


| Basic Information | |
|---|---|
| Family ID | F075196 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 40 residues |
| Representative Sequence | GRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 89.08 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.235 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.773 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.31% Coil/Unstructured: 79.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00266 | Aminotran_5 | 29.41 |
| PF00717 | Peptidase_S24 | 6.72 |
| PF00805 | Pentapeptide | 5.04 |
| PF01841 | Transglut_core | 5.04 |
| PF04255 | DUF433 | 1.68 |
| PF05016 | ParE_toxin | 1.68 |
| PF01541 | GIY-YIG | 0.84 |
| PF05721 | PhyH | 0.84 |
| PF13186 | SPASM | 0.84 |
| PF01435 | Peptidase_M48 | 0.84 |
| PF13360 | PQQ_2 | 0.84 |
| PF01850 | PIN | 0.84 |
| PF03446 | NAD_binding_2 | 0.84 |
| PF01408 | GFO_IDH_MocA | 0.84 |
| PF16826 | DUF5076 | 0.84 |
| PF00285 | Citrate_synt | 0.84 |
| PF01261 | AP_endonuc_2 | 0.84 |
| PF02678 | Pirin | 0.84 |
| PF13374 | TPR_10 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 5.04 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.68 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.84 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.84 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.08 % |
| Unclassified | root | N/A | 10.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01A56J7 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300001661|JGI12053J15887_10217986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100193867 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300002914|JGI25617J43924_10057220 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300002914|JGI25617J43924_10273747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300004082|Ga0062384_100662071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300004092|Ga0062389_101976874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 760 | Open in IMG/M |
| 3300005171|Ga0066677_10845867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005454|Ga0066687_10316137 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 888 | Open in IMG/M |
| 3300005537|Ga0070730_10573961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300005538|Ga0070731_10047037 | All Organisms → cellular organisms → Bacteria | 2879 | Open in IMG/M |
| 3300005576|Ga0066708_10227425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300005602|Ga0070762_11105992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300006174|Ga0075014_100548224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300006175|Ga0070712_101405805 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 609 | Open in IMG/M |
| 3300006176|Ga0070765_101727744 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006800|Ga0066660_10072525 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300006804|Ga0079221_10544894 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300009038|Ga0099829_10060727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2834 | Open in IMG/M |
| 3300009038|Ga0099829_11596007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300009088|Ga0099830_10581285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300009089|Ga0099828_11568748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300009759|Ga0116101_1202189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010343|Ga0074044_10827036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300010358|Ga0126370_11181907 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010361|Ga0126378_10001642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16550 | Open in IMG/M |
| 3300010398|Ga0126383_13105528 | Not Available | 542 | Open in IMG/M |
| 3300011270|Ga0137391_10544397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300011270|Ga0137391_10999095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012096|Ga0137389_11285788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012189|Ga0137388_10396709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1277 | Open in IMG/M |
| 3300012189|Ga0137388_11052012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300012202|Ga0137363_10152515 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300012202|Ga0137363_10330093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300012202|Ga0137363_10424369 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300012202|Ga0137363_11447285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300012202|Ga0137363_11782218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012285|Ga0137370_10020999 | All Organisms → cellular organisms → Bacteria | 3276 | Open in IMG/M |
| 3300012351|Ga0137386_11051602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012362|Ga0137361_11662833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012363|Ga0137390_10262384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1713 | Open in IMG/M |
| 3300012363|Ga0137390_10495136 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300012683|Ga0137398_10601066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300012923|Ga0137359_10524886 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300012923|Ga0137359_10525390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300012924|Ga0137413_10040480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
| 3300012924|Ga0137413_10410189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300012925|Ga0137419_10477210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 987 | Open in IMG/M |
| 3300012927|Ga0137416_10237521 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300012929|Ga0137404_10747770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300012944|Ga0137410_10513048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300012961|Ga0164302_10055917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1985 | Open in IMG/M |
| 3300016270|Ga0182036_10177923 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300016387|Ga0182040_11173113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300017822|Ga0187802_10192791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300017933|Ga0187801_10055873 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Monogononta → Pseudotrocha → Ploima → Brachionidae → Brachionus → Brachionus plicatilis | 1442 | Open in IMG/M |
| 3300017959|Ga0187779_10072650 | Not Available | 2034 | Open in IMG/M |
| 3300020579|Ga0210407_10869011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300020580|Ga0210403_10714138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300020580|Ga0210403_11528912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300020581|Ga0210399_11310073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300021168|Ga0210406_10596379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300021178|Ga0210408_10182782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1665 | Open in IMG/M |
| 3300021178|Ga0210408_10737819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021402|Ga0210385_11576677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021404|Ga0210389_11370302 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021475|Ga0210392_10753252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 726 | Open in IMG/M |
| 3300021477|Ga0210398_11059707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300021479|Ga0210410_10159778 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300021479|Ga0210410_10431290 | Not Available | 1180 | Open in IMG/M |
| 3300024284|Ga0247671_1008206 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300025406|Ga0208035_1043158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300025905|Ga0207685_10460767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300026035|Ga0207703_10285827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300026320|Ga0209131_1186718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300026322|Ga0209687_1106733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300026359|Ga0257163_1061400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300026514|Ga0257168_1144165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300026523|Ga0209808_1298789 | Not Available | 518 | Open in IMG/M |
| 3300026869|Ga0207821_1020213 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027172|Ga0208098_1019781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300027376|Ga0209004_1082529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 544 | Open in IMG/M |
| 3300027603|Ga0209331_1084750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300027645|Ga0209117_1099568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300027651|Ga0209217_1097763 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300027738|Ga0208989_10304872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 508 | Open in IMG/M |
| 3300027862|Ga0209701_10010999 | All Organisms → cellular organisms → Bacteria | 5908 | Open in IMG/M |
| 3300027867|Ga0209167_10794982 | Not Available | 515 | Open in IMG/M |
| 3300027903|Ga0209488_11120374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300028047|Ga0209526_10527610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300028536|Ga0137415_10411499 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300028536|Ga0137415_11146173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300028536|Ga0137415_11175894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300029636|Ga0222749_10410274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300029636|Ga0222749_10455591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031234|Ga0302325_12978801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300031715|Ga0307476_11397316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300031718|Ga0307474_10851281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → unclassified Rhodopseudomonas → Rhodopseudomonas sp. SK50-23 | 721 | Open in IMG/M |
| 3300031720|Ga0307469_12477351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300031753|Ga0307477_10710014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300031753|Ga0307477_10768146 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031754|Ga0307475_10230335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1484 | Open in IMG/M |
| 3300031754|Ga0307475_10312052 | Not Available | 1263 | Open in IMG/M |
| 3300031754|Ga0307475_10831116 | Not Available | 732 | Open in IMG/M |
| 3300031780|Ga0318508_1040142 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300031820|Ga0307473_10049542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1979 | Open in IMG/M |
| 3300031823|Ga0307478_11260210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031942|Ga0310916_10885229 | Not Available | 749 | Open in IMG/M |
| 3300031942|Ga0310916_10916008 | Not Available | 734 | Open in IMG/M |
| 3300031962|Ga0307479_10116272 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300032035|Ga0310911_10354691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300032180|Ga0307471_100372683 | Not Available | 1546 | Open in IMG/M |
| 3300032828|Ga0335080_11713213 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Lacipirellula → Lacipirellula limnantheis | 616 | Open in IMG/M |
| 3300032898|Ga0335072_10759908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300032898|Ga0335072_11591496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300033486|Ga0316624_10650785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_07156480 | 2170459010 | Grass Soil | RGTKPRQLEWHHGDKVRVRAERIDPMRKRVEFALVEKN |
| JGI12053J15887_102179862 | 3300001661 | Forest Soil | GRGAKQTQLKWSLGDRVRVRAERIDPMRKRVEFALADSA* |
| JGIcombinedJ26739_1001938674 | 3300002245 | Forest Soil | AKPKELAWHLGDRVRVRAERIDPMRRRVEFAIAEVA* |
| JGI25617J43924_100572201 | 3300002914 | Grasslands Soil | SASGRGANPRQLEWRLGDKVRVRAERIDPMRKRVEFALIP* |
| JGI25617J43924_102737472 | 3300002914 | Grasslands Soil | AGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALA* |
| Ga0062384_1006620711 | 3300004082 | Bog Forest Soil | RGRGAKPKEVAWHLGDKVRVRAERIDPMRRRVEFAIAEPV* |
| Ga0062389_1019768743 | 3300004092 | Bog Forest Soil | GAPRSGRGRGAKSKELAWHLGDKVHVRAERIDPMRRRVEFAIVDPA* |
| Ga0066677_108458672 | 3300005171 | Soil | GRGAKPRTLEWHLGDRVRVRADRIDPMRHRVEFALAQKA* |
| Ga0066687_103161371 | 3300005454 | Soil | RGRGAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALAEDIK* |
| Ga0070730_105739612 | 3300005537 | Surface Soil | GAGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALAD* |
| Ga0070731_100470371 | 3300005538 | Surface Soil | AAKQKQRSWGLGDRVKVRAERIDPMRRRVEFALIP* |
| Ga0066708_102274254 | 3300005576 | Soil | GASASGRGAKSRQLEWHLGDKVRVRAERIDPMRKRVEFALVAEP* |
| Ga0070762_111059922 | 3300005602 | Soil | PKVLTWQHGDRVRVRAERIDPMRRRVEFALAVGGA* |
| Ga0075014_1005482242 | 3300006174 | Watersheds | RGRGAKPAQLSWRLGDRIRVRAERIDPMRRRVEFALIGAE* |
| Ga0070712_1014058052 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GKQQRQLMWQHGDRVRVRAERIDPMRRRVEFALADLSQI* |
| Ga0070765_1017277441 | 3300006176 | Soil | GSRRGRGAKPKELAWHHGDRVRVRAERIDPMRRRVEFAIAEVP* |
| Ga0066660_100725254 | 3300006800 | Soil | GKDSRSVRDAKSRPLEWHLGDRVRVRADRIDPMRKRVEFAVIS* |
| Ga0079221_105448942 | 3300006804 | Agricultural Soil | RGRGAKPKELAWRLGDRVRVRAERIDPMRRRVEFAIAEVA* |
| Ga0099829_100607273 | 3300009038 | Vadose Zone Soil | APGSRRGRGAKPAQLGWRLGDRVRVRAERIDPMRRRVAFALVGAA* |
| Ga0099829_115960073 | 3300009038 | Vadose Zone Soil | PRPGRGAIVKQLEWHHGDRVRVRAERIDPMRKRVEFALVAQP* |
| Ga0099830_105812853 | 3300009088 | Vadose Zone Soil | GRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALA* |
| Ga0099830_109186112 | 3300009088 | Vadose Zone Soil | RAPGSPPGRGAKPRQMEWHLGDKVRVRAERIDPMRKRVEFALIA* |
| Ga0099828_115687481 | 3300009089 | Vadose Zone Soil | RRSRGAKPRQLEWHLGDKVRVRAERIDPMRKRVEFALVEKN* |
| Ga0116101_12021892 | 3300009759 | Peatland | GRGRGTKPQELAWHLGDKVRVRAERIDPMRRRVEFAIAEVA* |
| Ga0074044_108270361 | 3300010343 | Bog Forest Soil | RSGRGRGAKPKEVAWHLGDKVHVRAERIDPMRRSVEFAIVDPA* |
| Ga0126370_111819073 | 3300010358 | Tropical Forest Soil | GAKPTQMMWQHGDRVRVRAERIDPMRRRVEFALV* |
| Ga0126378_100016421 | 3300010361 | Tropical Forest Soil | ARPSRGAKPRPHEWHLGDRVRVRADRIDPMRKRVEFALVNRA* |
| Ga0126383_131055281 | 3300010398 | Tropical Forest Soil | QGPRGRGAAKARQRSWGLGDRVRVRAERIDPMRRRVEFALI* |
| Ga0137391_105443971 | 3300011270 | Vadose Zone Soil | SAGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALAGGAVQ* |
| Ga0137391_109990951 | 3300011270 | Vadose Zone Soil | KQLTWQHGDRVRVRAERIDPMRRRVEFALASGTLQ* |
| Ga0137389_112857881 | 3300012096 | Vadose Zone Soil | RGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALAGGAVQ* |
| Ga0137388_103967091 | 3300012189 | Vadose Zone Soil | SAGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFAIAQGI* |
| Ga0137388_110520123 | 3300012189 | Vadose Zone Soil | RGGASAGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALAELT* |
| Ga0137363_101525153 | 3300012202 | Vadose Zone Soil | GRGSKAKPMEWHLGDRVRVRAERIDPMRKRVEFALIGGN* |
| Ga0137363_103300932 | 3300012202 | Vadose Zone Soil | STSGRGAKPRQLEWHLGDKVRVRAARIDPMRKRVEFALLSGT* |
| Ga0137363_104243692 | 3300012202 | Vadose Zone Soil | GRGSKAKPMEWHLGDRVRVRAERIDPMRKRVEFALIGEN* |
| Ga0137363_114472851 | 3300012202 | Vadose Zone Soil | RGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALVAPN* |
| Ga0137363_117822182 | 3300012202 | Vadose Zone Soil | GRGAKPRQLEWHLGDKVRVRAERIDPMRKRVEFALIAH* |
| Ga0137370_100209995 | 3300012285 | Vadose Zone Soil | SAPGRGAKFRQLEWHLGDKVRVRAERIDPMRKRVEFALVASV* |
| Ga0137386_110516021 | 3300012351 | Vadose Zone Soil | APAPPAGRGAKPAKLEWHLGDKVRVRAERIDPMRKRVEFALVDS* |
| Ga0137361_116628333 | 3300012362 | Vadose Zone Soil | SPPGRGAKPRQLEWHLGDKVRVRAERIDPMRKRVEFALIA* |
| Ga0137390_102623841 | 3300012363 | Vadose Zone Soil | RGARRGRGAKPRQLEWRLGDKVRVRAERIDPMRKRVEFALVGGT* |
| Ga0137390_104951363 | 3300012363 | Vadose Zone Soil | AGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALAGGAVQ* |
| Ga0137398_106010662 | 3300012683 | Vadose Zone Soil | GAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALANAT* |
| Ga0137359_105248861 | 3300012923 | Vadose Zone Soil | RGRGAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALANGG* |
| Ga0137359_105253901 | 3300012923 | Vadose Zone Soil | KPNQLTWQHGDRVRVRAERIDPMRRRVEFALADGS* |
| Ga0137413_100404801 | 3300012924 | Vadose Zone Soil | RPSRGAKPRQLEWRLGDKVRVRAERIDPMRKRVEFALLN* |
| Ga0137413_104101893 | 3300012924 | Vadose Zone Soil | GGGRGRGVKPKQLIWQHGDRVRVRAERIDPMRRRVEFALA* |
| Ga0137419_104772103 | 3300012925 | Vadose Zone Soil | GRGRGAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALADAN* |
| Ga0137416_102375213 | 3300012927 | Vadose Zone Soil | GAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALANGG* |
| Ga0137404_107477701 | 3300012929 | Vadose Zone Soil | SGRSAKPRQLEWHLGDKVRVRAERIDPMRKRVEFALIAGT* |
| Ga0137410_105130482 | 3300012944 | Vadose Zone Soil | RHGRGSKAKPMEWHLGDRVRVRAERIDPMRKRVEFALVGGN* |
| Ga0164302_100559171 | 3300012961 | Soil | RGAAKSKQRRWGLGDSVKVRAERIDPLRRRVEFALLSAE* |
| Ga0182036_101779233 | 3300016270 | Soil | SDTHGRAQMGKGRGVKSRPLAWHRGDRVHVRADRIDPMRRRVEFAVIS |
| Ga0182040_111731131 | 3300016387 | Soil | HGRAQMGKGRGVKSRPLAWHLGDRVHVRADRIDPMRRRVEFAVIS |
| Ga0187802_101927911 | 3300017822 | Freshwater Sediment | RKGRGAKPKALEWHLGDKVRVRAERIDPMRKRVEFALLSGS |
| Ga0187801_100558732 | 3300017933 | Freshwater Sediment | KPKALEWHLGDKVRVRAERIDPMRKRVEFALLSGS |
| Ga0187779_100726501 | 3300017959 | Tropical Peatland | SEGRVGRGRGAKPKETAWHLGDRVKVRAERIDPMRRRVEFALVS |
| Ga0210407_108690112 | 3300020579 | Soil | AKPKQLMWQHGDRVRVRAERIDPTRRRVEFALAADTT |
| Ga0210403_107141382 | 3300020580 | Soil | AKPKEVGWHLGDKVRVRAERIDPMRKRVEFALIGEN |
| Ga0210403_115289123 | 3300020580 | Soil | PGSRRGRGAKPKELAWHLGDRVRVRAERIDPMRRRVEFAIAELA |
| Ga0210399_113100731 | 3300020581 | Soil | GRGAVTKERAWHLGDRVHVRAERIDPMRRRVEFAIAEIP |
| Ga0210406_105963791 | 3300021168 | Soil | RSRDSKPRQLEWRHGDKVRVRAERIDPMRKRVEFALVEKN |
| Ga0210408_101827821 | 3300021178 | Soil | RGGASPGRGRGAKPKQLMWQHGDRVRVRAERIDPMRRRVEFALA |
| Ga0210408_107378191 | 3300021178 | Soil | GRGAKPSELSWHLGDRVRVRAERIDPMRKRVEFALAESS |
| Ga0210385_115766772 | 3300021402 | Soil | SRRGRGAKPKELAWHHGDRVRVRAERIDPMRRRVEFALAEPA |
| Ga0210389_113703022 | 3300021404 | Soil | RGRGAKPKQLIWQHGERVRVRAERIDPMRRRVEFALAELTQ |
| Ga0210392_107532522 | 3300021475 | Soil | ANPKQLEWHLGDQVRVRAERIDPMRKRVEFALVTEP |
| Ga0210398_110597072 | 3300021477 | Soil | AKPKELAWHLGDRVSVRAERIDPMRRRVEFAIAGVA |
| Ga0210410_101597781 | 3300021479 | Soil | KPKELAWHLGDRVHVRAERIDPMRRRVEFAIAEVA |
| Ga0210410_104312902 | 3300021479 | Soil | GRGAKPVELAWHLGDKVRVRAERIDPMRKRVEFALVGET |
| Ga0247671_10082063 | 3300024284 | Soil | GAKLKELAWHLGDRVHVRAERIDPMRRRVEFAIAEVP |
| Ga0208035_10431583 | 3300025406 | Peatland | TGRGAKPQPQRAWHLGDPVHVRAERIDPIRKRVEFALVE |
| Ga0207685_104607673 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGRGAKSKELAWHLGDRVHVRAERIDPMRRRVEFAIAEVA |
| Ga0207699_112474893 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AQRSGSGKQQRQLIWQHGDRVRVRAERIDPMRRRVEFALVSSQ |
| Ga0207703_102858273 | 3300026035 | Switchgrass Rhizosphere | GKQQRQLMWQHGDRVRVRAERIDPMRRRVEFALVG |
| Ga0209350_10152755 | 3300026277 | Grasslands Soil | TPGARRSRGAKSRQLEWHLGDKVRVRAERIDPMRKRVEFALVAEP |
| Ga0209131_11867183 | 3300026320 | Grasslands Soil | KPKQLIWQHGDRVRVRAERIDPMRRRVEFALAEQS |
| Ga0209687_11067332 | 3300026322 | Soil | PKDSRSGRASKRRPLEWHLGDCVRVRADRIDPMRKRVEFALIAQP |
| Ga0257163_10614001 | 3300026359 | Soil | RGRGAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALAGEP |
| Ga0257168_11441652 | 3300026514 | Soil | GHGRGTKPKQLTWSLGDQVRVRAERIDPMRKRVEFALATPPQ |
| Ga0209808_12987891 | 3300026523 | Soil | SAMPNRESKSRPLEWHLGDRVRVRADRIDPMRKRVEFAVIS |
| Ga0207821_10202131 | 3300026869 | Tropical Forest Soil | GTGRGRQPAPLVWKLGDRVRVRAERIDPIRRRVEFALVSPS |
| Ga0208098_10197811 | 3300027172 | Forest Soil | GAAPKERAWHLGDRVRVRAERIDPMRRRVEFAIAEVA |
| Ga0209004_10825291 | 3300027376 | Forest Soil | RGSQRGLAPSRLIFKLGDIIRVRAERIDPIRRRVEFALASS |
| Ga0209331_10847501 | 3300027603 | Forest Soil | RGAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALA |
| Ga0209117_10995681 | 3300027645 | Forest Soil | KPKQLVWQHGDRVRVRAERIDPMRRRVEFALVEKN |
| Ga0209217_10977631 | 3300027651 | Forest Soil | KQLIWQHGDRVRVRAERIDPMRRRVEFALAGGAVQ |
| Ga0208989_103048721 | 3300027738 | Forest Soil | KPKQLIWQHGDRVRVRAERIDPMRRRVEFALADAN |
| Ga0209701_100109997 | 3300027862 | Vadose Zone Soil | KPKQLVWQHGDRVRVRAERIDPMRKRVEFAVVSGK |
| Ga0209167_107949821 | 3300027867 | Surface Soil | RSGRGAGKSKQRMWTLGDRVKVRAERIDPMRHRVEFALLD |
| Ga0209488_111203742 | 3300027903 | Vadose Zone Soil | KPRQLEWHLGDKVRVRAERIDPMRKRVEFALVEKN |
| Ga0209526_105276101 | 3300028047 | Forest Soil | GRGQQRGRGAKPKQLMWQHGDRVRVRAERIDPMRRRVEFALADMGS |
| Ga0137415_104114993 | 3300028536 | Vadose Zone Soil | KPRQLEWHLGDKVRVRAERIDPMRKRVEFVLIPAP |
| Ga0137415_111461732 | 3300028536 | Vadose Zone Soil | RGTKPRQFEWRHGDKVRVRAERIDPMRKRVEFALVEKD |
| Ga0137415_111758942 | 3300028536 | Vadose Zone Soil | GAKPKQLIWQHGDRVRVRAERIDPMRRRVEFALANGG |
| Ga0222749_104102742 | 3300029636 | Soil | GAKPREVGWHLGDKVRVRAERIDPMRKRVEFALISEN |
| Ga0222749_104555911 | 3300029636 | Soil | AKPSELSWHLGDRVRVRAERIDPMRKRVEFALAESS |
| Ga0302325_129788011 | 3300031234 | Palsa | SAHTRKGCGAKPAEQRSWHLGDPVRVRAERIDPIRKRVEFALTDETL |
| Ga0307476_113973162 | 3300031715 | Hardwood Forest Soil | RSGRGAAKSKQRMWGLGDRVKVRAERIDPMRHRVEFALSD |
| Ga0307474_108512812 | 3300031718 | Hardwood Forest Soil | GRGAKPQAQRAWHLGDPVQVRAERIDPIRKRVEFALIEN |
| Ga0307469_124773512 | 3300031720 | Hardwood Forest Soil | GARHGRGAKSKPLEWHLGDRVRVRAERIDPMRKRVEFALISES |
| Ga0307477_107100141 | 3300031753 | Hardwood Forest Soil | SAGRGRGAKPKQLTWQHGDRVRVRAERIDPMRRRVEFALVASS |
| Ga0307477_107681462 | 3300031753 | Hardwood Forest Soil | KPRQLEWHLGDRVRVRAERIDPMRKRVEFALLGAS |
| Ga0307475_102303353 | 3300031754 | Hardwood Forest Soil | SRGANPRQREWHLGDKVRVRAERIDPMRKRVEFALVEKN |
| Ga0307475_103120521 | 3300031754 | Hardwood Forest Soil | RGRGAKPQELAWHLGDRVHVRAERIDPMRRRVEFAIVEVA |
| Ga0307475_108311162 | 3300031754 | Hardwood Forest Soil | SGRGAGKSKQRMWTLGDRVKVRAERIDPMRHRVEFALLD |
| Ga0318508_10401423 | 3300031780 | Soil | RDAKSRPFEWHLGDRVRVRADRIDPMRKRVEFAVIA |
| Ga0307473_100495421 | 3300031820 | Hardwood Forest Soil | GRGAKPEQLSWHLGDRVRVRAERIDPMRRRVEFALVGGS |
| Ga0307478_112602101 | 3300031823 | Hardwood Forest Soil | GGVGRGRGAKPKQLMWQHGDRVRVRAERIDPMRRRVEFALAEVT |
| Ga0310916_108852291 | 3300031942 | Soil | HSRRGAGARAKQRSWTLGDRVKVRAERIDPMRRRVEFALVG |
| Ga0310916_109160082 | 3300031942 | Soil | GSRRGGASKSKPHSWTLGDRVAVRAERIDPMRRRVEFALAN |
| Ga0307479_101162721 | 3300031962 | Hardwood Forest Soil | AAPARGRGAKHRQLEWRHGDKVRVRAERIDPMRKRVEFALIP |
| Ga0310911_103546911 | 3300032035 | Soil | MGKGRGVKSRPLAWHLGDRVHVRADRIDPMRRRVEFAVIS |
| Ga0307471_1003726832 | 3300032180 | Hardwood Forest Soil | RGAAKSKQRRWGLGDRVQVRAERIDPMRHRVEFALLN |
| Ga0335080_117132131 | 3300032828 | Soil | RGAKPKETAWHLGDRVKVRAERIDPMRRRVEFALSEN |
| Ga0335072_107599081 | 3300032898 | Soil | AGARRGRGAKPQERAWHLGDRVHVRAERIDPMRRRVEFAIAEVA |
| Ga0335072_115914962 | 3300032898 | Soil | RGRGARQKELAWHLGDRVKVRAERIDPMRRRVEFAIAGTA |
| Ga0316624_106507851 | 3300033486 | Soil | GARAATAKQLFRLGDGVRVRAERIDPLRHRVEFSLV |
| ⦗Top⦘ |