


| Basic Information | |
|---|---|
| Family ID | F075155 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPASASSS |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.34 % |
| % of genes near scaffold ends (potentially truncated) | 68.91 % |
| % of genes from short scaffolds (< 2000 bps) | 78.99 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.992 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.891 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF14229 | DUF4332 | 40.34 |
| PF05872 | HerA_C | 25.21 |
| PF00809 | Pterin_bind | 10.08 |
| PF01546 | Peptidase_M20 | 6.72 |
| PF01288 | HPPK | 3.36 |
| PF02152 | FolB | 2.52 |
| PF07687 | M20_dimer | 1.68 |
| PF09939 | DUF2171 | 0.84 |
| PF01642 | MM_CoA_mutase | 0.84 |
| PF03992 | ABM | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 25.21 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 3.36 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 2.52 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.99 % |
| Unclassified | root | N/A | 21.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1194177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 905 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1033772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 799 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10003481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4272 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1016199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 956 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1012862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1593 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10028048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1329 | Open in IMG/M |
| 3300002911|JGI25390J43892_10156047 | Not Available | 533 | Open in IMG/M |
| 3300004633|Ga0066395_10920708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300005166|Ga0066674_10078149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1520 | Open in IMG/M |
| 3300005180|Ga0066685_10733637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300005187|Ga0066675_10867716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 682 | Open in IMG/M |
| 3300005363|Ga0008090_10131596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1675 | Open in IMG/M |
| 3300005467|Ga0070706_100137330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2282 | Open in IMG/M |
| 3300005471|Ga0070698_101141077 | Not Available | 728 | Open in IMG/M |
| 3300005552|Ga0066701_10009441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 4365 | Open in IMG/M |
| 3300005559|Ga0066700_10034171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 3004 | Open in IMG/M |
| 3300005713|Ga0066905_100271941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1314 | Open in IMG/M |
| 3300005713|Ga0066905_100610382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 925 | Open in IMG/M |
| 3300005713|Ga0066905_100622296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300005713|Ga0066905_100855956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 792 | Open in IMG/M |
| 3300005713|Ga0066905_101533316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 608 | Open in IMG/M |
| 3300005764|Ga0066903_106209197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300005764|Ga0066903_108555462 | Not Available | 521 | Open in IMG/M |
| 3300005983|Ga0081540_1001623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19162 | Open in IMG/M |
| 3300006028|Ga0070717_10263009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1527 | Open in IMG/M |
| 3300006034|Ga0066656_10503145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 790 | Open in IMG/M |
| 3300006038|Ga0075365_10584102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 790 | Open in IMG/M |
| 3300006175|Ga0070712_101635712 | Not Available | 563 | Open in IMG/M |
| 3300006791|Ga0066653_10055371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1667 | Open in IMG/M |
| 3300006800|Ga0066660_11038275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 655 | Open in IMG/M |
| 3300006845|Ga0075421_100104880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3555 | Open in IMG/M |
| 3300006854|Ga0075425_102431530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300006904|Ga0075424_100113668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2860 | Open in IMG/M |
| 3300007265|Ga0099794_10622802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 572 | Open in IMG/M |
| 3300007788|Ga0099795_10519400 | Not Available | 557 | Open in IMG/M |
| 3300009038|Ga0099829_10026721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4057 | Open in IMG/M |
| 3300009090|Ga0099827_11860843 | Not Available | 525 | Open in IMG/M |
| 3300009098|Ga0105245_12344587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
| 3300009156|Ga0111538_11298452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 919 | Open in IMG/M |
| 3300009162|Ga0075423_10136216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2578 | Open in IMG/M |
| 3300009792|Ga0126374_10779623 | Not Available | 728 | Open in IMG/M |
| 3300010046|Ga0126384_10668943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 917 | Open in IMG/M |
| 3300010046|Ga0126384_11059565 | Not Available | 741 | Open in IMG/M |
| 3300010047|Ga0126382_10320811 | Not Available | 1173 | Open in IMG/M |
| 3300010047|Ga0126382_12272288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300010304|Ga0134088_10651725 | Not Available | 526 | Open in IMG/M |
| 3300010325|Ga0134064_10179905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 748 | Open in IMG/M |
| 3300010335|Ga0134063_10216502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 905 | Open in IMG/M |
| 3300010358|Ga0126370_12389079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300010361|Ga0126378_10037765 | Not Available | 4393 | Open in IMG/M |
| 3300010361|Ga0126378_11451118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 777 | Open in IMG/M |
| 3300010366|Ga0126379_11771336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300010376|Ga0126381_103434815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 623 | Open in IMG/M |
| 3300012202|Ga0137363_10737628 | Not Available | 834 | Open in IMG/M |
| 3300012202|Ga0137363_11740112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300012207|Ga0137381_10064923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3043 | Open in IMG/M |
| 3300012209|Ga0137379_10036289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4755 | Open in IMG/M |
| 3300012210|Ga0137378_10064558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3315 | Open in IMG/M |
| 3300012211|Ga0137377_10868691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 834 | Open in IMG/M |
| 3300012212|Ga0150985_104606597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
| 3300012351|Ga0137386_10651211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 758 | Open in IMG/M |
| 3300012355|Ga0137369_10487882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300012359|Ga0137385_11201151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300012361|Ga0137360_10895604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 765 | Open in IMG/M |
| 3300012948|Ga0126375_10154934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1449 | Open in IMG/M |
| 3300012948|Ga0126375_10296973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1120 | Open in IMG/M |
| 3300012960|Ga0164301_10117511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1564 | Open in IMG/M |
| 3300012971|Ga0126369_10131264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2325 | Open in IMG/M |
| 3300012971|Ga0126369_10415537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 1386 | Open in IMG/M |
| 3300012971|Ga0126369_12071954 | Not Available | 657 | Open in IMG/M |
| 3300012986|Ga0164304_10224200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1243 | Open in IMG/M |
| 3300015371|Ga0132258_10210082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4728 | Open in IMG/M |
| 3300015372|Ga0132256_101785835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
| 3300016294|Ga0182041_11428444 | Not Available | 636 | Open in IMG/M |
| 3300016404|Ga0182037_11466529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 604 | Open in IMG/M |
| 3300016422|Ga0182039_11457696 | Not Available | 623 | Open in IMG/M |
| 3300018433|Ga0066667_10208468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
| 3300018468|Ga0066662_10246233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1457 | Open in IMG/M |
| 3300018482|Ga0066669_10050885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2615 | Open in IMG/M |
| 3300021168|Ga0210406_10894637 | Not Available | 668 | Open in IMG/M |
| 3300021403|Ga0210397_11637060 | Not Available | 500 | Open in IMG/M |
| 3300021560|Ga0126371_10287828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1767 | Open in IMG/M |
| 3300025910|Ga0207684_10646168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300026118|Ga0207675_102236331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300026297|Ga0209237_1113929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1155 | Open in IMG/M |
| 3300026538|Ga0209056_10042106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4177 | Open in IMG/M |
| 3300026547|Ga0209156_10479232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 3300026552|Ga0209577_10105562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2276 | Open in IMG/M |
| 3300026555|Ga0179593_1014611 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300027105|Ga0207944_1022983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300027882|Ga0209590_10899636 | Not Available | 557 | Open in IMG/M |
| 3300028878|Ga0307278_10006623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5504 | Open in IMG/M |
| 3300031093|Ga0308197_10314570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 582 | Open in IMG/M |
| 3300031546|Ga0318538_10041343 | Not Available | 2214 | Open in IMG/M |
| 3300031546|Ga0318538_10783556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 517 | Open in IMG/M |
| 3300031561|Ga0318528_10069468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1811 | Open in IMG/M |
| 3300031561|Ga0318528_10148027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300031561|Ga0318528_10787498 | Not Available | 508 | Open in IMG/M |
| 3300031640|Ga0318555_10169527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1172 | Open in IMG/M |
| 3300031682|Ga0318560_10298135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300031713|Ga0318496_10697501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300031719|Ga0306917_10149938 | Not Available | 1728 | Open in IMG/M |
| 3300031724|Ga0318500_10000247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10933 | Open in IMG/M |
| 3300031736|Ga0318501_10022619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2673 | Open in IMG/M |
| 3300031769|Ga0318526_10009917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3041 | Open in IMG/M |
| 3300031770|Ga0318521_10057165 | Not Available | 2036 | Open in IMG/M |
| 3300031805|Ga0318497_10081493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
| 3300031845|Ga0318511_10118467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1138 | Open in IMG/M |
| 3300031880|Ga0318544_10127947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300031890|Ga0306925_10565179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1204 | Open in IMG/M |
| 3300031893|Ga0318536_10047465 | Not Available | 2065 | Open in IMG/M |
| 3300031947|Ga0310909_10534847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300031981|Ga0318531_10098498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1286 | Open in IMG/M |
| 3300032010|Ga0318569_10073932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1511 | Open in IMG/M |
| 3300032010|Ga0318569_10420063 | Not Available | 624 | Open in IMG/M |
| 3300032051|Ga0318532_10299045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 571 | Open in IMG/M |
| 3300032052|Ga0318506_10399504 | Not Available | 609 | Open in IMG/M |
| 3300032076|Ga0306924_11399037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300032090|Ga0318518_10578635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_01069540 | 2124908045 | Soil | MDDLIGRLGVVTGVDRTAADRAVGIIPQSARSWAQSPALASSSDL |
| AF_2010_repII_A01DRAFT_10337722 | 3300000580 | Forest Soil | MDDLIGRIGAAIGADRTAAEKAGGDIPQSARSWPQSSVLASSSDL* |
| AF_2010_repII_A1DRAFT_100034812 | 3300000597 | Forest Soil | MDGLIGRLDAVVGVDRTAAEKAVGTIPQSARSSARFSILASSSDV* |
| AP72_2010_repI_A10DRAFT_10161991 | 3300000651 | Forest Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSAR |
| AF_2010_repII_A100DRAFT_10128621 | 3300000655 | Forest Soil | MDDLIGRLVAPVGVDRTAADKFVGIIPQSARSSARSP |
| AF_2010_repII_A001DRAFT_100280481 | 3300000793 | Forest Soil | LIGRLDAVVGVDRTAAEKAVGTIPQSARSSARFSILASSSDV* |
| JGI25390J43892_101560472 | 3300002911 | Grasslands Soil | MDDLIGRRGAVVGADRTAADKAVGIIPQSARSWAQSPALASS |
| Ga0066395_109207082 | 3300004633 | Tropical Forest Soil | AESAGLVRGYMDDLIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL* |
| Ga0066674_100781492 | 3300005166 | Soil | MDDLIGGLGTAYGADRTAEKVIGIIPQSARSWARSPALANSSNV* |
| Ga0066685_107336372 | 3300005180 | Soil | MDDFIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL* |
| Ga0066675_108677162 | 3300005187 | Soil | LVRGYMDDFIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL* |
| Ga0008090_101315962 | 3300005363 | Tropical Rainforest Soil | MDDLIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL* |
| Ga0070706_1001373302 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI* |
| Ga0070698_1011410772 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDLIGRRVANSGDRTAAEGAVGIIPQSLRREERSLEVHSV |
| Ga0066701_100094411 | 3300005552 | Soil | RPAESAGLVRGYMDDLIGGLGTVYGADRTAEKVVGIIPQSARSWARSPALANSSNV* |
| Ga0066700_100341714 | 3300005559 | Soil | MDDLIGGLGTVYGADRTAEKVVGIIPQSARSWARSPALANSSNV* |
| Ga0066905_1002719412 | 3300005713 | Tropical Forest Soil | MDDPIGRIGAEIGVDRTAAEKAVGIIPQSARSWARSSVLASSSDAS* |
| Ga0066905_1006103822 | 3300005713 | Tropical Forest Soil | MDDLIGRLGAGRGADRTAAEKAVGIIPQSARSWARFPALASSSSV* |
| Ga0066905_1006222963 | 3300005713 | Tropical Forest Soil | PAESAGLVRGYMDDLIGRLGVIIGVDRTAAEKAGGIIPQSARSWTRFPALASSSDV* |
| Ga0066905_1008559561 | 3300005713 | Tropical Forest Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPA |
| Ga0066905_1015333162 | 3300005713 | Tropical Forest Soil | SAGLVRGYMDDFAGCLGVINDADRAVADKTGGVIPQSARSPSPALASPSDV* |
| Ga0066903_1062091972 | 3300005764 | Tropical Forest Soil | GQPAESAGLVRGYMDGLIGRLDAVVGVDRTVAEKAVGTIPQSARSWGRSPVLVSSSDV* |
| Ga0066903_1085554622 | 3300005764 | Tropical Forest Soil | MDDLIGRLGAGRGADRTAAEKAVGIIPQSARLWARFPALASCSSV* |
| Ga0081540_10016235 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MDDLIGRLGAAIGVDRTAAEKAVGIIPQSARSWGRSSVLASSSDD* |
| Ga0070717_102630092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDLIGRLGAGSGADRTAAEKAVAIIPQSARSWARFPALASSPNI* |
| Ga0066656_105031451 | 3300006034 | Soil | AESAGLVRGYMDDFIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL* |
| Ga0075365_105841021 | 3300006038 | Populus Endosphere | GYMDDLIGRIGASIGADRTAAEKAGGDIPQSARSWARSSVLASSSDL* |
| Ga0070712_1016357121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDLIGRIGAAIGVDRTAAEKAVGIIPQSARSWARCSVLA |
| Ga0066653_100553712 | 3300006791 | Soil | MDDLIGRRGTVVGADRTAADKAVGIIPQSARSWAQSPALASSSDV* |
| Ga0066660_110382751 | 3300006800 | Soil | TGATIGVDRTAAEKAVGIIPQSARSWARCSVLACSSDV* |
| Ga0075421_1001048801 | 3300006845 | Populus Rhizosphere | MDDLIGRLGVVIGVERTAADRAVGIIPQSARSWAQSPALASSSDL* |
| Ga0075425_1024315302 | 3300006854 | Populus Rhizosphere | SAGLVRGYMDDLIGRLGAVIGADRAVAEKAVDSIPQSAGSWARSPVLASSSDV* |
| Ga0075424_1001136681 | 3300006904 | Populus Rhizosphere | MDDLIGRIGATIGVDRTAAEKAVGIIPQSARSWARCSVLA |
| Ga0099794_106228021 | 3300007265 | Vadose Zone Soil | GLVRGYMDDLIGRLGAGSGADRTAAEKAVAIIPQSARSWARFPALASSPNI* |
| Ga0099795_105194001 | 3300007788 | Vadose Zone Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQWARSSARSPAS |
| Ga0099829_100267213 | 3300009038 | Vadose Zone Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPVSASSSHV* |
| Ga0099827_118608431 | 3300009090 | Vadose Zone Soil | MDDLIGRLVANSGDRTAAERAVGIIPQSLRREEPSPMPCA |
| Ga0105245_123445871 | 3300009098 | Miscanthus Rhizosphere | SAGLVRGYMDDLIGRIGAAIGVDRTAAEKAVGIIPQSARSWARCSVLACSSDV* |
| Ga0111538_112984521 | 3300009156 | Populus Rhizosphere | IGADRTAAEKAGGDIPQSARSWARSSVLASSSDL* |
| Ga0075423_101362161 | 3300009162 | Populus Rhizosphere | MDDLIGRVGASIGADRTAAEKAGGDIPQSARSWARSSVLASSSDL* |
| Ga0126374_107796231 | 3300009792 | Tropical Forest Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSP |
| Ga0126384_106689433 | 3300010046 | Tropical Forest Soil | GAGERNMDDLIGRLVATVGVDRTAAKKAVGIIPQSARSSARSPASASSSHI* |
| Ga0126384_110595652 | 3300010046 | Tropical Forest Soil | MDDLIGRIGAAIGADRTAAEKAAGDIPQSARSWPRSSVLASSSDL* |
| Ga0126382_103208112 | 3300010047 | Tropical Forest Soil | MDDLIGRLGAGSGADRTAAEKAVGIIPQSARSWARFPALASSSSV* |
| Ga0126382_122722881 | 3300010047 | Tropical Forest Soil | LVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI* |
| Ga0134088_106517252 | 3300010304 | Grasslands Soil | MDDLIGRLVAPVGVDRTAAAKAVVIIPQSARSSARSP |
| Ga0134064_101799053 | 3300010325 | Grasslands Soil | AESAGLVRGYMDDLIGGLGTVYGADRTAEKVVGIIPQSARSWARAPALANSSNV* |
| Ga0134063_102165023 | 3300010335 | Grasslands Soil | MDDLIGRRGAVVGADRTAADKAVGIIPQSARSWAQSPALASSSDV* |
| Ga0126370_123890792 | 3300010358 | Tropical Forest Soil | ERHMDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRWSARSPASASSSHV* |
| Ga0126378_100377655 | 3300010361 | Tropical Forest Soil | MDGLIGRLDAVVGVDRTVSEKAVGTIPQSARSWGRSPVLVSSSDV* |
| Ga0126378_114511181 | 3300010361 | Tropical Forest Soil | MDGLIGRLDAVVGVDRTAAEKAVGTIPQSARSSARFSILARSSDV* |
| Ga0126379_117713361 | 3300010366 | Tropical Forest Soil | YGQPAESAGLVRGYMDGLIGRLDAVVGVDRTAAEKAVGTIPQSARSSARFSILASSSDV* |
| Ga0126381_1034348151 | 3300010376 | Tropical Forest Soil | TCRERGAGERHMDDLIGRLVAPVGVDRTAAAKAVVIIPQSARSSARSPASASSSHV* |
| Ga0137363_107376282 | 3300012202 | Vadose Zone Soil | MDDLIGRLVATLGVDRTAAEKAVGIIPQSARSSARSPASASSFHI* |
| Ga0137363_117401122 | 3300012202 | Vadose Zone Soil | STCRERGAGERHMDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPVSASSSHV* |
| Ga0137381_100649234 | 3300012207 | Vadose Zone Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSSHI* |
| Ga0137379_100362894 | 3300012209 | Vadose Zone Soil | MDDLIGGLGTVYGADRTAEKVVGIIPQSASSWARSPALANSSNV* |
| Ga0137378_100645583 | 3300012210 | Vadose Zone Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPASASSS |
| Ga0137377_108686913 | 3300012211 | Vadose Zone Soil | YCQPAESAGLVRGYMDDLIGRVGATIGVDRTAAEKAVGTVPQSARSWARSSVLASSSDV* |
| Ga0150985_1046065971 | 3300012212 | Avena Fatua Rhizosphere | LVRGYMDDLIGRVGATIGVDRTAAEKAVGTVPQSARSWARCSVLACSSDV* |
| Ga0137386_106512111 | 3300012351 | Vadose Zone Soil | RLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSSHI* |
| Ga0137369_104878821 | 3300012355 | Vadose Zone Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASS |
| Ga0137385_112011512 | 3300012359 | Vadose Zone Soil | MDDLIGRRGTVVGADRTAADKAVGIIPQSARSWAQSPAL |
| Ga0137360_108956041 | 3300012361 | Vadose Zone Soil | STCRERGAGERHMDDLIGRLVAPVGVDRTAAEKAVGIIPQWARSSARSPASASSSHV* |
| Ga0126375_101549342 | 3300012948 | Tropical Forest Soil | MDGLIGRLDAVVGVDRTVAEKAVGTIPQSARSSARFSILASSSDV* |
| Ga0126375_102969732 | 3300012948 | Tropical Forest Soil | MDDLIGRIGAAIGADRTAAEKAGGDIQQSARSWARSSVLASSSDL* |
| Ga0164301_101175111 | 3300012960 | Soil | MDDLIGRTGAMIGVDRTAAEKAVGIIPQSARSWARC |
| Ga0126369_101312642 | 3300012971 | Tropical Forest Soil | MDDLIGRIGAAIGADRTAAEKAAGDIPQSARSWPRSSVLASSSDR* |
| Ga0126369_104155371 | 3300012971 | Tropical Forest Soil | MDGLIGRLDAVVGVDRTAAEKAVGTIPQSARSSARFSILA |
| Ga0126369_120719541 | 3300012971 | Tropical Forest Soil | MDDLIGRLVAPVGVDRTAVEKAVGIIPQSARSSARSPASASS |
| Ga0164304_102242003 | 3300012986 | Soil | AESAGLVRGYMDDLIGRIGAATGVDRTAAEKAVGIIPQSARSWARCSVLASSSDV* |
| Ga0132258_102100827 | 3300015371 | Arabidopsis Rhizosphere | MDDLIGRIGASIGADRTAAEKAGGDIPQSARSWARSSVLASSSDL* |
| Ga0132256_1017858351 | 3300015372 | Arabidopsis Rhizosphere | RHMDDLIGRLVAPVGVDRTAAEKAVGIIPQWARSSARSPASASSSHF* |
| Ga0182041_114284441 | 3300016294 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASAS |
| Ga0182037_114665291 | 3300016404 | Soil | GRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0182039_114576961 | 3300016422 | Soil | MDDLIGCLVAPVGVDRTAAEKAVGIIPQSARSSARSPVSASSSH |
| Ga0066667_102084681 | 3300018433 | Grasslands Soil | MDDFIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL |
| Ga0066662_102462332 | 3300018468 | Grasslands Soil | MDDLIGRRGAVVGADRTAADKAVGIIPQSARSWAQSPALASSSDV |
| Ga0066669_100508851 | 3300018482 | Grasslands Soil | AIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL |
| Ga0210406_108946372 | 3300021168 | Soil | MDDLIGRLGAGSGADRTAAEKAVAIIPQSARSWARFPALASSPNI |
| Ga0210397_116370602 | 3300021403 | Soil | MDDLIGRLVAPVGVDRTAAAKAVVIIPQSARSSARSPASAS |
| Ga0126371_102878282 | 3300021560 | Tropical Forest Soil | MDDLIGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL |
| Ga0207684_106461682 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDLIGRLVAPVGVDRTAAEEAVGIIPQSARSSARSP |
| Ga0207675_1022363311 | 3300026118 | Switchgrass Rhizosphere | MDDLIGRIGAAIGVDRTAAEKAVGIIPQSARSWARC |
| Ga0209237_11139292 | 3300026297 | Grasslands Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPAS |
| Ga0209056_100421063 | 3300026538 | Soil | MDDLIGGLGTVYGADRTAEKVVGIIPQSARSWARSPALANSSNV |
| Ga0209156_104792321 | 3300026547 | Soil | IGRIGAAIGADRTAAEKAGGDIPQSARSWPRSSVLASSSDL |
| Ga0209577_101055621 | 3300026552 | Soil | RGYMDDLIGGLGTVYGADRTAEKVVGIIPQSARSWARSPALANSSNV |
| Ga0179593_10146114 | 3300026555 | Vadose Zone Soil | MDDLIGRLVATVGVDRTAAEKAVGILLQSAIVGAIPASASSSDV |
| Ga0207944_10229832 | 3300027105 | Forest Soil | PAESAGLVRGYMDDLIGRTGAMIGVDRTAAEKAVGIIPQSARSWARCSVLASSSDV |
| Ga0209590_108996361 | 3300027882 | Vadose Zone Soil | MDDLIGRLVANSGDRTAAERAVGIIPQSLRREEPSPMPCAGATMPASNPS |
| Ga0307278_100066237 | 3300028878 | Soil | MDDLIGRLVATVGVDRTAAEKAVGILLQSAIIGAIPASASSSDV |
| Ga0308197_103145702 | 3300031093 | Soil | AGLVRGYMDDLIGRNDATIGVDRTAAEKAVGIIPQSARSWARCSVLASSSDV |
| Ga0318538_100413431 | 3300031546 | Soil | MDDLIGRLVAKVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0318538_107835561 | 3300031546 | Soil | IGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0318528_100694682 | 3300031561 | Soil | MDDLIGRLVAPIGVDRTAAEKAVGIIPQSARSSARSPVSASSSHF |
| Ga0318528_101480271 | 3300031561 | Soil | RECGAGERHMDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0318528_107874981 | 3300031561 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASA |
| Ga0318555_101695272 | 3300031640 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARS |
| Ga0318560_102981352 | 3300031682 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASASS |
| Ga0318496_106975012 | 3300031713 | Soil | AGERHMDDLIGRLVAKVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0306917_101499381 | 3300031719 | Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASA |
| Ga0318500_100002479 | 3300031724 | Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARYPASASSFHI |
| Ga0318501_100226192 | 3300031736 | Soil | MDDLIGRLVAPIGVDRTAAEKAVGIIPQSARSSARSPVSASSSLF |
| Ga0318526_100099171 | 3300031769 | Soil | MTTPDLIGRLVAPVGVDRTAAEKAFGIIPQSARSSARSPASASSSHI |
| Ga0318521_100571652 | 3300031770 | Soil | MDDLIGRLVAPVGVDRTAAEKAFGIIPQSARSSARSPASASSSH |
| Ga0318497_100814931 | 3300031805 | Soil | RHMDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASASSSHV |
| Ga0318511_101184672 | 3300031845 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPAS |
| Ga0318544_101279471 | 3300031880 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASASSSHV |
| Ga0306925_105651791 | 3300031890 | Soil | DLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPASASSSPV |
| Ga0318536_100474651 | 3300031893 | Soil | MDDLIGRLVATVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0310909_105348471 | 3300031947 | Soil | ECGAGERHMDDLIGRLVAKVGVDRTAAEKAVGIIPQSARSSARSPASASSFHI |
| Ga0318531_100984981 | 3300031981 | Soil | MDDLIGRLVAPIGVDRTAAEKAVGIIPQSARSSARSPVSASSSH |
| Ga0318569_100739321 | 3300032010 | Soil | STCRECGAGERHMDDLIGRLVAPVGVDRTAAEKAFGIIPQSARSSARSPASASSSHI |
| Ga0318569_104200631 | 3300032010 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSP |
| Ga0318532_102990451 | 3300032051 | Soil | GERHMDDLIGRLVAPVGVDRTAAEKAFGIIPQSARSSARSPASASSSHI |
| Ga0318506_103995042 | 3300032052 | Soil | MDDLIGRLVAPVGVDRTAAEKAVGIIPQSTRSSARSPA |
| Ga0306924_113990371 | 3300032076 | Soil | MDDLIGRLVAKVGVDRTAAEKAVGIIPQSARSSARSP |
| Ga0318518_105786352 | 3300032090 | Soil | HMDDLIGRLVAPVGVDRTAAEKAVGIIPQSARSSARSPVSASSSHV |
| ⦗Top⦘ |