


| Basic Information | |
|---|---|
| Family ID | F075076 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MASSSKSKGSVKTVEWWKHLRDRKRAQNKLVRRDGKKQTKEEK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 38.14 % |
| % of genes near scaffold ends (potentially truncated) | 21.01 % |
| % of genes from short scaffolds (< 2000 bps) | 63.03 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.546 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (15.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.933 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (47.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF10263 | SprT-like | 10.17 |
| PF05257 | CHAP | 3.39 |
| PF06067 | DUF932 | 2.54 |
| PF02562 | PhoH | 1.69 |
| PF13730 | HTH_36 | 1.69 |
| PF03420 | Peptidase_S77 | 1.69 |
| PF03851 | UvdE | 1.69 |
| PF14090 | HTH_39 | 0.85 |
| PF02511 | Thy1 | 0.85 |
| PF04851 | ResIII | 0.85 |
| PF13392 | HNH_3 | 0.85 |
| PF13203 | DUF2201_N | 0.85 |
| PF02945 | Endonuclease_7 | 0.85 |
| PF06945 | DUF1289 | 0.85 |
| PF14243 | R2K_3 | 0.85 |
| PF00959 | Phage_lysozyme | 0.85 |
| PF09722 | Xre_MbcA_ParS_C | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF07659 | DUF1599 | 0.85 |
| PF03796 | DnaB_C | 0.85 |
| PF00004 | AAA | 0.85 |
| PF13884 | Peptidase_S74 | 0.85 |
| PF04404 | ERF | 0.85 |
| PF09003 | Arm-DNA-bind_1 | 0.85 |
| PF01510 | Amidase_2 | 0.85 |
| PF10030 | DUF2272 | 0.85 |
| PF04098 | Rad52_Rad22 | 0.85 |
| PF04977 | DivIC | 0.85 |
| PF09588 | YqaJ | 0.85 |
| PF00476 | DNA_pol_A | 0.85 |
| PF01844 | HNH | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.69 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.69 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 1.69 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.85 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.85 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.85 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.85 |
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.85 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.85 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.55 % |
| All Organisms | root | All Organisms | 34.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000929|NpDRAFT_10029727 | All Organisms → cellular organisms → Bacteria | 10101 | Open in IMG/M |
| 3300000929|NpDRAFT_10051437 | Not Available | 2447 | Open in IMG/M |
| 3300001844|RCM35_1082140 | Not Available | 550 | Open in IMG/M |
| 3300002295|B570J29593_1013558 | Not Available | 562 | Open in IMG/M |
| 3300002372|B570J29634_102116 | Not Available | 828 | Open in IMG/M |
| 3300002374|B570J29620_1006253 | Not Available | 775 | Open in IMG/M |
| 3300002381|B570J29641_1011322 | Not Available | 664 | Open in IMG/M |
| 3300002835|B570J40625_100255757 | All Organisms → Viruses → Predicted Viral | 1820 | Open in IMG/M |
| 3300004448|Ga0065861_1118563 | Not Available | 844 | Open in IMG/M |
| 3300004448|Ga0065861_1191296 | Not Available | 511 | Open in IMG/M |
| 3300004461|Ga0066223_1137890 | Not Available | 1240 | Open in IMG/M |
| 3300004481|Ga0069718_14896419 | Not Available | 2033 | Open in IMG/M |
| 3300004693|Ga0065167_1042596 | Not Available | 739 | Open in IMG/M |
| 3300004805|Ga0007792_10013831 | Not Available | 2481 | Open in IMG/M |
| 3300005346|Ga0074242_11035331 | Not Available | 643 | Open in IMG/M |
| 3300005510|Ga0066825_10137305 | All Organisms → Viruses | 897 | Open in IMG/M |
| 3300005588|Ga0070728_10002874 | All Organisms → cellular organisms → Bacteria | 20261 | Open in IMG/M |
| 3300005731|Ga0076919_1002448 | All Organisms → cellular organisms → Bacteria | 21426 | Open in IMG/M |
| 3300005941|Ga0070743_10004656 | Not Available | 4972 | Open in IMG/M |
| 3300005941|Ga0070743_10004656 | Not Available | 4972 | Open in IMG/M |
| 3300006030|Ga0075470_10003447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 4925 | Open in IMG/M |
| 3300006193|Ga0075445_10050067 | Not Available | 1662 | Open in IMG/M |
| 3300006752|Ga0098048_1173799 | Not Available | 639 | Open in IMG/M |
| 3300006875|Ga0075473_10021001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2507 | Open in IMG/M |
| 3300006919|Ga0070746_10323885 | Not Available | 703 | Open in IMG/M |
| 3300006924|Ga0098051_1002924 | Not Available | 5891 | Open in IMG/M |
| 3300006924|Ga0098051_1143035 | Not Available | 634 | Open in IMG/M |
| 3300006925|Ga0098050_1001296 | Not Available | 8682 | Open in IMG/M |
| 3300006925|Ga0098050_1078791 | Not Available | 850 | Open in IMG/M |
| 3300007544|Ga0102861_1031936 | Not Available | 1339 | Open in IMG/M |
| 3300007644|Ga0102902_1085641 | Not Available | 943 | Open in IMG/M |
| 3300007960|Ga0099850_1357570 | Not Available | 546 | Open in IMG/M |
| 3300008227|Ga0105358_10265499 | Not Available | 713 | Open in IMG/M |
| 3300008448|Ga0114876_1034737 | All Organisms → Viruses → Predicted Viral | 2425 | Open in IMG/M |
| 3300008450|Ga0114880_1047424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1832 | Open in IMG/M |
| 3300008470|Ga0115371_11202738 | Not Available | 2146 | Open in IMG/M |
| 3300008996|Ga0102831_1062437 | Not Available | 1244 | Open in IMG/M |
| 3300009000|Ga0102960_1073311 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300009001|Ga0102963_1008211 | Not Available | 4495 | Open in IMG/M |
| 3300009027|Ga0102957_1065836 | Not Available | 1246 | Open in IMG/M |
| 3300009059|Ga0102830_1192506 | Not Available | 597 | Open in IMG/M |
| 3300009075|Ga0105090_10981689 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009081|Ga0105098_10000033 | Not Available | 39201 | Open in IMG/M |
| 3300009149|Ga0114918_10370423 | Not Available | 786 | Open in IMG/M |
| 3300009165|Ga0105102_10015298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 3017 | Open in IMG/M |
| 3300009169|Ga0105097_10299475 | Not Available | 888 | Open in IMG/M |
| 3300009172|Ga0114995_10003976 | All Organisms → cellular organisms → Bacteria | 9908 | Open in IMG/M |
| 3300009409|Ga0114993_10687342 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 746 | Open in IMG/M |
| 3300009425|Ga0114997_10668946 | Not Available | 544 | Open in IMG/M |
| 3300009432|Ga0115005_10043432 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3450 | Open in IMG/M |
| 3300009785|Ga0115001_10049825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2758 | Open in IMG/M |
| 3300010149|Ga0098049_1070114 | Not Available | 1108 | Open in IMG/M |
| 3300010368|Ga0129324_10079368 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300011126|Ga0151654_1006401 | Not Available | 541 | Open in IMG/M |
| 3300013004|Ga0164293_10179291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1549 | Open in IMG/M |
| 3300013372|Ga0177922_10889049 | Not Available | 822 | Open in IMG/M |
| 3300017706|Ga0181377_1013641 | All Organisms → Viruses → Predicted Viral | 1896 | Open in IMG/M |
| 3300017746|Ga0181389_1154886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella | 608 | Open in IMG/M |
| 3300017780|Ga0181346_1084844 | Not Available | 1244 | Open in IMG/M |
| 3300017780|Ga0181346_1205432 | Not Available | 708 | Open in IMG/M |
| 3300017785|Ga0181355_1066964 | Not Available | 1511 | Open in IMG/M |
| 3300017785|Ga0181355_1113008 | Not Available | 1116 | Open in IMG/M |
| 3300017963|Ga0180437_10035252 | Not Available | 4972 | Open in IMG/M |
| 3300017971|Ga0180438_10512510 | Not Available | 896 | Open in IMG/M |
| 3300017971|Ga0180438_10673660 | Not Available | 761 | Open in IMG/M |
| 3300017987|Ga0180431_10873170 | Not Available | 598 | Open in IMG/M |
| 3300017989|Ga0180432_11097720 | Not Available | 537 | Open in IMG/M |
| 3300017991|Ga0180434_10017172 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 7283 | Open in IMG/M |
| 3300017991|Ga0180434_10633491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300018080|Ga0180433_10117397 | All Organisms → Viruses → Predicted Viral | 2268 | Open in IMG/M |
| 3300020358|Ga0211689_1011658 | All Organisms → Viruses → Predicted Viral | 3206 | Open in IMG/M |
| 3300020515|Ga0208234_1000004 | Not Available | 57908 | Open in IMG/M |
| 3300020515|Ga0208234_1020534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Moraxella → Moraxella osloensis | 771 | Open in IMG/M |
| 3300020538|Ga0208595_1000999 | Not Available | 9379 | Open in IMG/M |
| 3300020539|Ga0207941_1000006 | Not Available | 95097 | Open in IMG/M |
| 3300021085|Ga0206677_10074950 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300021371|Ga0213863_10313490 | Not Available | 654 | Open in IMG/M |
| 3300021958|Ga0222718_10189281 | Not Available | 1131 | Open in IMG/M |
| 3300021960|Ga0222715_10193659 | Not Available | 1222 | Open in IMG/M |
| 3300021962|Ga0222713_10001892 | All Organisms → cellular organisms → Bacteria | 22822 | Open in IMG/M |
| 3300021964|Ga0222719_10640719 | Not Available | 611 | Open in IMG/M |
| 3300022198|Ga0196905_1139088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300022200|Ga0196901_1000176 | Not Available | 34745 | Open in IMG/M |
| 3300024343|Ga0244777_10036936 | Not Available | 3110 | Open in IMG/M |
| 3300024346|Ga0244775_10005745 | All Organisms → cellular organisms → Bacteria | 12518 | Open in IMG/M |
| 3300024346|Ga0244775_10733889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 794 | Open in IMG/M |
| 3300025436|Ga0208103_1016394 | Not Available | 1028 | Open in IMG/M |
| 3300025635|Ga0208147_1000916 | All Organisms → cellular organisms → Bacteria | 9868 | Open in IMG/M |
| 3300025769|Ga0208767_1226374 | Not Available | 605 | Open in IMG/M |
| 3300025848|Ga0208005_1114686 | Not Available | 841 | Open in IMG/M |
| 3300025889|Ga0208644_1141513 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300026136|Ga0208763_1048680 | Not Available | 622 | Open in IMG/M |
| 3300026183|Ga0209932_1039625 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300026187|Ga0209929_1026837 | Not Available | 1757 | Open in IMG/M |
| 3300027205|Ga0208926_1050140 | Not Available | 618 | Open in IMG/M |
| 3300027531|Ga0208682_1125345 | Not Available | 590 | Open in IMG/M |
| 3300027704|Ga0209816_1021867 | Not Available | 3367 | Open in IMG/M |
| 3300027791|Ga0209830_10293743 | Not Available | 723 | Open in IMG/M |
| 3300027813|Ga0209090_10416141 | Not Available | 643 | Open in IMG/M |
| 3300027828|Ga0209692_10027143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3449 | Open in IMG/M |
| 3300027956|Ga0209820_1000026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39205 | Open in IMG/M |
| 3300027972|Ga0209079_10210278 | Not Available | 665 | Open in IMG/M |
| 3300028025|Ga0247723_1077403 | Not Available | 883 | Open in IMG/M |
| 3300031143|Ga0308025_1014333 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3218 | Open in IMG/M |
| 3300031539|Ga0307380_11291951 | Not Available | 558 | Open in IMG/M |
| 3300031673|Ga0307377_10807913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300031676|Ga0302136_1051928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1417 | Open in IMG/M |
| 3300031772|Ga0315288_10319194 | Not Available | 1613 | Open in IMG/M |
| 3300031861|Ga0315319_10402651 | Not Available | 687 | Open in IMG/M |
| 3300032212|Ga0316207_10280694 | Not Available | 631 | Open in IMG/M |
| 3300033996|Ga0334979_0072120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2195 | Open in IMG/M |
| 3300034062|Ga0334995_0007776 | Not Available | 10324 | Open in IMG/M |
| 3300034068|Ga0334990_0183305 | Not Available | 1144 | Open in IMG/M |
| 3300034093|Ga0335012_0016684 | Not Available | 4392 | Open in IMG/M |
| 3300034101|Ga0335027_0000756 | Not Available | 28446 | Open in IMG/M |
| 3300034102|Ga0335029_0003792 | Not Available | 12012 | Open in IMG/M |
| 3300034104|Ga0335031_0033848 | All Organisms → Viruses → Predicted Viral | 3718 | Open in IMG/M |
| 3300034283|Ga0335007_0081659 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.13% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.72% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 6.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.04% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.36% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.36% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.68% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.68% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.84% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.84% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.84% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.84% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.84% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.84% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.84% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300002295 | Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002372 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002374 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002381 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008227 | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM15C Gulf of Mexico | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020538 | Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031676 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300032212 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyrite | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_100297275 | 3300000929 | Freshwater And Marine | MSSSAKSKGSVPTVQWWKHLRKYWKRVQNKRVRADGKKQTQQ* |
| NpDRAFT_100514376 | 3300000929 | Freshwater And Marine | MSSSAKGKGNVPTVQWWKHLRKYWKRVQNKRVRADGKKQTQQ* |
| RCM35_10821402 | 3300001844 | Marine Plankton | MPSSSKSKGSVRTLQWWKHLRDWKRPQNKRVRKDGKKQIKDES* |
| B570J29593_10135582 | 3300002295 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWRRVQNKRVRKDGKKEIQKELKYD* |
| B570J29634_1021163 | 3300002372 | Freshwater | MSSSSKSKGGVKTVQWWKHLRKYYKRIQNKRVRKDGKKEINKEH* |
| B570J29620_10062533 | 3300002374 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIRKEL* |
| B570J29641_10113221 | 3300002381 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIRKEL*YNKV*PTN |
| B570J40625_1002557572 | 3300002835 | Freshwater | MSSSAKSKGSVPTVQWWKHLRKYWKRVQNKRVRSDGKKEIKKEI* |
| Ga0065861_11185631 | 3300004448 | Marine | MASASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGKNQIK |
| Ga0065861_11912961 | 3300004448 | Marine | MASAGKGKGWVKAVEWWKHLRKFAKRRQNKRVRKDGKKQIKTEE* |
| Ga0066223_11378903 | 3300004461 | Marine | MASASKGKGAVKTVEWWRHLRPFGERRQNKKVRKDGKNQIKNEEL* |
| Ga0069718_148964197 | 3300004481 | Sediment | MASSSKSKGAVKTVQWWKHLREYKRAQNKLVRRDGKKTIQKELQ* |
| Ga0065167_10425962 | 3300004693 | Freshwater | MSSVSKGKGAVFTRDWAKHLRPYGKRQAAKDVRKDGKKQIKEIL |
| Ga0007792_100138314 | 3300004805 | Freshwater | MSSVSKGKGAVFTRDWAKHLRPYGKRQAAKDVRKDGKKQIKEILEDK* |
| Ga0074242_110353311 | 3300005346 | Saline Water And Sediment | MASSSERKGGVKPVEWWKHLRDRKRDQNKKVRQDGKRLIKGANNEEVN* |
| Ga0066825_101373054 | 3300005510 | Marine | MASSSERKGGVKTVEWWKHLRHQKRTQNKRVRKDGKKQIESGRKELE* |
| Ga0070728_1000287414 | 3300005588 | Marine Sediment | MASSSKGKGAVKTVEWWKHLRDRKRDQQKKVRVDGKRQVREEKGG* |
| Ga0076919_100244830 | 3300005731 | M | MASSSKGKGGVKTVEWWKHLRPYGKKRQNKKVREDGKKRIRDSE* |
| Ga0070743_1000465613 | 3300005941 | Estuarine | MNSSAKGKGSVSTVQWWKHLRKYWKRVQNKRVRADGKKQTQQ* |
| Ga0070743_100046568 | 3300005941 | Estuarine | MSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIQKEL* |
| Ga0075470_100034478 | 3300006030 | Aqueous | MASSSKSKGGVKTVEWWKHLRDRKRAQNKLVRQDGKREIKEEK* |
| Ga0075445_100500671 | 3300006193 | Marine | MASSSKGKGSVKTVEWWKHLRPFGKRRQNKKVRKDGKKQIKTDEQ* |
| Ga0098048_11737993 | 3300006752 | Marine | MSSASKRKGAVRTVEWWKHLRKRKRAQNKLVRRNGQQQTGESNE* |
| Ga0075473_100210012 | 3300006875 | Aqueous | MLVAMASSSKSKGGVKTVEWWKHLRDRKRAQNKLVRQDGKREIKEEK* |
| Ga0070746_103238852 | 3300006919 | Aqueous | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKQEN* |
| Ga0098051_100292411 | 3300006924 | Marine | MASASKSKGGVKAVEWWKHLRNRKRDQNKLVRKDGKEKTKEVYDEK* |
| Ga0098051_11430353 | 3300006924 | Marine | MSSASKRKGAVRTVEWWKHLRKRKRAQNKLVRKDGQKQTGESDG* |
| Ga0098050_10012966 | 3300006925 | Marine | MASASKGKGGVKAVEWWKHLRNRKRDQNKLVRKDGKKKTKEVYDEK* |
| Ga0098050_10787911 | 3300006925 | Marine | AVKTVEWWKHLRERKRAQNKLVRRNGQQQTGESNE* |
| Ga0102861_10319362 | 3300007544 | Estuarine | MASSSKSKGSVKTVEWWKHLRDRKRAQNKLVRRDGKKQTKEEK* |
| Ga0102902_10856414 | 3300007644 | Estuarine | MNSSAKGKGSVSTVQWWKHLRKYWKRVQNKRVRADGKK |
| Ga0099850_13575703 | 3300007960 | Aqueous | MASSSGRKGGVKTLEWWKHLRYRKREQNKLVRRDGKKQI |
| Ga0105358_102654991 | 3300008227 | Methane Seep Mesocosm | MATASRGKGFVKPMEWWDHLKWCKRPQNKRVRQDGKKQIKEEIKN* |
| Ga0114876_10347378 | 3300008448 | Freshwater Lake | MSSSSKSKGAVATVQWWKHLRKYWKRKQNKRVRKDGKKTIDKEL* |
| Ga0114880_10474245 | 3300008450 | Freshwater Lake | MASSSKSKGSVRTVEWWKHLRDRKRAQNKLVRRDGKKQTKEEK* |
| Ga0115371_112027383 | 3300008470 | Sediment | MASASKGRGLVKTVEWWKHLRPFGKRRQNKKVRKDGKNQIKNEEL* |
| Ga0102831_10624371 | 3300008996 | Estuarine | FVRNSDSMSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIQKEL* |
| Ga0102960_10733112 | 3300009000 | Pond Water | MMASSGKGKGSVKTVEWWKHLKWRKRDQNKLVRKDGKKQIQNEAE* |
| Ga0102963_10082115 | 3300009001 | Pond Water | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKQENDS* |
| Ga0102957_10658365 | 3300009027 | Pond Water | KGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKQENDS* |
| Ga0102830_11925061 | 3300009059 | Estuarine | MSSSAKSKGSVPTVQWWKHLRKYWKRVQNKRVRADGKKQIQE* |
| Ga0105090_109816891 | 3300009075 | Freshwater Sediment | QSLTSMSSSAKSKGGVKTVQWWKHLRKYWGRVQNKRVRKDGKKEIQKEL* |
| Ga0105098_1000003337 | 3300009081 | Freshwater Sediment | MASAGKGKGWVKTVEWWKHLRWMKRPQNKRVRADGKKQIEKETL* |
| Ga0114918_103704232 | 3300009149 | Deep Subsurface | MMSSSGKGKGSVKTIEWWKHLRKRKRAQNKLVRKDGKKKALEGK* |
| Ga0105102_100152987 | 3300009165 | Freshwater Sediment | MASSSKSKGGIKTVEWWKHLRDRKRAQNKLVRQDGKKEIKEQK* |
| Ga0105097_102994751 | 3300009169 | Freshwater Sediment | SKGKGWVKTVEWWKHLRWMKRSQNKRVRADGKKQIDKESL* |
| Ga0114995_1000397612 | 3300009172 | Marine | MASASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGENQIKNEEL* |
| Ga0114993_106873423 | 3300009409 | Marine | MASASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGKNQIKNEEL* |
| Ga0114997_106689462 | 3300009425 | Marine | MASASKGKGAVKPVEWWRHLRPFGKRRQNKKVRKDGKNQIKNEEL* |
| Ga0115005_1004343210 | 3300009432 | Marine | MASVSKGKGAVKTAEWWRHLRPFGKRRQNKKVRKDGKNQIKNEEL* |
| Ga0115004_100315631 | 3300009526 | Marine | AVKTVEWWRHLRPFGKRRQNKKVRKDGENQIKNEEL* |
| Ga0115001_100498251 | 3300009785 | Marine | ASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGENQIKNEEL* |
| Ga0098049_10701141 | 3300010149 | Marine | MSSAGKRKGAVKTVEWWKHLRERKRAQNKLVRRNGQQQTGESNE* |
| Ga0129324_100793681 | 3300010368 | Freshwater To Marine Saline Gradient | MASASKGKGMVKTVEWWKHLRDRKRAQNKLVRVEGKKQITKTSITDD* |
| Ga0151654_10064011 | 3300011126 | Marine | SKGSVKTIEWWKHLRKRKRAQNKLVRKDGKEQIKDGQ* |
| Ga0164293_101792913 | 3300013004 | Freshwater | ASSSKSKGSVRTVEWWKHLRDRKRAQNKLVRRGGQKQIKEEK* |
| Ga0177922_108890492 | 3300013372 | Freshwater | MASSSKGKGSVKTIGWAKHLRPIGKKFQNKAVRNDGKKKI |
| Ga0181377_10136412 | 3300017706 | Marine | MASASKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKSED |
| Ga0181389_11548864 | 3300017746 | Seawater | MASSSKRKGSVKVVEWWKHLRYRKRNQNKLVRQDGKNQIKKEKDE |
| Ga0181346_10848443 | 3300017780 | Freshwater Lake | MASSGKGKGWVKTCEWWKHLRWKKRVQNKIVRKDGKKQIEKEQL |
| Ga0181346_12054321 | 3300017780 | Freshwater Lake | MASSGKGKGWVKTCEWWKHLRWKKRVQNKLVRKDGKKQIVETSDMDG |
| Ga0181355_10669645 | 3300017785 | Freshwater Lake | MASSGKGKGWVKTCEWWKHLRWKKRVQNKLVRKDGKKQIVE |
| Ga0181355_11130082 | 3300017785 | Freshwater Lake | MASSGKGKGWVKTCEWWKHLRWKKRVQNKIVRKDGKKQIVKASDMDG |
| Ga0180437_100352529 | 3300017963 | Hypersaline Lake Sediment | MASSGKRKGSVKTVEWWDHLRDRKRDQNKLVRQDGKKQIEQEKE |
| Ga0180438_105125103 | 3300017971 | Hypersaline Lake Sediment | MASSSKRKGSVKTLEWWKHLRYRKREQNRLVRRDGKKQTQEREE |
| Ga0180438_106736601 | 3300017971 | Hypersaline Lake Sediment | MASSGKGKGSVKTVERWQHLGPRKRDQNKLVRQDGKKQIEQEKE |
| Ga0180431_108731702 | 3300017987 | Hypersaline Lake Sediment | MASISTGKGSVKTLEWWKHLRYRKREQNKLVRRDGKKQIQEREE |
| Ga0180432_110977202 | 3300017989 | Hypersaline Lake Sediment | MASSSKRKGGVKPVEWWDHLRDRKRDQNKRVRQDGKKQTQEREE |
| Ga0180434_100171728 | 3300017991 | Hypersaline Lake Sediment | MASSSKSKGGVRTLEWWKHLRDRKKDQNKLVRQDGKKQVKNESER |
| Ga0180434_106334911 | 3300017991 | Hypersaline Lake Sediment | MMASAGKGKGSVKTLEWWKHLRDRKREQNKLVRRDGKRQINKERD |
| Ga0180433_101173972 | 3300018080 | Hypersaline Lake Sediment | MASSSKGKGGVKTLEWWDHLRKRKRDQNKLVRKDGKKQIREES |
| Ga0211689_101165810 | 3300020358 | Marine | MSSSSIRRGAVKTVEWWKHLRSRKRAQNKLVRQDGKAITKEESK |
| Ga0208234_100000495 | 3300020515 | Freshwater | MSSSSKSKGGVKTVQWWKHLRKYYKRIQNKRVRKDGKKEINKEH |
| Ga0208234_10205341 | 3300020515 | Freshwater | MSSSAKSKGSVPTVQWWKHLRKYWKRVQNKRVRSDGKKEIKKEI |
| Ga0208595_10009991 | 3300020538 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWRRVQNKRVRKDGKKEIQKELKYD |
| Ga0207941_100000627 | 3300020539 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIRKEL |
| Ga0206677_100749505 | 3300021085 | Seawater | MATGSKGKGSVGATEWWKHLRPFNKRKTNKRVRKNGQKQIRETTNE |
| Ga0213863_103134902 | 3300021371 | Seawater | MATGSKGKGSVGATEPWKHLRPFNKRKTNKRVRKDGQKQTKESKDDSNNV |
| Ga0222718_101892814 | 3300021958 | Estuarine Water | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQVKQ |
| Ga0222715_101936594 | 3300021960 | Estuarine Water | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRRDGKKQIKAEE |
| Ga0222713_1000189236 | 3300021962 | Estuarine Water | MASSSKSKGSVKTVQWWKHLRDWKRPQNKRVRQDGKREIKEEK |
| Ga0222719_106407191 | 3300021964 | Estuarine Water | MASSSKRKGSVKTLEWWKHLRYRKREQNKLVRRDGKKQIQERDRD |
| Ga0196905_11390881 | 3300022198 | Aqueous | TGGELVASSSGRKGGVKTLEWWKHLRYRKRDQNKLVRRDGKKQIRETSIGT |
| Ga0196901_100017618 | 3300022200 | Aqueous | MASSSGRKGGVKTLEWWKHLRYRKRDQNKLVRRDGKKQVKQEE |
| Ga0244777_100369368 | 3300024343 | Estuarine | MNSSAKGKGSVSTVQWWKHLRKYWKRVQNKRVRADGKKQTQQ |
| Ga0244775_1000574510 | 3300024346 | Estuarine | MSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIQKEL |
| Ga0244775_107338891 | 3300024346 | Estuarine | MSSSAKGKGSVPTVQWWKHLRKYWKRVQNKRVRADGKKQTQE |
| Ga0208103_10163943 | 3300025436 | Freshwater | MSSVSKGKGAVFTRDWAKHLRPYGKRQAAKDVRKDGKKQIKEILEDK |
| Ga0208147_10009165 | 3300025635 | Aqueous | MLVAMASSSKSKGGVKTVEWWKHLRDRKRAQNKLVRQDGKREIKEEK |
| Ga0208767_12263743 | 3300025769 | Aqueous | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKQEN |
| Ga0208005_11146862 | 3300025848 | Aqueous | MASSSKSKGGVKTVEWWKHLRDRKRAQNKLVRQDGKREIKEEK |
| Ga0208644_11415133 | 3300025889 | Aqueous | MASSSKGKGWVKTVQWWKHLRDWKRNQNKLVRKDGKKQIQETKYETIT |
| Ga0208763_10486801 | 3300026136 | Marine | KGGVKTVEWWKHLRHQKRTQNKRVRKDGKKQIESGRKELE |
| Ga0209932_10396252 | 3300026183 | Pond Water | MASSGKGKGSVKTVEWWKHLKWRKRDQNKLVRKDGKKQIQNEAE |
| Ga0209929_10268374 | 3300026187 | Pond Water | MASAGKGKGWVKTVEWWKHLRKFAKRRQNKRVRKDGKKQIKQENDS |
| Ga0208926_10501403 | 3300027205 | Estuarine | MASSSKSKGSVKTVEWWKHLRDRKRAQNKLVRRDGKKQTKEEK |
| Ga0208682_11253453 | 3300027531 | Estuarine | MNSSAKGKGNVPTVQWWKHLRKYWKRVQNKRVRADGKKQTQQ |
| Ga0209816_10218678 | 3300027704 | Marine | VSSASKRRGAVKTVEWWKHLRERKRAQNKLVRQDGKTQEQGEHNERIA |
| Ga0209830_102937431 | 3300027791 | Marine | MASASKGKGAVKPVEWWRHLRPFGKRRQNKKVRKDGKNQIKNEE |
| Ga0209090_104161412 | 3300027813 | Marine | MASASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGKNQIKNEEL |
| Ga0209692_100271436 | 3300027828 | Marine Sediment | MASSSKGKGAVKTVEWWKHLRDRKRDQQKKVRVDGKRQVREEKGG |
| Ga0209820_100002641 | 3300027956 | Freshwater Sediment | MASAGKGKGWVKTVEWWKHLRWMKRPQNKRVRADGKKQIEKETL |
| Ga0209079_102102783 | 3300027972 | Freshwater Sediment | MASAGKGKGWVKTVEWWKHLRWMKRSQNKRVRADGKKQIDKESL |
| Ga0247723_10774032 | 3300028025 | Deep Subsurface Sediment | MSSSSKSKGSVRTVQWWKHLRDWKRPQNKRVRTDGKKQIKKDE |
| Ga0308025_10143335 | 3300031143 | Marine | MATSSKGKGAVKTVEWWKHLRPFGKRRQNKKVRKDGKNQIKNDSGD |
| Ga0307380_112919513 | 3300031539 | Soil | MASASKGKGSVKTVEWWKHLRDRKRAQNKRVRVDGRKQTIKTT |
| Ga0307377_108079132 | 3300031673 | Soil | MMASAGKGKGYVKPLEWWRHLRWRKRDQNKKVRQDGKKQTREESSDDV |
| Ga0302136_10519281 | 3300031676 | Marine | MASASKGKGAVKTVEWWRHLRPFGKRRQNKKVRKDGEN |
| Ga0315288_103191942 | 3300031772 | Sediment | MLFIAHSMSSSAKSKGGVKTVQWWKHLRKYWSRVQNKRVRKDGKKEIQKEL |
| Ga0315319_104026512 | 3300031861 | Seawater | MASSSKGKGSVNTLQWWKHLKSWKRPQNKLVRKDGKKQIKKETDYEYSNR |
| Ga0316207_102806941 | 3300032212 | Microbial Mat | MASSSRGKGGIKTVEWWKHLRHRKRDQNKRVRQDGKKKLEKDDE |
| Ga0334979_0072120_180_311 | 3300033996 | Freshwater | VASSSKSKGSVRTVEWWKHLRDRKRAQNKLVRRDGQKQTKEEK |
| Ga0334995_0007776_400_534 | 3300034062 | Freshwater | VASSSKSKGSVRTVEWWKHLRDRKRAQNKLVRRDGKKQIAEQKK |
| Ga0334990_0183305_156_287 | 3300034068 | Freshwater | VASSSKSKGSVRTVEWWKHLRDRKRAQNKLVRRGGQKQIKEEK |
| Ga0335012_0016684_1432_1566 | 3300034093 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKYWGRVQNKRVRKDGKKEIQKEL |
| Ga0335027_0000756_23354_23485 | 3300034101 | Freshwater | MSSSAKSKGGVKTVQWWKHLRKFWKRKQNKLVRRNAKQQINKD |
| Ga0335029_0003792_5286_5417 | 3300034102 | Freshwater | MASAGKGKGSVKTVQWWKHLRDWKRPQNKRVRRDGKREIKEEK |
| Ga0335031_0033848_1255_1389 | 3300034104 | Freshwater | MSSSSKSKGGVKTVQWWKHLRKYWRRVQNKRVRKDGKKEIHKEL |
| Ga0335007_0081659_155_289 | 3300034283 | Freshwater | MSSSSKSKGGVKTVQWWKHLRKYWSRVQNKRVRRDGKKEIRKEL |
| ⦗Top⦘ |