5.88 |
| PF13177 | DNA_pol3_delta2 | 5.88 |
| PF03851 | UvdE | 5.88 |
| PF00535 | Glycos_transf_2 | 5.04 |
| PF02229 | PC4 | 4.20 |
| PF03013 | Pyr_excise | 4.20 |
| PF04055 | Radical_SAM | 2.52 |
| PF02562 | PhoH | 0.84 |
| PF13578 | Methyltransf_24 | 0.84 |
| PF01501 | Glyco_transf_8 | 0.84 |
| PF03819 | MazG | 0.84 |
| PF01467 | CTP_transf_like | 0.84 |
| PF01202 | SKI | 0.84 |
| PF00574 | CLP_protease | 0.84 |
| PF08406 | CbbQ_C | 0.84 |
| PF01327 | Pep_deformylase | 0.84 |
| PF00709 | Adenylsucc_synt | 0.84 |
| PF01513 | NAD_kinase | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 5.88 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 5.88 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.84 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.84 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1442 | Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.84 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.84 |
| COG5597 | N-acetylglucosaminyl transferase | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.47 % |
| Unclassified | root | N/A | 23.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084006|2223486107 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 589 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10070371 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1264 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10180903 | Not Available | 665 | Open in IMG/M |
| 3300000158|SI54feb11_100mDRAFT_c1047260 | Not Available | 598 | Open in IMG/M |
| 3300001354|JGI20155J14468_10054452 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
| 3300001960|GOS2230_1048067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 666 | Open in IMG/M |
| 3300005603|Ga0066853_10257884 | All Organisms → cellular organisms → Archaea | 574 | Open in IMG/M |
| 3300006025|Ga0075474_10183127 | Not Available | 647 | Open in IMG/M |
| 3300006166|Ga0066836_10542734 | All Organisms → cellular organisms → Archaea | 704 | Open in IMG/M |
| 3300006749|Ga0098042_1102268 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006751|Ga0098040_1035564 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300006751|Ga0098040_1212362 | Not Available | 564 | Open in IMG/M |
| 3300006752|Ga0098048_1234917 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
| 3300006789|Ga0098054_1234381 | Not Available | 664 | Open in IMG/M |
| 3300006789|Ga0098054_1255459 | All Organisms → cellular organisms → Archaea | 632 | Open in IMG/M |
| 3300006810|Ga0070754_10116361 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300006870|Ga0075479_10184365 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 842 | Open in IMG/M |
| 3300006929|Ga0098036_1130494 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
| 3300006990|Ga0098046_1139988 | Not Available | 521 | Open in IMG/M |
| 3300007234|Ga0075460_10260111 | Not Available | 577 | Open in IMG/M |
| 3300007647|Ga0102855_1077541 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 894 | Open in IMG/M |
| 3300009103|Ga0117901_1312730 | All Organisms → cellular organisms → Archaea | 708 | Open in IMG/M |
| 3300009409|Ga0114993_10396963 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300009425|Ga0114997_10361677 | All Organisms → cellular organisms → Archaea | 791 | Open in IMG/M |
| 3300009472|Ga0115554_1110830 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1159 | Open in IMG/M |
| 3300009476|Ga0115555_1417823 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 533 | Open in IMG/M |
| 3300009703|Ga0114933_10140724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1668 | Open in IMG/M |
| 3300009705|Ga0115000_10732527 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 609 | Open in IMG/M |
| 3300009706|Ga0115002_10706144 | All Organisms → cellular organisms → Archaea | 712 | Open in IMG/M |
| 3300009785|Ga0115001_10364046 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 908 | Open in IMG/M |
| 3300009786|Ga0114999_11342461 | All Organisms → cellular organisms → Archaea | 505 | Open in IMG/M |
| 3300009790|Ga0115012_10107982 | All Organisms → Viruses → Predicted Viral | 1958 | Open in IMG/M |
| 3300010150|Ga0098056_1287346 | Not Available | 543 | Open in IMG/M |
| 3300010155|Ga0098047_10240592 | All Organisms → cellular organisms → Archaea | 689 | Open in IMG/M |
| 3300011252|Ga0151674_1100732 | All Organisms → cellular organisms → Archaea | 774 | Open in IMG/M |
| 3300012523|Ga0129350_1005432 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 902 | Open in IMG/M |
| 3300012920|Ga0160423_10080883 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
| 3300012954|Ga0163111_11367358 | All Organisms → cellular organisms → Archaea | 697 | Open in IMG/M |
| 3300017706|Ga0181377_1050197 | All Organisms → cellular organisms → Archaea | 801 | Open in IMG/M |
| 3300017720|Ga0181383_1039702 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300017725|Ga0181398_1008281 | All Organisms → Viruses → Predicted Viral | 2681 | Open in IMG/M |
| 3300017727|Ga0181401_1061482 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300017731|Ga0181416_1076059 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300017733|Ga0181426_1121602 | Not Available | 526 | Open in IMG/M |
| 3300017739|Ga0181433_1085466 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300017744|Ga0181397_1009423 | All Organisms → Viruses → Predicted Viral | 3035 | Open in IMG/M |
| 3300017749|Ga0181392_1239626 | All Organisms → cellular organisms → Archaea | 512 | Open in IMG/M |
| 3300017762|Ga0181422_1079158 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300017772|Ga0181430_1246158 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 505 | Open in IMG/M |
| 3300018049|Ga0181572_10850110 | Not Available | 542 | Open in IMG/M |
| 3300018421|Ga0181592_10261914 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300018421|Ga0181592_10525408 | Not Available | 814 | Open in IMG/M |
| 3300018424|Ga0181591_10727643 | Not Available | 696 | Open in IMG/M |
| 3300018424|Ga0181591_11027874 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 558 | Open in IMG/M |
| 3300019751|Ga0194029_1004062 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300019765|Ga0194024_1029708 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300020304|Ga0211684_1032151 | All Organisms → cellular organisms → Archaea | 725 | Open in IMG/M |
| 3300020311|Ga0211628_1064190 | All Organisms → cellular organisms → Archaea | 594 | Open in IMG/M |
| 3300020378|Ga0211527_10217031 | Not Available | 530 | Open in IMG/M |
| 3300020388|Ga0211678_10156900 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 973 | Open in IMG/M |
| 3300020401|Ga0211617_10484419 | All Organisms → cellular organisms → Archaea | 508 | Open in IMG/M |
| 3300020402|Ga0211499_10058343 | All Organisms → cellular organisms → Archaea | 1487 | Open in IMG/M |
| 3300020403|Ga0211532_10288445 | Not Available | 634 | Open in IMG/M |
| 3300020411|Ga0211587_10143309 | All Organisms → cellular organisms → Archaea | 1017 | Open in IMG/M |
| 3300020411|Ga0211587_10243511 | All Organisms → cellular organisms → Archaea | 745 | Open in IMG/M |
| 3300020416|Ga0211644_10093861 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300020417|Ga0211528_10194522 | All Organisms → cellular organisms → Archaea | 781 | Open in IMG/M |
| 3300020437|Ga0211539_10397644 | All Organisms → cellular organisms → Archaea | 574 | Open in IMG/M |
| 3300020448|Ga0211638_10101529 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300020449|Ga0211642_10526382 | Not Available | 506 | Open in IMG/M |
| 3300020470|Ga0211543_10157826 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300020470|Ga0211543_10240268 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 889 | Open in IMG/M |
| 3300020470|Ga0211543_10533973 | Not Available | 555 | Open in IMG/M |
| 3300020478|Ga0211503_10037858 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 3076 | Open in IMG/M |
| 3300020478|Ga0211503_10323080 | All Organisms → cellular organisms → Archaea | 840 | Open in IMG/M |
| 3300021957|Ga0222717_10188162 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1233 | Open in IMG/M |
| 3300022053|Ga0212030_1044852 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 625 | Open in IMG/M |
| (restricted) 3300022888|Ga0233428_1032821 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2318 | Open in IMG/M |
| 3300023116|Ga0255751_10212964 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| (restricted) 3300024258|Ga0233440_1016040 | All Organisms → cellular organisms → Archaea | 3594 | Open in IMG/M |
| (restricted) 3300024258|Ga0233440_1019123 | All Organisms → cellular organisms → Archaea | 3129 | Open in IMG/M |
| (restricted) 3300024302|Ga0233449_1026040 | All Organisms → cellular organisms → Archaea | 2604 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1276258 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 563 | Open in IMG/M |
| (restricted) 3300024336|Ga0233447_1113485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 776 | Open in IMG/M |
| 3300024344|Ga0209992_10013453 | All Organisms → Viruses → Predicted Viral | 4827 | Open in IMG/M |
| 3300025084|Ga0208298_1088450 | Not Available | 570 | Open in IMG/M |
| 3300025102|Ga0208666_1008486 | All Organisms → Viruses → Predicted Viral | 3636 | Open in IMG/M |
| 3300025103|Ga0208013_1045816 | All Organisms → Viruses | 1201 | Open in IMG/M |
| 3300025108|Ga0208793_1171690 | Not Available | 560 | Open in IMG/M |
| 3300025118|Ga0208790_1094585 | Not Available | 876 | Open in IMG/M |
| 3300025127|Ga0209348_1096828 | Not Available | 922 | Open in IMG/M |
| 3300025127|Ga0209348_1155024 | All Organisms → cellular organisms → Archaea | 670 | Open in IMG/M |
| 3300025127|Ga0209348_1171888 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
| 3300025128|Ga0208919_1215094 | All Organisms → cellular organisms → Archaea | 571 | Open in IMG/M |
| 3300025132|Ga0209232_1179842 | Not Available | 657 | Open in IMG/M |
| 3300025137|Ga0209336_10134327 | All Organisms → cellular organisms → Archaea | 666 | Open in IMG/M |
| 3300025610|Ga0208149_1080548 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 802 | Open in IMG/M |
| 3300025645|Ga0208643_1026772 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1946 | Open in IMG/M |
| 3300025727|Ga0209047_1099419 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 990 | Open in IMG/M |
| 3300025803|Ga0208425_1018398 | All Organisms → Viruses → Predicted Viral | 1871 | Open in IMG/M |
| 3300025803|Ga0208425_1108663 | Not Available | 642 | Open in IMG/M |
| 3300025806|Ga0208545_1079908 | Not Available | 894 | Open in IMG/M |
| 3300026257|Ga0208407_1196040 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 594 | Open in IMG/M |
| 3300026321|Ga0208764_10252470 | Not Available | 860 | Open in IMG/M |
| 3300027687|Ga0209710_1145558 | All Organisms → cellular organisms → Archaea | 867 | Open in IMG/M |
| 3300027838|Ga0209089_10118402 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300027839|Ga0209403_10458927 | All Organisms → cellular organisms → Archaea | 654 | Open in IMG/M |
| 3300027844|Ga0209501_10377902 | All Organisms → cellular organisms → Archaea | 846 | Open in IMG/M |
| 3300027906|Ga0209404_10126548 | Not Available | 1535 | Open in IMG/M |
| 3300028436|Ga0256397_1000208 | All Organisms → cellular organisms → Archaea | 4298 | Open in IMG/M |
| 3300029319|Ga0183748_1042621 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300031510|Ga0308010_1267859 | All Organisms → cellular organisms → Archaea | 595 | Open in IMG/M |
| 3300031588|Ga0302137_1219772 | All Organisms → cellular organisms → Archaea | 650 | Open in IMG/M |
| 3300031675|Ga0302122_10071392 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300031702|Ga0307998_1076207 | All Organisms → cellular organisms → Archaea | 1278 | Open in IMG/M |
| 3300031886|Ga0315318_10294601 | Not Available | 930 | Open in IMG/M |
| 3300032032|Ga0315327_10210341 | Not Available | 1220 | Open in IMG/M |
| 3300032047|Ga0315330_10054012 | All Organisms → Viruses → Predicted Viral | 2683 | Open in IMG/M |
| 3300032132|Ga0315336_1220044 | Not Available | 684 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.24% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.40% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.04% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.04% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.36% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.68% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.68% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.68% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084006 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_dispersant_7 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000158 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100m | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020304 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556110-ERR599176) | Environmental | Open in IMG/M |
| 3300020311 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024258 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_120_MG | Environmental | Open in IMG/M |
| 3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300024336 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_135_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025727 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028436 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2223898541 | 2222084006 | Marine | MYYEVQVVFTEEIPTKNGMREKKNRKMFLVECDSVSVAEAK |
| DelMOSum2011_100703711 | 3300000115 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAE |
| DelMOWin2010_101809032 | 3300000117 | Marine | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEV |
| SI54feb11_100mDRAFT_10472602 | 3300000158 | Marine | MTYYETQVIFTEEIPTKNGVREKKTRRAFLVECDSV |
| JGI20155J14468_100544525 | 3300001354 | Pelagic Marine | MYYEVQVVFTEEIPTKNGFREKKSRKTFLVECVSVSI |
| GOS2230_10480672 | 3300001960 | Marine | MYYEAQVLFTEEVDTKNGVKEKKVRRNYLVECDSVSVA* |
| Ga0066853_102578841 | 3300005603 | Marine | MYFEATVIFIEEIQTKNGVKEKKVRKTYLVECDSVSVAESKVNEWLKT |
| Ga0075474_101831272 | 3300006025 | Aqueous | MYREYYYEVNVVFTEEIPTKNGFREKKLRRSFLVECMS |
| Ga0066836_105427341 | 3300006166 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRVYLVECDSVSV |
| Ga0098042_11022681 | 3300006749 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAETKV |
| Ga0098040_10355647 | 3300006751 | Marine | MYFETQVIFTEDIPTKNGVREKKTRRAFLVECDSVSVAEA |
| Ga0098040_12123622 | 3300006751 | Marine | MYFETQVIFTEEIPTKNGIKEKKTRRAFLVECDSVSVAEA |
| Ga0098048_12349171 | 3300006752 | Marine | MYFEAQVIFIEEIATKNGTREKKIRRHYLVECDSVTVAEAKVNEYLKDSHYPF |
| Ga0098054_12343813 | 3300006789 | Marine | MFEVTVIFIEEIATKNGVKEKKIRRNYLVTECDSVSVAEAKIHEYLKDSA |
| Ga0098054_12554592 | 3300006789 | Marine | MYYEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAESKVNEWLKTS |
| Ga0070754_101163614 | 3300006810 | Aqueous | MYFEVQVIFTEEIQTKSGIREKQRRKHLLVECDSV |
| Ga0075479_101843651 | 3300006870 | Aqueous | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKVNEFLKDS |
| Ga0098036_11304941 | 3300006929 | Marine | MFFEATVVFIEEIQMKNGVKEKKVRRSYLVECDSVT |
| Ga0098046_11399882 | 3300006990 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAETKVREWL |
| Ga0075460_102601111 | 3300007234 | Aqueous | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAE |
| Ga0102855_10775412 | 3300007647 | Estuarine | MYYEVQVMFVEEIQTKNGVKEKRVRRNYLVDCDAVSVAEAKI |
| Ga0117901_13127302 | 3300009103 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNEWLKDSPFVFE |
| Ga0114993_103969632 | 3300009409 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVSV |
| Ga0114997_103616772 | 3300009425 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVA |
| Ga0115554_11108301 | 3300009472 | Pelagic Marine | MFVEEIQTKNGVKEKRVRKNYLVDCEAVSVAETKINE |
| Ga0115555_14178233 | 3300009476 | Pelagic Marine | MYFEAQVVFIEEIATKNGTREKKTRRHFLVECDSVS |
| Ga0114933_101407241 | 3300009703 | Deep Subsurface | MYYEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNEWLKT |
| Ga0115000_107325271 | 3300009705 | Marine | MYFEVQVMFVEEIQTKNGVKEKKIRKNYLVQCDSVTV |
| Ga0115002_107061442 | 3300009706 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVSVAEAKVTEFLKDSAFF |
| Ga0115001_103640462 | 3300009785 | Marine | MFVEEIQTKNGVKEKKVRRNYLVDCEAVSVAETKMNE |
| Ga0114999_113424612 | 3300009786 | Marine | MYFEVQVIFVEEIQTKNGVKEKKIRKNYLVQCDSVTVAEAKI |
| Ga0115012_101079827 | 3300009790 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAE |
| Ga0098056_12873461 | 3300010150 | Marine | MFEVTVIFIEEIATKNGVKEKKIRRNYLVTECDSVSVAEAKIHEYLKDSAYPFE |
| Ga0098047_102405922 | 3300010155 | Marine | MYYEATVIFIEEIQMKNGVKEKKVRKTYLVECDSVSVAESKVNE |
| Ga0151674_11007321 | 3300011252 | Marine | MFVEEIQTKNGVKEKRVRRNYLVDCDAVSVAEAKINEYLKD |
| Ga0129350_10054321 | 3300012523 | Aqueous | MYFEVQVIFTEEIQTKSGIREKQRRKHLLVECDSVTVAEATVN |
| Ga0160423_100808835 | 3300012920 | Surface Seawater | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSV |
| Ga0163111_113673581 | 3300012954 | Surface Seawater | MYFEATVVFIEEIQTKNGVREKKVRKTYLVECDSISVAEAKVNE |
| Ga0181377_10501971 | 3300017706 | Marine | MYYEVQVVFTEEIPTKNGFREKKLRKSFLVECMSVSVAEAKVNEFL |
| Ga0181383_10397024 | 3300017720 | Seawater | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAENKVREWLK |
| Ga0181398_10082817 | 3300017725 | Seawater | MYFEVQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEAK |
| Ga0181401_10614822 | 3300017727 | Seawater | MYFEVQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEA |
| Ga0181416_10760592 | 3300017731 | Seawater | MYFEVQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEAKVNE |
| Ga0181426_11216022 | 3300017733 | Seawater | MYYEVNVVFTEEIPTKNGFRVKKIRKSFLVECMSVSVAEAKVNE |
| Ga0181433_10854663 | 3300017739 | Seawater | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECEACSVAENKVREWLKNSPF |
| Ga0181397_10094235 | 3300017744 | Seawater | MYYEVQVMFVEEIQTKNGVKEKRVRKYYLVECDAVS |
| Ga0181392_12396261 | 3300017749 | Seawater | MYYEVQVMFVEEIQTKNGVKEKRVRKNYLVDCEAVSVAETKINEY |
| Ga0181422_10791581 | 3300017762 | Seawater | MYFEAQVVFTEEIPTKNGVREKKTRRNFLVECDSVS |
| Ga0181430_12461582 | 3300017772 | Seawater | MYYEVQVVFTEEIATKNSVREKKTRRAFLVECDSVSVAEA |
| Ga0181572_108501101 | 3300018049 | Salt Marsh | MYYEAQVVFTEEIPTKNGVREKRTRRSFLVECDSVSV |
| Ga0181592_102619144 | 3300018421 | Salt Marsh | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKV |
| Ga0181592_105254081 | 3300018421 | Salt Marsh | MYYEAQVVFVEEIPTKNGVREKRTRRAFLVECDSVSVAEAKVNEVL |
| Ga0181591_107276433 | 3300018424 | Salt Marsh | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSV |
| Ga0181591_110278741 | 3300018424 | Salt Marsh | MYYEAQVVFTEEIPTKNGVREKRTRRSFLVECDSVSVAEAKVN |
| Ga0194029_10040625 | 3300019751 | Freshwater | MYYEVQVVFTEEIPIKYGFREKKSRKTFLVECVSVSI |
| Ga0194024_10297084 | 3300019765 | Freshwater | MYREYYYEVNVVFTEEIPTKNGFREKKLRRSFLVECMSVSVAEAKVNE |
| Ga0211684_10321512 | 3300020304 | Marine | MYFEVQVIFVEEIQTKNGIKEKKIRKNYLVKCDSVTVAEAKI |
| Ga0211628_10641902 | 3300020311 | Marine | MYYEAQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAEAKVNEFLKDSAFFFEV |
| Ga0211527_102170312 | 3300020378 | Marine | MYFEATVVFIEEIQMKNGVKEKKVRRSYLVECDSV |
| Ga0211678_101569001 | 3300020388 | Marine | MFFEATVVFIEEIQMKNGVKEKKVRRSYLVECDSVTVAEAKVNEWVK |
| Ga0211617_104844191 | 3300020401 | Marine | MYYEAQVVFVEEIPTKNGVREKKTRRSFLVECDSVSVAEAKVN |
| Ga0211499_100583433 | 3300020402 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRSYLVECDSV |
| Ga0211532_102884452 | 3300020403 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAENK |
| Ga0211587_101433092 | 3300020411 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRSYLVECDSVTVA |
| Ga0211587_102435111 | 3300020411 | Marine | MTYYETQVIFTEEIPTKNGVKEKKTRRNFLVECDSVSVAEA |
| Ga0211644_100938611 | 3300020416 | Marine | MYYEAQVVFVEEIPTKNGVREKKTRRAFLVECDSVSVA |
| Ga0211528_101945221 | 3300020417 | Marine | MTYFEAQVIFIEEIATKNGTREKKVRQHYLVECDSVTVAEAKVNEYLKDS |
| Ga0211539_103976442 | 3300020437 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRNYLVECDSVTVAEAK |
| Ga0211638_101015294 | 3300020448 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAESKVREWLKDSPFAFD |
| Ga0211642_105263823 | 3300020449 | Marine | MYYEAQVVFTEEIPTKNGVREKKTRRSFLVECDSV |
| Ga0211543_101578262 | 3300020470 | Marine | MYYEAQVVFVEEIPTKNGVREKKTRRAFLVECDSVSVAEAKVNEM |
| Ga0211543_102402682 | 3300020470 | Marine | MYFEATVVFIEEIQMKNGVKEKKVRRSYLVECDSVSVAEAKVN |
| Ga0211543_105339732 | 3300020470 | Marine | MYFEAQVIFTEEIPTKNGVKEKKTRKAFLVECDSVSVA |
| Ga0211503_100378585 | 3300020478 | Marine | MYYEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNEW |
| Ga0211503_103230802 | 3300020478 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNEWLKTSPFAFE |
| Ga0222717_101881621 | 3300021957 | Estuarine Water | MYYEVAVVFTEEIQTKNGVREKKVTKNYLVECFAVTAAEAKISEYL |
| Ga0212030_10448521 | 3300022053 | Aqueous | MYFEVQVIFTEEIQTKSGIREKQRRKHLLVECDSVTVAEATVNSYLKDA |
| (restricted) Ga0233428_10328211 | 3300022888 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVSVAEAK |
| Ga0255751_102129641 | 3300023116 | Salt Marsh | MYYEVNVVFTEEIPTKNGFREKKLRKSFLVECMSV |
| (restricted) Ga0233440_10160405 | 3300024258 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSV |
| (restricted) Ga0233440_10191234 | 3300024258 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVSVAEAKVTEFLKDSAF |
| (restricted) Ga0233449_10260401 | 3300024302 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVSVA |
| (restricted) Ga0233443_12762581 | 3300024324 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAEAKV |
| (restricted) Ga0233447_11134852 | 3300024336 | Seawater | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAEAKVTE |
| Ga0209992_100134531 | 3300024344 | Deep Subsurface | MYYEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNE |
| Ga0208298_10884502 | 3300025084 | Marine | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKVNEF |
| Ga0208666_10084861 | 3300025102 | Marine | MYYEVQVLFIEEVQVKNGTKEKKVRKNYLVECDACSVAETKVREWLKNSPF |
| Ga0208013_10458161 | 3300025103 | Marine | MTYYETQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEAKVNETL |
| Ga0208793_11716902 | 3300025108 | Marine | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAK |
| Ga0208790_10945851 | 3300025118 | Marine | MYFETQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEAKVNE |
| Ga0209348_10968283 | 3300025127 | Marine | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKVNE |
| Ga0209348_11550241 | 3300025127 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRSYLVECDSVTVAEAK |
| Ga0209348_11718882 | 3300025127 | Marine | MYYEVQVVFIEEIQTKNGVREKKVRENYLVECDAVSVAEAKVME |
| Ga0208919_12150941 | 3300025128 | Marine | MFFEATVVFIEEIQMKNGVKEKKVRRSYLVECDSVTV |
| Ga0209232_11798421 | 3300025132 | Marine | MYFEAQVIFTEEIPTKNGIKEKKTRRNFLVECDSVSVAE |
| Ga0209336_101343272 | 3300025137 | Marine | MYYEVQVMFVEEIQTKNGVKEKRVRKYYLVECDAVSVAEAKIT |
| Ga0208149_10805481 | 3300025610 | Aqueous | MYFEVQVIFTEEIQTKSGIREKQRRKHLLVECDSVTVAEATVNNYLKDA |
| Ga0208643_10267724 | 3300025645 | Aqueous | MYYEVAVVFTEEIQTKNGVREKKTTKNYLVECFAVTAA |
| Ga0209047_10994191 | 3300025727 | Marine | MYFEATVIFIEEIQTKNGVKEKKVRKTYLVECDSVSVAESKVNEWLKTS |
| Ga0208425_10183981 | 3300025803 | Aqueous | MYREYYYEVNVVFTEEIPTKNGFREKKLRRSFLVECMSVSVAEAKV |
| Ga0208425_11086631 | 3300025803 | Aqueous | MYYEVNVVFTEEIPTKNGFREKKIRKSFLVECMSVSVAEAKVNEFLKDSPN |
| Ga0208545_10799084 | 3300025806 | Aqueous | MFEVNVIFIEEIATKNGVKEKKIRRNYLVMNCDTVSVAEAKIYEHLKDSAYP |
| Ga0208407_11960401 | 3300026257 | Marine | MYYEATVVFIEEIQTKNGVKEKKVRKTYLVECDSVSVAEAKVNEWLKTSPFAFE |
| Ga0208764_102524702 | 3300026321 | Marine | MYFEATVVFIEEIQTKNGVKEKKVRRVYLVECDSVS |
| Ga0209710_11455581 | 3300027687 | Marine | MYFEVQVIFVEEIQTKNGVKEKKIRKNYLVQCDSVTVAEAKINEYL |
| Ga0209089_101184023 | 3300027838 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLIECDSVS |
| Ga0209403_104589271 | 3300027839 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSV |
| Ga0209501_103779021 | 3300027844 | Marine | MYYETQVVFTEEIDTKNGVKEKKVRRNYLVECDSVSVAEAIVTEF |
| Ga0209404_101265481 | 3300027906 | Marine | MYYEAQVVFVEEIPTKNGVREKKTRRAFLVECDSVS |
| Ga0256397_10002081 | 3300028436 | Seawater | MSYYEVQVVFIEEIQTKNGSKEKKVRRNYLVECDSA |
| Ga0183748_10426211 | 3300029319 | Marine | MYYEAQVVFIEEIPTKNGVREKKTRRAFLVECDSVSVA |
| Ga0308010_12678592 | 3300031510 | Marine | MYYEVAVVFKEEIQTKNGVREKKTTKNYLVECFAVTAA |
| Ga0302137_12197721 | 3300031588 | Marine | MYFEAQVIFIEEIQTKNGTREKKVRRHYLVECDSVTVAETKVNEHLK |
| Ga0302122_100713921 | 3300031675 | Marine | MYFEAQVIFIEEIQTKNGTREKKVRRHYLVECDSVT |
| Ga0307998_10762071 | 3300031702 | Marine | MYFEVQVIFVEEIQTKNGIKEKKIRKNYLVECDSVTVAEAKINEHLKDSHFPF |
| Ga0315318_102946012 | 3300031886 | Seawater | MYYEATVVFIEEIQMKNGVKEKKVRKTYLVECDSVSVAESKVNEWLKDS |
| Ga0315327_102103411 | 3300032032 | Seawater | MFEVNVIFIEEIATKNGVKEKKIRRNYLVMNCDTVSVAEAKIYEHL |
| Ga0315330_100540125 | 3300032047 | Seawater | MYYEVQVMFVEEIQTKNGVKEKRVRKYYLVECDAVSV |
| Ga0315336_12200442 | 3300032132 | Seawater | MYFETQVIFTEEIPTKNGVREKKTRRAFLVECDSVSVAEAKVNELLK |
| ⦗Top⦘ |