


| Basic Information | |
|---|---|
| Family ID | F074890 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 31.09 % |
| % of genes near scaffold ends (potentially truncated) | 24.37 % |
| % of genes from short scaffolds (< 2000 bps) | 61.34 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.941 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.899 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.832 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 55.56% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF06945 | DUF1289 | 18.49 |
| PF12236 | Head-tail_con | 6.72 |
| PF03237 | Terminase_6N | 3.36 |
| PF05866 | RusA | 1.68 |
| PF03592 | Terminase_2 | 1.68 |
| PF16754 | Pesticin | 1.68 |
| PF03796 | DnaB_C | 0.84 |
| PF06378 | DUF1071 | 0.84 |
| PF00182 | Glyco_hydro_19 | 0.84 |
| PF13482 | RNase_H_2 | 0.84 |
| PF02195 | ParBc | 0.84 |
| PF04466 | Terminase_3 | 0.84 |
| PF11351 | GTA_holin_3TM | 0.84 |
| PF12651 | RHH_3 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 18.49 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.68 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.68 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.84 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.84 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.84 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.84 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.94 % |
| All Organisms | root | All Organisms | 47.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10184918 | Not Available | 654 | Open in IMG/M |
| 3300000947|BBAY92_10030594 | Not Available | 1469 | Open in IMG/M |
| 3300000973|BBAY93_10046965 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300003409|JGI26088J50261_1013235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2537 | Open in IMG/M |
| 3300003427|JGI26084J50262_1030054 | Not Available | 1521 | Open in IMG/M |
| 3300003427|JGI26084J50262_1034362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 1354 | Open in IMG/M |
| 3300003621|JGI26083J51738_10015614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2751 | Open in IMG/M |
| 3300004829|Ga0068515_103354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2065 | Open in IMG/M |
| 3300005512|Ga0074648_1006900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8287 | Open in IMG/M |
| 3300005512|Ga0074648_1013084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5229 | Open in IMG/M |
| 3300005512|Ga0074648_1018898 | All Organisms → Viruses → Predicted Viral | 3959 | Open in IMG/M |
| 3300005512|Ga0074648_1167522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 644 | Open in IMG/M |
| 3300006025|Ga0075474_10046971 | Not Available | 1470 | Open in IMG/M |
| 3300006025|Ga0075474_10078854 | Not Available | 1081 | Open in IMG/M |
| 3300006026|Ga0075478_10087202 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300006026|Ga0075478_10170998 | Not Available | 672 | Open in IMG/M |
| 3300006027|Ga0075462_10130819 | Not Available | 772 | Open in IMG/M |
| 3300006027|Ga0075462_10253513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 521 | Open in IMG/M |
| 3300006467|Ga0099972_12543723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 519 | Open in IMG/M |
| 3300006802|Ga0070749_10021839 | All Organisms → Viruses → Predicted Viral | 4048 | Open in IMG/M |
| 3300006802|Ga0070749_10056143 | All Organisms → Viruses | 2385 | Open in IMG/M |
| 3300006802|Ga0070749_10057717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2348 | Open in IMG/M |
| 3300006802|Ga0070749_10144979 | Not Available | 1383 | Open in IMG/M |
| 3300006802|Ga0070749_10255754 | Not Available | 991 | Open in IMG/M |
| 3300006802|Ga0070749_10351058 | Not Available | 820 | Open in IMG/M |
| 3300006802|Ga0070749_10380545 | Not Available | 781 | Open in IMG/M |
| 3300006802|Ga0070749_10480677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 678 | Open in IMG/M |
| 3300006802|Ga0070749_10502667 | Not Available | 660 | Open in IMG/M |
| 3300006802|Ga0070749_10567912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 614 | Open in IMG/M |
| 3300006810|Ga0070754_10019588 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
| 3300006810|Ga0070754_10083859 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300006810|Ga0070754_10104796 | Not Available | 1393 | Open in IMG/M |
| 3300006810|Ga0070754_10340292 | Not Available | 666 | Open in IMG/M |
| 3300006869|Ga0075477_10029761 | Not Available | 2502 | Open in IMG/M |
| 3300006869|Ga0075477_10039235 | Not Available | 2142 | Open in IMG/M |
| 3300006916|Ga0070750_10259364 | Not Available | 753 | Open in IMG/M |
| 3300006916|Ga0070750_10286021 | Not Available | 708 | Open in IMG/M |
| 3300006919|Ga0070746_10049508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2196 | Open in IMG/M |
| 3300007344|Ga0070745_1106421 | Not Available | 1092 | Open in IMG/M |
| 3300007346|Ga0070753_1177526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 797 | Open in IMG/M |
| 3300007538|Ga0099851_1261656 | Not Available | 617 | Open in IMG/M |
| 3300007541|Ga0099848_1057753 | Not Available | 1549 | Open in IMG/M |
| 3300007542|Ga0099846_1260220 | Not Available | 600 | Open in IMG/M |
| 3300007960|Ga0099850_1125881 | Not Available | 1044 | Open in IMG/M |
| 3300008012|Ga0075480_10341901 | Not Available | 749 | Open in IMG/M |
| 3300009000|Ga0102960_1000188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22453 | Open in IMG/M |
| 3300009000|Ga0102960_1023327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2316 | Open in IMG/M |
| 3300009001|Ga0102963_1167929 | Not Available | 881 | Open in IMG/M |
| 3300009124|Ga0118687_10247014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 660 | Open in IMG/M |
| 3300009451|Ga0127402_1089002 | Not Available | 645 | Open in IMG/M |
| 3300010299|Ga0129342_1016490 | Not Available | 3052 | Open in IMG/M |
| 3300010392|Ga0118731_109326606 | All Organisms → Viruses | 1204 | Open in IMG/M |
| 3300017818|Ga0181565_10408687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 894 | Open in IMG/M |
| 3300017824|Ga0181552_10219818 | Not Available | 971 | Open in IMG/M |
| 3300017949|Ga0181584_10005210 | All Organisms → cellular organisms → Bacteria | 9807 | Open in IMG/M |
| 3300017949|Ga0181584_10464818 | Not Available | 783 | Open in IMG/M |
| 3300017950|Ga0181607_10001210 | Not Available | 23196 | Open in IMG/M |
| 3300017950|Ga0181607_10004628 | Not Available | 11760 | Open in IMG/M |
| 3300017950|Ga0181607_10081319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
| 3300017950|Ga0181607_10109651 | All Organisms → Viruses | 1730 | Open in IMG/M |
| 3300017950|Ga0181607_10172156 | Not Available | 1295 | Open in IMG/M |
| 3300017952|Ga0181583_10352869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 924 | Open in IMG/M |
| 3300017952|Ga0181583_10937255 | All Organisms → Viruses | 502 | Open in IMG/M |
| 3300017956|Ga0181580_10893902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage MEP301 | 554 | Open in IMG/M |
| 3300017969|Ga0181585_10619992 | Not Available | 714 | Open in IMG/M |
| 3300018036|Ga0181600_10124573 | Not Available | 1475 | Open in IMG/M |
| 3300018041|Ga0181601_10348685 | Not Available | 805 | Open in IMG/M |
| 3300018041|Ga0181601_10433940 | All Organisms → Viruses | 696 | Open in IMG/M |
| 3300018080|Ga0180433_11245166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 539 | Open in IMG/M |
| 3300018423|Ga0181593_10966534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Methylophilales phage MEP301 | 586 | Open in IMG/M |
| 3300018424|Ga0181591_11048024 | Not Available | 552 | Open in IMG/M |
| 3300018426|Ga0181566_11047325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 548 | Open in IMG/M |
| 3300021335|Ga0213867_1159683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 769 | Open in IMG/M |
| 3300021347|Ga0213862_10097535 | Not Available | 1034 | Open in IMG/M |
| 3300021371|Ga0213863_10002656 | Not Available | 12579 | Open in IMG/M |
| 3300021425|Ga0213866_10182655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1097 | Open in IMG/M |
| 3300021957|Ga0222717_10043764 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
| 3300021958|Ga0222718_10005713 | Not Available | 10025 | Open in IMG/M |
| 3300021958|Ga0222718_10010747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6821 | Open in IMG/M |
| 3300021958|Ga0222718_10017784 | Not Available | 5010 | Open in IMG/M |
| 3300021958|Ga0222718_10019398 | All Organisms → Viruses → Predicted Viral | 4761 | Open in IMG/M |
| 3300021958|Ga0222718_10038451 | Not Available | 3131 | Open in IMG/M |
| 3300021959|Ga0222716_10533453 | Not Available | 653 | Open in IMG/M |
| 3300021961|Ga0222714_10065865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2423 | Open in IMG/M |
| 3300021964|Ga0222719_10007153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9437 | Open in IMG/M |
| 3300021964|Ga0222719_10012010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7113 | Open in IMG/M |
| 3300021964|Ga0222719_10014556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6405 | Open in IMG/M |
| 3300021964|Ga0222719_10095311 | Not Available | 2182 | Open in IMG/M |
| 3300021964|Ga0222719_10157988 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300021964|Ga0222719_10598608 | All Organisms → Viruses | 642 | Open in IMG/M |
| 3300022187|Ga0196899_1080318 | Not Available | 999 | Open in IMG/M |
| 3300022937|Ga0255770_10222051 | Not Available | 930 | Open in IMG/M |
| 3300023180|Ga0255768_10134905 | Not Available | 1589 | Open in IMG/M |
| 3300023180|Ga0255768_10363616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 783 | Open in IMG/M |
| 3300025608|Ga0209654_1000734 | Not Available | 30383 | Open in IMG/M |
| 3300025608|Ga0209654_1009045 | All Organisms → Viruses → Predicted Viral | 4522 | Open in IMG/M |
| 3300025608|Ga0209654_1093791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 818 | Open in IMG/M |
| 3300025610|Ga0208149_1008684 | Not Available | 3172 | Open in IMG/M |
| 3300025617|Ga0209138_1007557 | Not Available | 6352 | Open in IMG/M |
| 3300025646|Ga0208161_1068449 | Not Available | 1065 | Open in IMG/M |
| 3300025695|Ga0209653_1001323 | Not Available | 20163 | Open in IMG/M |
| 3300025695|Ga0209653_1001743 | Not Available | 17030 | Open in IMG/M |
| 3300025759|Ga0208899_1062242 | Not Available | 1537 | Open in IMG/M |
| 3300025771|Ga0208427_1028395 | Not Available | 2153 | Open in IMG/M |
| 3300025818|Ga0208542_1190094 | Not Available | 535 | Open in IMG/M |
| 3300025853|Ga0208645_1228959 | Not Available | 636 | Open in IMG/M |
| 3300025853|Ga0208645_1233515 | Not Available | 626 | Open in IMG/M |
| 3300025879|Ga0209555_10085040 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300026138|Ga0209951_1000422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8955 | Open in IMG/M |
| 3300026183|Ga0209932_1002540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5217 | Open in IMG/M |
| 3300027612|Ga0209037_1163971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 536 | Open in IMG/M |
| 3300031539|Ga0307380_10099516 | All Organisms → Viruses | 3002 | Open in IMG/M |
| 3300031565|Ga0307379_10175904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2218 | Open in IMG/M |
| 3300031565|Ga0307379_10402614 | Not Available | 1311 | Open in IMG/M |
| 3300031566|Ga0307378_10502918 | Not Available | 1086 | Open in IMG/M |
| 3300031578|Ga0307376_10093358 | Not Available | 2124 | Open in IMG/M |
| 3300031578|Ga0307376_10291099 | Not Available | 1093 | Open in IMG/M |
| 3300034375|Ga0348336_024646 | Not Available | 2993 | Open in IMG/M |
| 3300034418|Ga0348337_033734 | Not Available | 2305 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 35.29% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 18.49% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 11.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 10.08% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.04% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.20% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.36% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 3.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.68% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.84% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.84% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.84% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.84% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101849182 | 3300000117 | Marine | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLVNIGPLRIQKAEWA* |
| BBAY92_100305943 | 3300000947 | Macroalgal Surface | VIVFNNWSYHWYLGFNFGFEIYEGEIKSEGLTYPVEYLLINIGPLRIQKGEYI* |
| BBAY93_100469654 | 3300000973 | Macroalgal Surface | VIVFSNWSWHWYMGFNIGFEIYEGEIKSDGLTYPVEYFLINIGPLRIQKGQYI* |
| JGI26088J50261_10132353 | 3300003409 | Marine | MWSWHIYLGFNFGFEAYEGEVDGDPVDYFLINIGCIRIQRAEWA* |
| JGI26084J50262_10300542 | 3300003427 | Marine | MWSYHFYWGFNLGFEIYEGEVDGAPVDYFLVNIGPIRIQKAEWA* |
| JGI26084J50262_10343624 | 3300003427 | Marine | MSNWSWHWYMGFNIGFEIYEGEIKSEGLTYPVEYFLINIGPLRIQKGEYI* |
| JGI26083J51738_100156148 | 3300003621 | Marine | MXNWSWHWYMGFNIGFEXXEGEXKSEGXTYPVXYXLINIGPXXIQKAEWX* |
| Ga0068515_1033544 | 3300004829 | Marine Water | MWSWHVYWGFNIGFEIYESEIDGDLVEYFLINLGPIRIQKANWA* |
| Ga0074648_10069004 | 3300005512 | Saline Water And Sediment | MWSYHFYWGFNLGFEIYEGEVDGDPVDYFLINIGPLRLQKAEWS* |
| Ga0074648_10130846 | 3300005512 | Saline Water And Sediment | VIVFNNWSYHWYWGFNFGFEWYEGEVDGNPVDYFLINIGPLRIQKAEWA* |
| Ga0074648_10188985 | 3300005512 | Saline Water And Sediment | MWSWHTYWGFNLGFEWYEGEVDGKPVDYFLINIGPIRIQKAEWA* |
| Ga0074648_11675222 | 3300005512 | Saline Water And Sediment | MWSWHTYWGFNLGFEWYEGEVDGNPVDYFLINIGPIRVQKAEWA* |
| Ga0075474_100469712 | 3300006025 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA* |
| Ga0075474_100788544 | 3300006025 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDGAPVDYFLVNLGPLRIQKAEWA* |
| Ga0075478_100872022 | 3300006026 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINIGPLRIQKAEWA* |
| Ga0075478_101709981 | 3300006026 | Aqueous | SYHLYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA* |
| Ga0075462_101308193 | 3300006027 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0075462_102535133 | 3300006027 | Aqueous | VIVFSNWSYHWYWGFNFGFEWYEGEVDNKPVDYFLINIGPLRIQKAEWA* |
| Ga0099972_125437231 | 3300006467 | Marine | VIVFSNWSYHWYWGLSFGFEWYEGEVDGNPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_100218396 | 3300006802 | Aqueous | MWSYYIYWGFNFGFEWYEGEIDNKPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_100561433 | 3300006802 | Aqueous | MWSYHFYWGFNIGIEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0070749_100577176 | 3300006802 | Aqueous | VIVFNNWSYHWYWGFSFGFEWYEGEVDGNPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_101449792 | 3300006802 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDSQPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_102557541 | 3300006802 | Aqueous | NIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0070749_103510582 | 3300006802 | Aqueous | MWSYHLYWGFNLGFEIYEGEVDGNPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_103805453 | 3300006802 | Aqueous | MWSYHFYWGFNIGVEIYEGEIDGAPVDYFLINIGPLRIQKAEWA* |
| Ga0070749_104806773 | 3300006802 | Aqueous | MWSWHFYLGFNLGCEWYEGEVYGGPVDYFLINLGPIRIQKAEWA* |
| Ga0070749_105026673 | 3300006802 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLVNIGPLRIQKAEWA* |
| Ga0070749_105679123 | 3300006802 | Aqueous | MWSWHIYWGFNFGFEWYEGEVDGDPVDYFLINIGCLRIQKAEWA* |
| Ga0070754_100195886 | 3300006810 | Aqueous | MWSYHFYWGFNLGFEIYEGEIDDKPVDYFLINLGPLRIQKAEWA* |
| Ga0070754_100838593 | 3300006810 | Aqueous | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0070754_101047961 | 3300006810 | Aqueous | MWSYHLYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA* |
| Ga0070754_103402923 | 3300006810 | Aqueous | MWSWHIYWGFNLGFEIYESEIDNDLVEYFLINIGPIRIQRAEWA* |
| Ga0075477_100297617 | 3300006869 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDSQPVDYFLINIGPL |
| Ga0075477_100392354 | 3300006869 | Aqueous | EKSLMWSYYFYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA* |
| Ga0070750_102593641 | 3300006916 | Aqueous | KVMWSYHFYWGFNVGFEIYEGEVDGAPVDYFLVNLGPLRIQKAEWA* |
| Ga0070750_102860212 | 3300006916 | Aqueous | LKLKKVRSSMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0070746_100495086 | 3300006919 | Aqueous | LYLMWSWHIYWGFNFGFEWYEGEVDGDPVDYFLINIGCLRIQKAEWA* |
| Ga0070745_11064213 | 3300007344 | Aqueous | PIWYLVLRKRNNMWSYHFYWGFNIGFEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0070753_11775262 | 3300007346 | Aqueous | VIVFSNWSYHWYWGFNFGFEWYEGEVDGNPVDYFLINIGPLRIQKAEWA* |
| Ga0099851_12616562 | 3300007538 | Aqueous | MQTWYLVLRRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0099848_10577531 | 3300007541 | Aqueous | LMQTWYLVLRRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0099846_12602201 | 3300007542 | Aqueous | RRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINIGPLRIQKAEWA* |
| Ga0099850_11258811 | 3300007960 | Aqueous | LKLMQTWYLVLRRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Ga0075480_103419014 | 3300008012 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKA |
| Ga0102960_100018843 | 3300009000 | Pond Water | MWSYHFYWGFNLGFEIYEGEVEGNLVDYFLINLGPLRIQKAEWA* |
| Ga0102960_10233272 | 3300009000 | Pond Water | MGFNIGFEIYEGEIKSEGLTYPVEYFLINIGPLRIQKGEYI* |
| Ga0102963_11679292 | 3300009001 | Pond Water | MWSYHLYWGFNLGFEIYEGEVDGAPVDYFLVNIGPIRIQKAEWA* |
| Ga0118687_102470141 | 3300009124 | Sediment | LMWSYHFYWGFNLGFEIYEGEVEGNLVDYFLINLGPLRIQKAEWA* |
| Ga0127402_10890022 | 3300009451 | Meromictic Pond | MWSWHYITGFQIGIEVYEGEVDGKPVEYFIIDLGPLRIQRAEWI* |
| Ga0129342_10164902 | 3300010299 | Freshwater To Marine Saline Gradient | MPTWYLVLRRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA* |
| Ga0118731_1093266063 | 3300010392 | Marine | MWSWHIYWGFNIGFEAYEGEVDGDPVDYFLINIGCIRIQKAEWA* |
| Ga0181565_104086872 | 3300017818 | Salt Marsh | MWSWHFYLGFNIGCEWYEGEVDGEPVDYFLINLGPIRIQKAEWA |
| Ga0181552_102198182 | 3300017824 | Salt Marsh | MWSYHFYWGFNLGFEIYEGEVDNQPVDYFLINIGPLRIQKAEWT |
| Ga0181584_1000521013 | 3300017949 | Salt Marsh | MWSWHFYLGFNLGCEWYEGEVDGEPVDYFLINLGPIRIQKAEWA |
| Ga0181584_104648182 | 3300017949 | Salt Marsh | MWSYHFYWGFNLGFEIYEGEVDSQPVDYFLINIGPLRIQKAEWT |
| Ga0181607_1000121035 | 3300017950 | Salt Marsh | MWSYHLYWGFNLGFEIYEGEVDGDPVDYFLVNIGPLRIQRAEWS |
| Ga0181607_100046288 | 3300017950 | Salt Marsh | MWSFHLYWGFNIGFEFYEGEIDEFPVEYFLINLGPLRIQKAEWQ |
| Ga0181607_100813193 | 3300017950 | Salt Marsh | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA |
| Ga0181607_101096513 | 3300017950 | Salt Marsh | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Ga0181607_101721561 | 3300017950 | Salt Marsh | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLVNIGPL |
| Ga0181583_103528694 | 3300017952 | Salt Marsh | MWSWHIYWGFNFGFEWYEGEVDGDLVDYFLINIGCIRIQRAEWA |
| Ga0181583_109372551 | 3300017952 | Salt Marsh | VFSNWSYHWYWGFNFGFEIYEGEIKSEGLTYPVEYLLINIGPLRIQKGEYI |
| Ga0181580_108939021 | 3300017956 | Salt Marsh | LYLMWSWHIYWGFNFGFEWYEGEVDGDLVDYFLINIGCIRIQRAEWA |
| Ga0181585_106199924 | 3300017969 | Salt Marsh | MWSYHLYWGFNVGFEIYEGEVDGEPVDYFLVNLGPLRI |
| Ga0181600_101245732 | 3300018036 | Salt Marsh | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLVNIGPLRIQKAEWA |
| Ga0181601_103486853 | 3300018041 | Salt Marsh | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQK |
| Ga0181601_104339403 | 3300018041 | Salt Marsh | VIVFKNWSWHWYLGFNIGFEIYEGEIKSDGLTYPVEYLLINIGPLRIQKGEYI |
| Ga0180433_112451662 | 3300018080 | Hypersaline Lake Sediment | MWSWHFYLGFNLGIEWYEGEVDNNPVEYFLINLGSLRIQKAEWA |
| Ga0181593_109665341 | 3300018423 | Salt Marsh | MWSWHIYWGFNFGFEWYEGEVDGDLVNYFLINIGCIRIQRAEWA |
| Ga0181591_110480242 | 3300018424 | Salt Marsh | MWSYHFYWGFNLGFEIYEGEVDGAPVDYFLVNLGPLRIQKAEWA |
| Ga0181566_110473252 | 3300018426 | Salt Marsh | VIVFNNWSYHWYWGFNFGFEIYEGEIKSEGLTYPVEYLLINIGPLRIQKGEYI |
| Ga0213867_11596831 | 3300021335 | Seawater | LMWSYHFYLGFNLGFEFYEGEVDGDPVDYFLINIGPLRLQKAEWS |
| Ga0213862_100975352 | 3300021347 | Seawater | MPIWYLALRRRNNMWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINLGPLRIQKAEWA |
| Ga0213863_100026569 | 3300021371 | Seawater | MWSYHFYWGFNVGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA |
| Ga0213866_101826551 | 3300021425 | Seawater | VFNNWSYHWYWGFNFGFEWYEGEVDGNPVDYFLINIGPLRI |
| Ga0222717_100437642 | 3300021957 | Estuarine Water | MWSYHFYWGFNLGFEIYEGEVDDAPVDYFLINLGPLRIQKAEWA |
| Ga0222718_1000571326 | 3300021958 | Estuarine Water | MWSCHFYLGFNLGLEWYEGEVDNNPVDYFLINIGPLRIQKAEWA |
| Ga0222718_100107475 | 3300021958 | Estuarine Water | MWSYHFYWGFNLGFEIYEGEVDGDPVDYFLINIGPLRLQKAEWS |
| Ga0222718_1001778413 | 3300021958 | Estuarine Water | MWSYHFYWGFNLGFEIYESEVDNNLVEYFLINIGPLRIQKAEWA |
| Ga0222718_100193988 | 3300021958 | Estuarine Water | MWSYHLYWGFNLGFEIYEGEIDGNPVDYFLVNLGPLRIQKAEWA |
| Ga0222718_100384512 | 3300021958 | Estuarine Water | MWSYHLYWGFNLGFEIYEGEVDGAPVDYFLVNIGPIRIQKAEWA |
| Ga0222716_105334531 | 3300021959 | Estuarine Water | MWSHHFYWGFNIGFEIYEGEVDGEPVDYFLINLGPLRIQKAEWA |
| Ga0222714_100658653 | 3300021961 | Estuarine Water | MWSWHIYWGFNLGFEAYEGEVDGNPVDYFLINIGCLRFQRAEWA |
| Ga0222719_1000715316 | 3300021964 | Estuarine Water | MWSWHIYWGFNLGFEWYEGEVDGNPVDYFLINIGPLRLQKAEWA |
| Ga0222719_100120108 | 3300021964 | Estuarine Water | MGFNIGFEIYEGEIKSDGLTYPVEYFLINIGPLRIQKGQYI |
| Ga0222719_100145562 | 3300021964 | Estuarine Water | MWSWHIYLGFNFGFEAYEGEVDGDPVDYFLINIGCIRIQRAEWS |
| Ga0222719_100953112 | 3300021964 | Estuarine Water | MWSYHLYLGFNLGFEIYEGEVDGNPVDYFLVNLGPLRIQKAEWA |
| Ga0222719_101579883 | 3300021964 | Estuarine Water | CLMWSYHFYWGFNLGFEIYEGEVEGNLVDYFLINLGPLRIQKAEWA |
| Ga0222719_105986082 | 3300021964 | Estuarine Water | VIVFNNWSYHWYLGFNIGFEIYEGEVKSDGLTYPVEYLLINIGPLRIQKAEWA |
| Ga0196899_10803182 | 3300022187 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLVNIGPLRIQKAEWA |
| Ga0255770_102220513 | 3300022937 | Salt Marsh | MWSYHLYWGFNVGFEIYEGEVDGEPVDYFLVNLGPLRIQKAEWA |
| Ga0255768_101349053 | 3300023180 | Salt Marsh | MWSYHLYWGFNLGFEIYEGEIESEGLTYPVDYFLINLGPLRIQKAQYA |
| Ga0255768_103636163 | 3300023180 | Salt Marsh | MWSFHLYWGFNIGFEFYEGEIDKFPVEYFLINLGPLRIQKAEWQ |
| Ga0209654_100073454 | 3300025608 | Marine | MWSWHIYLGFNFGFEAYEGEVDGDPVDYFLINIGCIRIQRAEWA |
| Ga0209654_10090455 | 3300025608 | Marine | VIVFSNWSWHWYIGFNIGFEIYEGEIKSEGLTYPVEYLLINIGPLRIQKGEYI |
| Ga0209654_10937913 | 3300025608 | Marine | MWSYHIYWGFNIGFEWYEGEVDNKPVDYFLINIGPIRIQKAEWA |
| Ga0208149_10086846 | 3300025610 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA |
| Ga0209138_100755715 | 3300025617 | Marine | MWSHHFYWGFNLGFEIYEGEVDGDPVDYFLINLGPLRIQKAEWA |
| Ga0208161_10684493 | 3300025646 | Aqueous | LMQTWYLVLRRRNNMWSYHFYWGFNIGVEIYEGEVDGAPVDYFLINLGPLRIQKAEWA |
| Ga0209653_10013237 | 3300025695 | Marine | MWSYHFYWGFNLGFEIYEGEVDGAPVDYFLVNIGPIRIQKAEWA |
| Ga0209653_10017436 | 3300025695 | Marine | MNNWSWHWYMGFNIGFEWYEGEIKSEGITYPVDYFLINIGPIRIQKAEWA |
| Ga0208899_10622425 | 3300025759 | Aqueous | MWSYHFYWGFNLGFEIYEGEVDSQPVDYFLINIGPLRIQKAEWA |
| Ga0208427_10283954 | 3300025771 | Aqueous | MWSYYFYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA |
| Ga0208542_11900942 | 3300025818 | Aqueous | MWSYHLYWGFNLGFEIYEGEVDGNPVDYFLINIGPLRIQKAEWA |
| Ga0208645_12289594 | 3300025853 | Aqueous | MWSYHFYWGFNLGFEIYEGEIDDKPVDYFLINLGP |
| Ga0208645_12335154 | 3300025853 | Aqueous | MWSYHLYWGFNLGFEIYEGEVDGDPVDYFLVNLGPLRIQKAEWA |
| Ga0209555_100850402 | 3300025879 | Marine | MSNWSWHWYMGFNIGFEIYEGEIKSEGLTYPVEYFLINIGPLRIQKGEYI |
| Ga0209951_10004229 | 3300026138 | Pond Water | MWSYHFYWGFNLGFEIYEGEVEGNLVDYFLINLGPLRIQKAEWA |
| Ga0209932_10025406 | 3300026183 | Pond Water | MWSWHIYWGFNFGFEWYEGEVDGDPVDYFLINIGCLRIQKAEWA |
| Ga0209037_11639711 | 3300027612 | Marine | LGFNFGFEAYEGEVDGDPVDYFLINIGCIRIQRAEWA |
| Ga0307380_100995163 | 3300031539 | Soil | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Ga0307379_101759041 | 3300031565 | Soil | SHHFYWGFNIGFEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Ga0307379_104026141 | 3300031565 | Soil | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINLGP |
| Ga0307378_105029183 | 3300031566 | Soil | RNNMWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINLGPLRIQKAEWA |
| Ga0307376_100933582 | 3300031578 | Soil | MWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINLGPLRIQKAEWA |
| Ga0307376_102910991 | 3300031578 | Soil | LVLRRRNNMWSHHFYWGFNIGFEIYEGEVDGAPVDYFLINIGPLRIQKAEWA |
| Ga0348336_024646_1981_2115 | 3300034375 | Aqueous | MWSYHFYWGFNIGVEIYEGEVDGAPVDYFLVNLGPLRIQKAEWA |
| Ga0348337_033734_1_126 | 3300034418 | Aqueous | YHFYWGFNLGFEIYEGEVDGAPVDYFLVNLGPLRIQKAEWA |
| ⦗Top⦘ |