


| Basic Information | |
|---|---|
| Family ID | F075222 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.40 % |
| % of genes near scaffold ends (potentially truncated) | 92.44 % |
| % of genes from short scaffolds (< 2000 bps) | 89.92 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.597 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.933 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 2.70% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF02130 | YbeY | 72.27 |
| PF03462 | PCRF | 8.40 |
| PF13343 | SBP_bac_6 | 1.68 |
| PF09335 | SNARE_assoc | 1.68 |
| PF10017 | Methyltransf_33 | 1.68 |
| PF09084 | NMT1 | 0.84 |
| PF04365 | BrnT_toxin | 0.84 |
| PF13847 | Methyltransf_31 | 0.84 |
| PF13442 | Cytochrome_CBB3 | 0.84 |
| PF07679 | I-set | 0.84 |
| PF13751 | DDE_Tnp_1_6 | 0.84 |
| PF01850 | PIN | 0.84 |
| PF13711 | DUF4160 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 72.27 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 8.40 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 8.40 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.68 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.68 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.84 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.44 % |
| Unclassified | root | N/A | 7.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100863260 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300002407|C687J29651_10200026 | Not Available | 641 | Open in IMG/M |
| 3300003319|soilL2_10030525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3322 | Open in IMG/M |
| 3300004067|Ga0055485_10006426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1856 | Open in IMG/M |
| 3300004067|Ga0055485_10091331 | Not Available | 764 | Open in IMG/M |
| 3300004071|Ga0055486_10194468 | Not Available | 513 | Open in IMG/M |
| 3300004114|Ga0062593_100420673 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300004782|Ga0062382_10159148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 961 | Open in IMG/M |
| 3300005172|Ga0066683_10614870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 656 | Open in IMG/M |
| 3300005186|Ga0066676_10804417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 636 | Open in IMG/M |
| 3300005335|Ga0070666_10362532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1038 | Open in IMG/M |
| 3300005335|Ga0070666_11138484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300005344|Ga0070661_100297874 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005444|Ga0070694_100588761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 895 | Open in IMG/M |
| 3300005444|Ga0070694_100877866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 739 | Open in IMG/M |
| 3300005467|Ga0070706_100427322 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005471|Ga0070698_102198612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005518|Ga0070699_101563813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 604 | Open in IMG/M |
| 3300005530|Ga0070679_100067902 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
| 3300005539|Ga0068853_101419395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 672 | Open in IMG/M |
| 3300005549|Ga0070704_100344728 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005559|Ga0066700_10813815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 628 | Open in IMG/M |
| 3300005614|Ga0068856_101249170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 759 | Open in IMG/M |
| 3300005713|Ga0066905_100670263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 886 | Open in IMG/M |
| 3300005841|Ga0068863_102359569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300006173|Ga0070716_101035008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 651 | Open in IMG/M |
| 3300006196|Ga0075422_10266265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 725 | Open in IMG/M |
| 3300006794|Ga0066658_10307658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 847 | Open in IMG/M |
| 3300006846|Ga0075430_100360980 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300006871|Ga0075434_100767841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 981 | Open in IMG/M |
| 3300006871|Ga0075434_102161836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300007076|Ga0075435_100389823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1197 | Open in IMG/M |
| 3300009094|Ga0111539_10994854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 975 | Open in IMG/M |
| 3300009100|Ga0075418_10481067 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300009131|Ga0115027_11607410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300009147|Ga0114129_10761317 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300009156|Ga0111538_14079126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009166|Ga0105100_10313214 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300009176|Ga0105242_10937846 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009179|Ga0115028_12095438 | Not Available | 502 | Open in IMG/M |
| 3300009610|Ga0105340_1033197 | Not Available | 2005 | Open in IMG/M |
| 3300009799|Ga0105075_1048442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300009822|Ga0105066_1165678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300009823|Ga0105078_1016373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 831 | Open in IMG/M |
| 3300010043|Ga0126380_12133899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 516 | Open in IMG/M |
| 3300010396|Ga0134126_10063973 | All Organisms → cellular organisms → Bacteria | 4578 | Open in IMG/M |
| 3300010396|Ga0134126_11229835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 831 | Open in IMG/M |
| 3300010399|Ga0134127_10985337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 902 | Open in IMG/M |
| 3300010401|Ga0134121_10013492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6490 | Open in IMG/M |
| 3300011416|Ga0137422_1076583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 804 | Open in IMG/M |
| 3300011430|Ga0137423_1211926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300011433|Ga0137443_1072594 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300011435|Ga0137426_1008454 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
| 3300011441|Ga0137452_1099571 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012359|Ga0137385_11465534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 546 | Open in IMG/M |
| 3300012486|Ga0157331_1009158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 700 | Open in IMG/M |
| 3300012891|Ga0157305_10171748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300012915|Ga0157302_10056505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1127 | Open in IMG/M |
| 3300013296|Ga0157374_10056169 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300013306|Ga0163162_10965609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 963 | Open in IMG/M |
| 3300014300|Ga0075321_1060716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 693 | Open in IMG/M |
| 3300014870|Ga0180080_1059297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 647 | Open in IMG/M |
| 3300015256|Ga0180073_1083492 | Not Available | 680 | Open in IMG/M |
| 3300016357|Ga0182032_10208895 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300018028|Ga0184608_10386374 | Not Available | 610 | Open in IMG/M |
| 3300018059|Ga0184615_10011179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4895 | Open in IMG/M |
| 3300018072|Ga0184635_10276919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 662 | Open in IMG/M |
| 3300018077|Ga0184633_10230468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 954 | Open in IMG/M |
| 3300018082|Ga0184639_10229627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 983 | Open in IMG/M |
| 3300018084|Ga0184629_10191716 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300018422|Ga0190265_13583253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300018429|Ga0190272_10855905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 846 | Open in IMG/M |
| 3300019356|Ga0173481_10267086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 779 | Open in IMG/M |
| 3300019361|Ga0173482_10429151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300020579|Ga0210407_10982038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300021090|Ga0210377_10010434 | All Organisms → cellular organisms → Bacteria | 7214 | Open in IMG/M |
| 3300021344|Ga0193719_10323479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 644 | Open in IMG/M |
| 3300025159|Ga0209619_10135110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1439 | Open in IMG/M |
| 3300025537|Ga0210061_1077357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300025912|Ga0207707_10053894 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
| 3300025917|Ga0207660_10364154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1160 | Open in IMG/M |
| 3300025920|Ga0207649_10351791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1091 | Open in IMG/M |
| 3300025921|Ga0207652_10098748 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
| 3300025926|Ga0207659_11107867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
| 3300025926|Ga0207659_11282826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 629 | Open in IMG/M |
| 3300025930|Ga0207701_10349944 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300025931|Ga0207644_10936059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 726 | Open in IMG/M |
| 3300025934|Ga0207686_11290113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 599 | Open in IMG/M |
| 3300025936|Ga0207670_11604179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 553 | Open in IMG/M |
| 3300025939|Ga0207665_10996202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
| 3300025986|Ga0207658_11041836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 747 | Open in IMG/M |
| 3300025993|Ga0208415_1015711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 723 | Open in IMG/M |
| 3300026088|Ga0207641_10351039 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300026089|Ga0207648_10363018 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300026314|Ga0209268_1119031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300026320|Ga0209131_1240488 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300026537|Ga0209157_1311189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 574 | Open in IMG/M |
| 3300027513|Ga0208685_1115539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300027526|Ga0209968_1018994 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300027637|Ga0209818_1095188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 782 | Open in IMG/M |
| 3300027778|Ga0209464_10285057 | Not Available | 600 | Open in IMG/M |
| 3300027862|Ga0209701_10382490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300027907|Ga0207428_10308070 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300027907|Ga0207428_10338938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea | 1108 | Open in IMG/M |
| 3300028420|Ga0210366_10527864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300028803|Ga0307281_10024007 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300031170|Ga0307498_10014304 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300031716|Ga0310813_10982075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 769 | Open in IMG/M |
| 3300031820|Ga0307473_10609576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 755 | Open in IMG/M |
| 3300031941|Ga0310912_10455808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 997 | Open in IMG/M |
| 3300031944|Ga0310884_10668519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 626 | Open in IMG/M |
| 3300031965|Ga0326597_12185130 | Not Available | 506 | Open in IMG/M |
| 3300032174|Ga0307470_10153349 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300032174|Ga0307470_11164628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 624 | Open in IMG/M |
| 3300032211|Ga0310896_10557448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 635 | Open in IMG/M |
| 3300033004|Ga0335084_10525029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1215 | Open in IMG/M |
| 3300033412|Ga0310810_10321354 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300033815|Ga0364946_000448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5956 | Open in IMG/M |
| 3300034177|Ga0364932_0238760 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma spitsbergense | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.24% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.04% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.52% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.68% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1008632603 | 3300000364 | Soil | MAQQIPRLTLRKGVKQIPRHQELYKKDFVFVNPASIGANLXXLXXSXQQVFNIR* |
| C687J29651_102000261 | 3300002407 | Soil | ARFPHKGIKQIPRHQELYKKDFVFVNPTFIGPNLNELTASYQRIFNMR* |
| soilL2_100305253 | 3300003319 | Sugarcane Root And Bulk Soil | TVLAQQVPRLTLRKGIKQIPRHQDFYKKDFVFVNPAFIGPNLNELIASYQQIFEVR* |
| Ga0055485_100064263 | 3300004067 | Natural And Restored Wetlands | LAQQVPRITLRKGVKQIPRHQELYKKEFVFVNPAYLGANLTELIASYQQVFNIR* |
| Ga0055485_100913312 | 3300004067 | Natural And Restored Wetlands | LAQQVPRITLRKGVKQIPRHQELYKKEFVFVNPAYLGANLTELIASYQQVFNVR* |
| Ga0055486_101944681 | 3300004071 | Natural And Restored Wetlands | QQVPRITLRKGVKQIPRHQELYKKEFVFVNPAYLGANLTELIASYQQVFNIR* |
| Ga0062593_1004206731 | 3300004114 | Soil | RITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0062382_101591481 | 3300004782 | Wetland Sediment | VKQIPRHQELYKKDFVFVNPAFLGANLTELIASYQQVFNIR* |
| Ga0066683_106148701 | 3300005172 | Soil | KGVKQIPRHQELYKRDFVFVNPASIGPNLNELIATYQKIFNVN* |
| Ga0066676_108044172 | 3300005186 | Soil | TLRKGVKQIPRHQELYKRDFVFVNPASIGPNLNELIATYQKIFNVN* |
| Ga0070666_103625323 | 3300005335 | Switchgrass Rhizosphere | LRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0070666_111384841 | 3300005335 | Switchgrass Rhizosphere | RKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0070661_1002978743 | 3300005344 | Corn Rhizosphere | PRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0070694_1005887612 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0070694_1008778662 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LRKGIKQIPRHQELYKKEFVFVKPASIGPNLTELIASYQQIFNVR* |
| Ga0070706_1004273221 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RKGIKQIPRHQELYKKEFVFVNPAFLGPNLNELIASYQQIFNTR* |
| Ga0070698_1021986121 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQQIPRISLRKGIKQIPRHQDLYKKEFVFVNPASIGPSLNELIVTYQQIFNVR* |
| Ga0070699_1015638131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EGQTVLAQQVPRLTLRKGIKQIPRHQDLYKKDFVFVNPASIGPNLNELIASYQQTFDVR* |
| Ga0070679_1000679021 | 3300005530 | Corn Rhizosphere | LRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0068853_1014193951 | 3300005539 | Corn Rhizosphere | VLAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0070704_1003447283 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTVLAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPAFLGPNLNELIASYQQIFNTR* |
| Ga0066700_108138152 | 3300005559 | Soil | QQIPRLTLRKGVKQIPRHQELYKKEFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0068856_1012491701 | 3300005614 | Corn Rhizosphere | RITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0066905_1006702631 | 3300005713 | Tropical Forest Soil | KQIPRHQELYKKDFVFVNPASIGANLNELIASYQQIFTVR* |
| Ga0068863_1023595691 | 3300005841 | Switchgrass Rhizosphere | IPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0070716_1010350082 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNIR* |
| Ga0075422_102662652 | 3300006196 | Populus Rhizosphere | IPRHQELYKKDFVFVNPASIGPNLNELITSYQQIFNVR* |
| Ga0066658_103076581 | 3300006794 | Soil | AAVLAQQVPRLTLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0075430_1003609801 | 3300006846 | Populus Rhizosphere | KQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFDVR* |
| Ga0075434_1007678413 | 3300006871 | Populus Rhizosphere | PRHQELYKKDFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0075434_1021618362 | 3300006871 | Populus Rhizosphere | VLAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0075435_1003898231 | 3300007076 | Populus Rhizosphere | AQQIPRMTLRKGVKQIPRHQELYKKDFVFVNPASIGPNLNALIASYQQIFDIR* |
| Ga0111539_109948541 | 3300009094 | Populus Rhizosphere | QELYKKDFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0075418_104810673 | 3300009100 | Populus Rhizosphere | VKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0115027_116074102 | 3300009131 | Wetland | RLTLRKGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0114129_107613173 | 3300009147 | Populus Rhizosphere | QIPRHQELYKKDFVFVNPASIGPNLNELIASYQQIFNVR* |
| Ga0111538_140791261 | 3300009156 | Populus Rhizosphere | HQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0105100_103132142 | 3300009166 | Freshwater Sediment | VLALQVPRITLRKGVKQIPRHQELYKNGFVFVNPAYLGANLTELIASYQQVFNIR* |
| Ga0105242_109378461 | 3300009176 | Miscanthus Rhizosphere | MLSEEGQSVLAQQIPRITLRKGIKQIPRHHCLYKKEFVFVNPASIGPNLNDLIAS |
| Ga0115028_120954381 | 3300009179 | Wetland | QIPRHQELYKKEFVFVNPASLGPNLTELIASYQQVFNVR* |
| Ga0105340_10331972 | 3300009610 | Soil | PRHQELYKKEFVYVNPAYLGANLTELIASYQQVFNIR* |
| Ga0105075_10484421 | 3300009799 | Groundwater Sand | SLMAQQIPRLTLRKGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0105066_11656781 | 3300009822 | Groundwater Sand | KGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0105078_10163731 | 3300009823 | Groundwater Sand | RHQELYKKDFVFVNPASIGANLNELIASYQQVFNVR* |
| Ga0126380_121338992 | 3300010043 | Tropical Forest Soil | GVKQIPRHQELYKKDFVFVNPASIGANLNDLIASYQQIFNVR* |
| Ga0134126_100639731 | 3300010396 | Terrestrial Soil | TLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0134126_112298351 | 3300010396 | Terrestrial Soil | TLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0134127_109853371 | 3300010399 | Terrestrial Soil | QTVLAQQIPRITQRNGIKQIPRHQELYKKEFAFVNPASIGPQLNELAASYRQIFNVR* |
| Ga0134121_1001349210 | 3300010401 | Terrestrial Soil | PRHQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR* |
| Ga0137422_10765831 | 3300011416 | Soil | IPRLTLRKGIKQIPRYQDLYKKEFVFVNPASLGPNLNEVMASYQQIFNVR* |
| Ga0137423_12119262 | 3300011430 | Soil | PRLTLRKGVKQIPRHQELYKRDFVFVNPASIGANLNELTASYQQIFNVR* |
| Ga0137443_10725941 | 3300011433 | Soil | RNGIKQIPRYQELYKKEFVFVNPATLGPNLKEVMASYQQIFNVR* |
| Ga0137426_10084541 | 3300011435 | Soil | HQELYKKEFVFVNPASLGPNLTELIASYQQVFNIR* |
| Ga0137452_10995713 | 3300011441 | Soil | MAQQIPRLTLRNGIKQIPRYQELYKKEFVFVNPASLGPNLNEVMASYQQIFNVR* |
| Ga0137385_114655341 | 3300012359 | Vadose Zone Soil | SLRKGIKQIPRHQELYKKEFVFVNPASIGPSLSELIATYQQIFNVR* |
| Ga0157331_10091581 | 3300012486 | Soil | KQIPRHQELYKKDFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0157305_101717482 | 3300012891 | Soil | EGQTVLAQQVPRITLRKGVKQIPRHQELYKKEFVFVNPAYLGANLTDLIASYQQVFNLR* |
| Ga0157302_100565053 | 3300012915 | Soil | AQQIPCITLRKGIKQIARHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0157374_100561691 | 3300013296 | Miscanthus Rhizosphere | QELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR* |
| Ga0163162_109656093 | 3300013306 | Switchgrass Rhizosphere | QELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR* |
| Ga0075321_10607161 | 3300014300 | Natural And Restored Wetlands | RITLRKGVKQIPRHQELYKKEFVFVNPASIGPNLNELTASYQQIFNVR* |
| Ga0180080_10592972 | 3300014870 | Soil | MTLRKGIKQIPRHQELYKKDFVFVNPASIGPNLTELTASYQQIFNVR* |
| Ga0180073_10834921 | 3300015256 | Soil | VTPERKGVKQIPRNQELYKKDFVFVSPASIGPNLKEMVASYQQIFDVR* |
| Ga0182032_102088951 | 3300016357 | Soil | QIPRITLRKGIKQILRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0184608_103863741 | 3300018028 | Groundwater Sediment | QIPRHQELYKKEFVFVNPASIGPNLNELIASYQQIFNVR |
| Ga0184615_100111792 | 3300018059 | Groundwater Sediment | VRLQDLTPKRKGVKQIPRNQELYKKDFVFVSPASIEPNLKEMVAFYQQIFDVR |
| Ga0184635_102769192 | 3300018072 | Groundwater Sediment | GVKQIPRHQELYKKEFVFVNPASIGANLNELIASYQQVFDVR |
| Ga0184633_102304681 | 3300018077 | Groundwater Sediment | SVMAQQIPRMTLRKGIRQIPRHQELYKKDFVFVNPASIGPNLNELTASYQQIFNVR |
| Ga0184639_102296272 | 3300018082 | Groundwater Sediment | EGQTVLAQQVPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNELIASYQQIFNVR |
| Ga0184629_101917163 | 3300018084 | Groundwater Sediment | KQIPRHQELYKKDFVFVNPAFIGPNLNELTASYQQIFNVR |
| Ga0190265_135832531 | 3300018422 | Soil | RHQELYKKEFVYVNPAYLGANLTELIASYQQVFNIR |
| Ga0190272_108559051 | 3300018429 | Soil | YQDLYKKEFVFVNPASLGPNLNEVMASYQQIFNVR |
| Ga0173481_102670861 | 3300019356 | Soil | KQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0173482_104291511 | 3300019361 | Soil | IPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0210407_109820382 | 3300020579 | Soil | MPQQIPRLTLRKGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNIR |
| Ga0210377_100104344 | 3300021090 | Groundwater Sediment | VRLQDLTPERKGVKQIPRNQELYKKDFVFVSPASIEPNLKEMVAFYQQIFDVR |
| Ga0193719_103234792 | 3300021344 | Soil | IPRHQELYKKEFVFVNPASIGANLNELIASYQQVFDVR |
| Ga0209619_101351103 | 3300025159 | Soil | KQIPRHQELYKKDFVFVNPTFIGPNLNELTASYQRIFNMR |
| Ga0210061_10773571 | 3300025537 | Natural And Restored Wetlands | RHQELYKKEFVFVNPASIGPNLNELIASYQQIFNIR |
| Ga0207707_100538947 | 3300025912 | Corn Rhizosphere | TLRKGIKQIPRHQDLYKKDFVFVNPASIGPNLNELIASYQQIFDVR |
| Ga0207660_103641543 | 3300025917 | Corn Rhizosphere | PRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0207649_103517911 | 3300025920 | Corn Rhizosphere | RITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0207652_100987484 | 3300025921 | Corn Rhizosphere | PRLTLRKGIKQIPRHQDLYKKDFVFVNPASIGPNLNELIASYQQIFDVR |
| Ga0207659_111078672 | 3300025926 | Miscanthus Rhizosphere | AQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0207659_112828261 | 3300025926 | Miscanthus Rhizosphere | GQTFMAQQIPRSTLRKGIKQIPRYQELYKKEFVFVNPASLGPNLNEVMASYQQIFNVR |
| Ga0207701_103499441 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0207644_109360591 | 3300025931 | Switchgrass Rhizosphere | KGIKQIARHQELYKKDFVFVNPASIGPSLNDLIASYQQIFNVR |
| Ga0207686_112901131 | 3300025934 | Miscanthus Rhizosphere | TLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0207670_116041792 | 3300025936 | Switchgrass Rhizosphere | QIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0207665_109962022 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GGKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFDVR |
| Ga0207658_110418361 | 3300025986 | Switchgrass Rhizosphere | PRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0208415_10157111 | 3300025993 | Rice Paddy Soil | IPRHQELYKKEFVFVNPASIGPNLNELTASYQQIFNVR |
| Ga0207641_103510391 | 3300026088 | Switchgrass Rhizosphere | GQTVLAQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQVFNVR |
| Ga0207648_103630183 | 3300026089 | Miscanthus Rhizosphere | RITLRKGIKQIARHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0209268_11190312 | 3300026314 | Soil | GQTVLAQQIPRLTLRKGVKQIPRHQELYKRDFVFVNPASIGPNLNELIATYQKIFNVN |
| Ga0209131_12404882 | 3300026320 | Grasslands Soil | EAQTMMAQQIPRLTIRKGVKQTARNQELYQKDFVFVNPASIGPNLSEMVASYRQIFDVR |
| Ga0209157_13111891 | 3300026537 | Soil | KQIPRHQELYKKDFVFVNPASIGPNLNELIATYQKIFNVN |
| Ga0208685_11155392 | 3300027513 | Soil | IPRHQELYKKEFVYVNPAYLGANLTELIASYQQVFNIR |
| Ga0209968_10189943 | 3300027526 | Arabidopsis Thaliana Rhizosphere | ITLRKGVKQIPRHQELYKKEFVFVNPASIGPNLNELTASYQQIFNVR |
| Ga0209818_10951881 | 3300027637 | Agricultural Soil | VLAQQIPRITLRNGIKQIPRHQDLYKKEFVFVNPASIGPHLNELAASYQQVFNVR |
| Ga0209464_102850571 | 3300027778 | Wetland Sediment | VLAQQVPRITLRKGIKQIPRHQELYKKDFVFVNPAYLGANLTELIASYQQVFNIR |
| Ga0209701_103824902 | 3300027862 | Vadose Zone Soil | AQQIPRMTIRKGVKQIPRNQELYKKDFIFVSPASIGPNLNEMIASYQQIFDVR |
| Ga0207428_103080703 | 3300027907 | Populus Rhizosphere | LTLRKGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFDVR |
| Ga0207428_103389383 | 3300027907 | Populus Rhizosphere | QIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0210366_105278641 | 3300028420 | Estuarine | QIPRHQELYKKDFVFVNPANLGANLTELIASYQQVFNIR |
| Ga0307281_100240071 | 3300028803 | Soil | MAQQIPRLTLRKGIKQIPRYQELYKKEFVFVDPASLGPNLNEVMASYQQIFNVR |
| Ga0307498_100143041 | 3300031170 | Soil | PRHQELYKKDFVFVNPASIGPNLNELIASYQQIFNVR |
| Ga0310813_109820751 | 3300031716 | Soil | RKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0307473_106095763 | 3300031820 | Hardwood Forest Soil | TLRKGVKQIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFNIR |
| Ga0310912_104558083 | 3300031941 | Soil | PRITLRKGIKQILRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNVR |
| Ga0310884_106685191 | 3300031944 | Soil | KQIPRHQELYKKDFVFVNPASIGPNLNELITSYQQIFNVR |
| Ga0326597_121851301 | 3300031965 | Soil | MAQQIPRMTLRKGIKQIPRHQELYKKDFVFVKPAFIGPNLNELTASYQQIFNVRYY |
| Ga0307470_101533493 | 3300032174 | Hardwood Forest Soil | QIPRHQELYKKDFVFVNPASIGANLNELIASYQQVFDVR |
| Ga0307470_111646281 | 3300032174 | Hardwood Forest Soil | RHQDLYKKEFVFVNPASIGPNLNELMATYQQIFNVR |
| Ga0310896_105574482 | 3300032211 | Soil | QQVPRITLRKGVKQIPRHQELYKKEFVFVNPAYLGANLTDLIASYQQVFNLR |
| Ga0335084_105250293 | 3300033004 | Soil | QQIPRMTLRKGVKQIPRHQELYKKDFVFVNPASIGPNLNALVASYQQIFDVR |
| Ga0310810_103213541 | 3300033412 | Soil | AQQIPRITLRKGIKQIPRHQELYKKEFVFVNPASIGPNLNDLIASYQQIFNIR |
| Ga0364946_000448_720_866 | 3300033815 | Sediment | VTPERKGVKQIPRNQELYKKDFVFVSPASIGPNLKEMVASYQQIFDVR |
| Ga0364932_0238760_2_115 | 3300034177 | Sediment | PRHQELYKKDFVFVNPAFIGPNLIELTASYQQIFNVR |
| ⦗Top⦘ |