


| Basic Information | |
|---|---|
| Family ID | F075300 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMGPIK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 37.29 % |
| % of genes near scaffold ends (potentially truncated) | 90.76 % |
| % of genes from short scaffolds (< 2000 bps) | 90.76 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.261 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.210 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 4.20 |
| PF01548 | DEDD_Tnp_IS110 | 1.68 |
| PF08388 | GIIM | 1.68 |
| PF07505 | DUF5131 | 0.84 |
| PF01996 | F420_ligase | 0.84 |
| PF04392 | ABC_sub_bind | 0.84 |
| PF00665 | rve | 0.84 |
| PF02371 | Transposase_20 | 0.84 |
| PF02899 | Phage_int_SAM_1 | 0.84 |
| PF03928 | HbpS-like | 0.84 |
| PF00872 | Transposase_mut | 0.84 |
| PF13358 | DDE_3 | 0.84 |
| PF13683 | rve_3 | 0.84 |
| PF09361 | Phasin_2 | 0.84 |
| PF08714 | Fae | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.52 |
| COG1478 | F420-0:Gamma-glutamyl ligase (F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.84 |
| COG1795 | Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase) | Energy production and conversion [C] | 0.84 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.84 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.84 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.84 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.84 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.84 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.84 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.26 % |
| All Organisms | root | All Organisms | 48.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000816|AF_2010_repII_A10DRAFT_1002847 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300001160|JGI12654J13325_1009274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_105329910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 549 | Open in IMG/M |
| 3300005166|Ga0066674_10259480 | Not Available | 822 | Open in IMG/M |
| 3300005174|Ga0066680_10887635 | Not Available | 530 | Open in IMG/M |
| 3300005332|Ga0066388_100494303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1860 | Open in IMG/M |
| 3300005563|Ga0068855_102373025 | Not Available | 530 | Open in IMG/M |
| 3300005578|Ga0068854_100065637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2639 | Open in IMG/M |
| 3300005591|Ga0070761_10770277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 605 | Open in IMG/M |
| 3300005618|Ga0068864_102069571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005947|Ga0066794_10136640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300006046|Ga0066652_100690352 | Not Available | 971 | Open in IMG/M |
| 3300006052|Ga0075029_101239297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300006055|Ga0097691_1014328 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300006169|Ga0082029_1719468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006173|Ga0070716_101650911 | Not Available | 527 | Open in IMG/M |
| 3300006174|Ga0075014_100858333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300006796|Ga0066665_10917912 | Not Available | 677 | Open in IMG/M |
| 3300006796|Ga0066665_11280178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300006797|Ga0066659_11708498 | Not Available | 531 | Open in IMG/M |
| 3300006950|Ga0075524_10170613 | Not Available | 945 | Open in IMG/M |
| 3300006954|Ga0079219_10446556 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300009036|Ga0105244_10509698 | Not Available | 554 | Open in IMG/M |
| 3300009519|Ga0116108_1260313 | Not Available | 506 | Open in IMG/M |
| 3300009548|Ga0116107_1110210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300009617|Ga0116123_1034114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
| 3300009665|Ga0116135_1036326 | Not Available | 1696 | Open in IMG/M |
| 3300009824|Ga0116219_10528882 | Not Available | 651 | Open in IMG/M |
| 3300010046|Ga0126384_12374864 | Not Available | 513 | Open in IMG/M |
| 3300010047|Ga0126382_11007937 | Not Available | 730 | Open in IMG/M |
| 3300010049|Ga0123356_12551563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 640 | Open in IMG/M |
| 3300010112|Ga0127458_1071949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300010366|Ga0126379_11493069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300010366|Ga0126379_12065998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300010376|Ga0126381_100314110 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300010376|Ga0126381_104667719 | Not Available | 528 | Open in IMG/M |
| 3300010376|Ga0126381_104872122 | Not Available | 516 | Open in IMG/M |
| 3300010399|Ga0134127_12727516 | Not Available | 574 | Open in IMG/M |
| 3300011089|Ga0138573_1045140 | Not Available | 602 | Open in IMG/M |
| 3300012210|Ga0137378_11803897 | Not Available | 516 | Open in IMG/M |
| 3300012285|Ga0137370_10681572 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012357|Ga0137384_10884257 | Not Available | 720 | Open in IMG/M |
| 3300012363|Ga0137390_11186538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera | 711 | Open in IMG/M |
| 3300012381|Ga0134026_1038543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012397|Ga0134056_1341400 | Not Available | 858 | Open in IMG/M |
| 3300012399|Ga0134061_1281282 | Not Available | 651 | Open in IMG/M |
| 3300012961|Ga0164302_11925208 | Not Available | 504 | Open in IMG/M |
| 3300012971|Ga0126369_11697227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 721 | Open in IMG/M |
| 3300013307|Ga0157372_10118342 | Not Available | 3040 | Open in IMG/M |
| 3300013308|Ga0157375_12810137 | Not Available | 582 | Open in IMG/M |
| 3300014501|Ga0182024_10942678 | Not Available | 1036 | Open in IMG/M |
| 3300016270|Ga0182036_11055572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 671 | Open in IMG/M |
| 3300016270|Ga0182036_11480477 | Not Available | 569 | Open in IMG/M |
| 3300016357|Ga0182032_10062004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2483 | Open in IMG/M |
| 3300016357|Ga0182032_11241204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300016357|Ga0182032_11868464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300016404|Ga0182037_11594209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 580 | Open in IMG/M |
| 3300016422|Ga0182039_10677213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300016445|Ga0182038_11585477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 589 | Open in IMG/M |
| 3300016445|Ga0182038_12189636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 501 | Open in IMG/M |
| 3300017947|Ga0187785_10347523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300017959|Ga0187779_11041562 | Not Available | 569 | Open in IMG/M |
| 3300018033|Ga0187867_10004046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11481 | Open in IMG/M |
| 3300018465|Ga0190269_11261355 | Not Available | 587 | Open in IMG/M |
| 3300018465|Ga0190269_11810595 | Not Available | 521 | Open in IMG/M |
| 3300019881|Ga0193707_1170074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300020082|Ga0206353_11503239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300020580|Ga0210403_11226650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300021168|Ga0210406_10963332 | Not Available | 637 | Open in IMG/M |
| 3300021168|Ga0210406_11328544 | Not Available | 516 | Open in IMG/M |
| 3300021168|Ga0210406_11381964 | Not Available | 503 | Open in IMG/M |
| 3300021406|Ga0210386_11683616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300022527|Ga0242664_1137308 | Not Available | 531 | Open in IMG/M |
| 3300022531|Ga0242660_1129470 | Not Available | 644 | Open in IMG/M |
| 3300022886|Ga0247746_1140285 | Not Available | 612 | Open in IMG/M |
| 3300025481|Ga0208079_1097864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300025891|Ga0209585_10305608 | Not Available | 638 | Open in IMG/M |
| 3300025915|Ga0207693_10059550 | Not Available | 2991 | Open in IMG/M |
| 3300025927|Ga0207687_11371168 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025972|Ga0207668_10054432 | Not Available | 2777 | Open in IMG/M |
| 3300026121|Ga0207683_11167492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300026271|Ga0209880_1121607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300026272|Ga0209913_1105954 | Not Available | 581 | Open in IMG/M |
| 3300026309|Ga0209055_1241577 | Not Available | 557 | Open in IMG/M |
| 3300026868|Ga0207818_1021158 | Not Available | 572 | Open in IMG/M |
| 3300027094|Ga0208094_109321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027324|Ga0209845_1040664 | Not Available | 739 | Open in IMG/M |
| 3300027884|Ga0209275_10880093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300028381|Ga0268264_11921894 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300028710|Ga0307322_10233361 | Not Available | 508 | Open in IMG/M |
| 3300030007|Ga0311338_12011317 | Not Available | 513 | Open in IMG/M |
| 3300030688|Ga0311345_11145979 | Not Available | 570 | Open in IMG/M |
| 3300030831|Ga0308152_113683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 531 | Open in IMG/M |
| 3300031094|Ga0308199_1122920 | Not Available | 593 | Open in IMG/M |
| 3300031423|Ga0308177_1023774 | Not Available | 557 | Open in IMG/M |
| 3300031561|Ga0318528_10632416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 573 | Open in IMG/M |
| 3300031561|Ga0318528_10701649 | Not Available | 541 | Open in IMG/M |
| 3300031573|Ga0310915_10567140 | Not Available | 805 | Open in IMG/M |
| 3300031640|Ga0318555_10516121 | Not Available | 647 | Open in IMG/M |
| 3300031668|Ga0318542_10108673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
| 3300031679|Ga0318561_10362969 | Not Available | 794 | Open in IMG/M |
| 3300031719|Ga0306917_11277644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031720|Ga0307469_10652420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300031748|Ga0318492_10243596 | Not Available | 928 | Open in IMG/M |
| 3300031751|Ga0318494_10677227 | Not Available | 603 | Open in IMG/M |
| 3300031753|Ga0307477_10016828 | All Organisms → cellular organisms → Bacteria | 4992 | Open in IMG/M |
| 3300031860|Ga0318495_10465659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 553 | Open in IMG/M |
| 3300031890|Ga0306925_10107281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
| 3300031894|Ga0318522_10368203 | Not Available | 544 | Open in IMG/M |
| 3300031954|Ga0306926_10432638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium neotropicale | 1622 | Open in IMG/M |
| 3300031954|Ga0306926_12099693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300032001|Ga0306922_10768336 | Not Available | 1009 | Open in IMG/M |
| 3300032001|Ga0306922_11551793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300032060|Ga0318505_10535695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 551 | Open in IMG/M |
| 3300032064|Ga0318510_10431945 | Not Available | 564 | Open in IMG/M |
| 3300032075|Ga0310890_11529338 | Not Available | 550 | Open in IMG/M |
| 3300032076|Ga0306924_12567263 | Not Available | 509 | Open in IMG/M |
| 3300033290|Ga0318519_10234357 | Not Available | 1057 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.36% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.84% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.84% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027094 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A10DRAFT_10028471 | 3300000816 | Forest Soil | VKARNHLRVASALPHSEGIAYKPLCGEIAMCPRVGRMGSIK* |
| JGI12654J13325_10092742 | 3300001160 | Forest Soil | KEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK* |
| JGIcombinedJ13530_1053299101 | 3300001213 | Wetland | MECAVKARNCSRVASALPHSEGITYKPPCGEIAMCLRVGR |
| Ga0066674_102594801 | 3300005166 | Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK* |
| Ga0066680_108876351 | 3300005174 | Soil | AKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK* |
| Ga0066388_1004943031 | 3300005332 | Tropical Forest Soil | AKARNRSRVASALPHSEGSTYKSPCDEVVLCPRVGADGAE* |
| Ga0068855_1023730251 | 3300005563 | Corn Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVG |
| Ga0068854_1000656371 | 3300005578 | Corn Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVGRM |
| Ga0070761_107702771 | 3300005591 | Soil | RVASALPHSEGIAYKPLCGEIAMCPRVGRMGPIK* |
| Ga0068864_1020695711 | 3300005618 | Switchgrass Rhizosphere | NHSRVASALPHSEGIAYKPPCGEIAMCARVGRMGSIK* |
| Ga0066794_101366401 | 3300005947 | Soil | KECAVKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMRPIK* |
| Ga0066652_1006903523 | 3300006046 | Soil | AAKARNHSRVASALPHSEGIAYKPNGEIAMCPRVGRMGPIK* |
| Ga0075029_1012392971 | 3300006052 | Watersheds | HSRVAEALPHSEGVTHKPPCGEIVTCLRVGQMGSIK* |
| Ga0097691_10143286 | 3300006055 | Arctic Peat Soil | VKARNHSRVASALPHSEGIAYKPLCGEIAMCLRVGRMGPIK* |
| Ga0082029_17194681 | 3300006169 | Termite Nest | QDGIGAKARNHARVASALPHSEGIASKAPCGEVAMCSRVGRMGSIK* |
| Ga0070716_1016509112 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSEARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK* |
| Ga0075014_1008583332 | 3300006174 | Watersheds | AKKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK* |
| Ga0066665_109179121 | 3300006796 | Soil | EGMVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK* |
| Ga0066665_112801782 | 3300006796 | Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGR |
| Ga0066659_117084981 | 3300006797 | Soil | RKEWTAKARNHPRVASALPHSEGIAYKPPSSEVAMCSRVERMGSIK* |
| Ga0075524_101706132 | 3300006950 | Arctic Peat Soil | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRM |
| Ga0079219_104465561 | 3300006954 | Agricultural Soil | VAKARNHAWVASALPHSEGIAYKPSYGEVAMRPRVGRMGPVRAVSG* |
| Ga0105244_105096981 | 3300009036 | Miscanthus Rhizosphere | MGVKARNHARVASALPHSEGIAYKPPCGEVAMCRRV |
| Ga0116108_12603131 | 3300009519 | Peatland | VKARNHSRVASALPHSEGIAYKPPCGEIAMRLRVG |
| Ga0116107_11102101 | 3300009548 | Peatland | TAKAGNQSRVAEAETHSEGMAYKPQSGEIAMCPRVGRMRPNK* |
| Ga0116123_10341141 | 3300009617 | Peatland | RVAEAETHSEGMAYKPQSGEIAMCPRVGRMRPNKLGWFGTA* |
| Ga0116135_10363261 | 3300009665 | Peatland | RNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMGSIK* |
| Ga0116219_105288821 | 3300009824 | Peatlands Soil | VKARNHSRAASALPHSEGIAYKPLCGEIAMCPRVGRMG |
| Ga0126384_123748641 | 3300010046 | Tropical Forest Soil | ECAAKARNHSRVASALPHSEGIAYKPLCGEIAMCPRVARMGSIKW* |
| Ga0126382_110079372 | 3300010047 | Tropical Forest Soil | RNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK* |
| Ga0123356_125515631 | 3300010049 | Termite Gut | DKEEWSAKARNHSRVALALPHSEGIAYKLPCGEIAMCLRAGRMGPSK* |
| Ga0127458_10719491 | 3300010112 | Grasslands Soil | CQDGMVAKARNHSRVASALPHSEGIAYKPPCGEIAMCPRVGRMGPIK* |
| Ga0126379_114930691 | 3300010366 | Tropical Forest Soil | KKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMRSRVGRMGSIK* |
| Ga0126379_120659981 | 3300010366 | Tropical Forest Soil | ARNHSRVASALPHSEGIAYKPLCGEIAMCRRVGRMGSIKW* |
| Ga0126381_1003141101 | 3300010376 | Tropical Forest Soil | SRVASALPHSEGIAYKPLRGEIAMCLRVGRMGSIK* |
| Ga0126381_1046677192 | 3300010376 | Tropical Forest Soil | VKARNHSRVAEALPHSEGIAYKPLCGEIAMCLRVGRMGPIK* |
| Ga0126381_1048721221 | 3300010376 | Tropical Forest Soil | SRVASALLHSEGIAYKPPCGEIAMCLRVGRMGSVK* |
| Ga0134127_127275162 | 3300010399 | Terrestrial Soil | MVAKARNHSRVASALPHSEGIAYKPSYGEVAMCLRVGRMGPVKRGRT |
| Ga0138573_10451401 | 3300011089 | Peatlands Soil | VKARNHSRAASALPHSEGIAYKPPCGEIAMCLRVGRMG |
| Ga0137378_118038971 | 3300012210 | Vadose Zone Soil | RVASALPHSEGIAYKPPCGEIAVCPRVGRMGSIK* |
| Ga0137370_106815721 | 3300012285 | Vadose Zone Soil | KARNRSRVAPALPHSEGIAYKPPCGEIAMCPRVGRMGPIK* |
| Ga0137384_108842571 | 3300012357 | Vadose Zone Soil | VKARNHSRVAKALPYSEDIAYKPPCGEIAVCLRVGRMRPIS |
| Ga0137390_111865382 | 3300012363 | Vadose Zone Soil | AKARNHSRVASALPHSEDIAYKPLRGEIAMCLRVGRMGSIK* |
| Ga0134026_10385431 | 3300012381 | Grasslands Soil | TACQDGMVAKARNHSRVASALPHSEGIAYKPSYGEVAMCPRVGRMGPVK* |
| Ga0134056_13414002 | 3300012397 | Grasslands Soil | RNRSRVASALPHSEGIAYKPPCGEIAMCPRVGRMGPIK* |
| Ga0134061_12812822 | 3300012399 | Grasslands Soil | VKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVGRMGPAKR |
| Ga0164302_119252081 | 3300012961 | Soil | SRVASALPHSEGIAYKPPCGEIAMCLRVGRMGPIK* |
| Ga0126369_116972271 | 3300012971 | Tropical Forest Soil | ARIHSRVASALPHSEGIAYKPLCGEIAMCLRVGRMRSIK* |
| Ga0157372_101183422 | 3300013307 | Corn Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMGPIK* |
| Ga0157375_128101371 | 3300013308 | Miscanthus Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEIAMCPRVGRMGPI |
| Ga0182024_109426782 | 3300014501 | Permafrost | KARNHSWVASALPHSEGIAYKPLCGEIAMCPRVGRMGPIKR* |
| Ga0182036_110555721 | 3300016270 | Soil | VKARIHSRVASALPHSEDIAYKPPSGGIEMCSRVRRLGKTK |
| Ga0182036_114804771 | 3300016270 | Soil | ARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK |
| Ga0182032_100620041 | 3300016357 | Soil | MECAVKAGNHSRVASALPHSEGIAYKPPCGEIAVCLRAGRMG |
| Ga0182032_112412041 | 3300016357 | Soil | AKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMRPTK |
| Ga0182032_118684641 | 3300016357 | Soil | HSRVASALPHSEGIAYKPPCGEIAMCLRVGRMGSVK |
| Ga0182037_115942091 | 3300016404 | Soil | VKARIHSRVASALPHSEDIAYKPPSGEIAMCSRVGRMGST |
| Ga0182039_106772131 | 3300016422 | Soil | KARNHPRVASALPHSEGIAFKPPCGEIAMCSRVGRMGSIK |
| Ga0182038_115854772 | 3300016445 | Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSI |
| Ga0182038_121896361 | 3300016445 | Soil | VKARNHPRVASALPHSEGIAYKPPCGEIAMCLRVGRMGS |
| Ga0187785_103475231 | 3300017947 | Tropical Peatland | AEKEWSAKARNHPRVASALPHSEGIAYKTQCGEIAMCSRVGRMGSIK |
| Ga0187779_110415621 | 3300017959 | Tropical Peatland | AKARNRARVASALPHSEGIAYKPLCGEIAVCPRVGRMGSIK |
| Ga0187867_1000404618 | 3300018033 | Peatland | VKARNHSRVASALPRSEGIAYKPPCGEIAMYLRVGRMRPIK |
| Ga0190269_112613551 | 3300018465 | Soil | RTECQDGMTAKARNYSRVASALPHSEGIAYKLPCSEIAMCSRVGRMGSTK |
| Ga0190269_118105951 | 3300018465 | Soil | MTAKARNYSRVASALPHSEGLAYKPSYGEVAMCRRVGRMGPV |
| Ga0193707_11700741 | 3300019881 | Soil | SAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0206353_115032391 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVG |
| Ga0210403_112266501 | 3300020580 | Soil | RHAKKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0210406_109633321 | 3300021168 | Soil | VKARNHLRVASALPHSEGIAYKPPCGEIAMCLRVGRM |
| Ga0210406_113285441 | 3300021168 | Soil | VKARNHSRVASALLHSEGIAYKPPCGEIAMCPRVGR |
| Ga0210406_113819641 | 3300021168 | Soil | VKARNHSWVASALPHSEGNAYKPQCGEIALCPSQRRPD |
| Ga0210386_116836161 | 3300021406 | Soil | HRERHAKKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0242664_11373081 | 3300022527 | Soil | VKARNHSRVASALLRSEGIAYKPPCGEIAMCLRVGRMRP |
| Ga0242660_11294702 | 3300022531 | Soil | ALPHSEGIAYKPLCGEIAMCSRVGRMGSITIVSAD |
| Ga0247746_11402851 | 3300022886 | Soil | MVAKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVGRMGP |
| Ga0208079_10978641 | 3300025481 | Arctic Peat Soil | HSRVASALPHSEGIAYKPFYGEIAMCLRVGRMGPSK |
| Ga0209585_103056081 | 3300025891 | Arctic Peat Soil | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGR |
| Ga0207693_100595502 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMRPIK |
| Ga0207687_113711681 | 3300025927 | Miscanthus Rhizosphere | MGVKARNHSRVASALPHSEGIAYKPPCGEVAMCLRVGRM |
| Ga0207668_100544322 | 3300025972 | Switchgrass Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMGPIK |
| Ga0207683_111674921 | 3300026121 | Miscanthus Rhizosphere | KKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSSK |
| Ga0209880_11216071 | 3300026271 | Soil | KECAVKARNHLRVASALPHSEGIAYKPPCGEIAMCLRVGRMRPIK |
| Ga0209913_11059541 | 3300026272 | Soil | VKARNHSRVASALPHSEGIAYKPPCGEIAMCLRVGRMG |
| Ga0209055_12415771 | 3300026309 | Soil | PRVASALPHSEGIAYKPPSSEVAMCSRVERMGSIK |
| Ga0207818_10211581 | 3300026868 | Tropical Forest Soil | VKARNRSRVAEALPHSEGIAYKPPCGEITMCLRAGRMGPIK |
| Ga0208094_1093211 | 3300027094 | Forest Soil | ARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0209845_10406641 | 3300027324 | Groundwater Sand | ETEQAVKARNHSSVAEALPHSEGSAYKPLCGEIALCRQVGRMGPGKR |
| Ga0209275_108800931 | 3300027884 | Soil | KEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0268264_119218941 | 3300028381 | Switchgrass Rhizosphere | VKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVGRMGPVKRGR |
| Ga0307322_102333611 | 3300028710 | Soil | AKARNHPRIASALPHSEGIAYKLPSSEIAMCPRVGRMGSIK |
| Ga0311338_120113171 | 3300030007 | Palsa | VKARNRSRVASALPHSEGIAYKPLCGEIAMCLRAGRMGP |
| Ga0311345_111459792 | 3300030688 | Bog | ARNHSRVASALPHSEDIAYKPPRGEIAMCLRVGRMGSIK |
| Ga0308152_1136831 | 3300030831 | Soil | VKARNHSRVASALPHSEGIAYKPPCGEVAMCRRVGRMGPVK |
| Ga0308199_11229201 | 3300031094 | Soil | KKEWSAKARNHPRVASALPHSEGIAYKPLCGEIAMCSRVGRMGSIK |
| Ga0308177_10237741 | 3300031423 | Soil | MVAKARNHSRVASALPHSEGIAYKPPCGEVAMCPRVGRMGPV |
| Ga0318528_106324161 | 3300031561 | Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVG |
| Ga0318528_107016491 | 3300031561 | Soil | GHRERHAKKEWSAKARNHPRVASALPHSEGIAYKLLCSEIAMCPRVGRMGSIK |
| Ga0310915_105671401 | 3300031573 | Soil | VKARNHSRVAEALPHSEGIAYKPLCGEIAMCLRVGRMGPIK |
| Ga0318555_105161212 | 3300031640 | Soil | KERAVKARNHSRVAEALPHSEGIAYKPLCGEITMCPRVGRMGPIKW |
| Ga0318542_101086731 | 3300031668 | Soil | VRKEWAAKARNHSRVASALPHSEGIAYKPLCGEIAMCPQVGRRSIK |
| Ga0318561_103629691 | 3300031679 | Soil | ECTAKARNHSGVAEALPHSEGIAYKPPCGEIAVCPRVGRMGSIK |
| Ga0306917_112776441 | 3300031719 | Soil | RHAKKVWSVKARNHPRVASALPHSEGIAYKLPCSEIAMCSRVGRMGSVK |
| Ga0307469_106524202 | 3300031720 | Hardwood Forest Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK |
| Ga0318492_102435961 | 3300031748 | Soil | RMECAVKARNHSRVASALPHSEGIAYKPPCGEIAVCLRVGRMGSIK |
| Ga0318494_106772271 | 3300031751 | Soil | RERHAKKEWSAKARNHPRVASALPHSEGIAYKLLCSEIAMCPRVGRMGSIK |
| Ga0307477_100168286 | 3300031753 | Hardwood Forest Soil | CLGIGAHALMHSEDISYKPPSGEVELCLRVGRMGSIK |
| Ga0318517_105151341 | 3300031835 | Soil | PRGHRERHAKKEWSAKARNHPRVASALPHSEGIAYKLLCSEIAMCPRVGRMGSIK |
| Ga0318495_104656591 | 3300031860 | Soil | MVAKARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMG |
| Ga0306925_101072814 | 3300031890 | Soil | VKARNHLRVASALPHSEGIAYKPLCGEIAMCPQVGRMGSIK |
| Ga0318522_103682031 | 3300031894 | Soil | AKARNHSRVAEALPHSEGIAYKPLCGEIAMCLRVGRMGPIK |
| Ga0306926_104326381 | 3300031954 | Soil | KARNRSRVADALPHSEGIAYKPPCGEIAVCLRAGRMGSIK |
| Ga0306926_120996931 | 3300031954 | Soil | RHAKKEWSAKARNHPRVASALPHSEGIAYKPLCGEIVMCSRVGRMGSIK |
| Ga0306922_107683361 | 3300032001 | Soil | RNHSRVASALPHSEGIAYKPPCGEIAVCLRVGRMGSIK |
| Ga0306922_115517931 | 3300032001 | Soil | KARNHPRVASALPHSEGIAYKPPCGEIAMCSRVGRMGSIK |
| Ga0318505_105356951 | 3300032060 | Soil | VKARNRSRVAEALPHSEGIAYKPPCGEITMCLRAGRMGPTK |
| Ga0318510_104319451 | 3300032064 | Soil | IHSRVASALPHSEDIAYKPPSGEVAMCPRVGRMGSIK |
| Ga0310890_115293381 | 3300032075 | Soil | VKARNHSRVASALPHSEGIAYKPPCGEIAMYLRVGRM |
| Ga0306924_125672631 | 3300032076 | Soil | MECAVKARNHSRVASALPHSEGIAYKPPCGEIAVCLRVGRMGS |
| Ga0318519_102343572 | 3300033290 | Soil | VKARNHLRVASALPHSEGIAYKPLCGEIAMCPRVGRMG |
| ⦗Top⦘ |