


| Basic Information | |
|---|---|
| Family ID | F074829 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWFGYALANVGLAMAAK |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.15 % |
| % of genes near scaffold ends (potentially truncated) | 19.33 % |
| % of genes from short scaffolds (< 2000 bps) | 57.14 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.71 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (48.739 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.387 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.824 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.71 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.25.1.1: Ferritin | d3bvfa1 | 3bvf | 0.94762 |
| a.25.1.1: Ferritin | d4iwka_ | 4iwk | 0.94455 |
| a.25.1.1: Ferritin | d1z6om1 | 1z6o | 0.94257 |
| a.25.1.1: Ferritin | d3ka8a_ | 3ka8 | 0.9414 |
| a.25.1.0: automated matches | d7o6ea_ | 7o6e | 0.93808 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF05136 | Phage_portal_2 | 15.13 |
| PF05876 | GpA_ATPase | 12.61 |
| PF05866 | RusA | 10.92 |
| PF01555 | N6_N4_Mtase | 2.52 |
| PF07120 | DUF1376 | 2.52 |
| PF01726 | LexA_DNA_bind | 2.52 |
| PF12840 | HTH_20 | 2.52 |
| PF13479 | AAA_24 | 2.52 |
| PF05119 | Terminase_4 | 1.68 |
| PF09956 | DUF2190 | 1.68 |
| PF09339 | HTH_IclR | 1.68 |
| PF13589 | HATPase_c_3 | 0.84 |
| PF00145 | DNA_methylase | 0.84 |
| PF05050 | Methyltransf_21 | 0.84 |
| PF05014 | Nuc_deoxyrib_tr | 0.84 |
| PF01135 | PCMT | 0.84 |
| PF03118 | RNA_pol_A_CTD | 0.84 |
| PF01381 | HTH_3 | 0.84 |
| PF04448 | DUF551 | 0.84 |
| PF13884 | Peptidase_S74 | 0.84 |
| PF13384 | HTH_23 | 0.84 |
| PF10520 | Lipid_desat | 0.84 |
| PF13455 | MUG113 | 0.84 |
| PF10124 | Mu-like_gpT | 0.84 |
| PF08241 | Methyltransf_11 | 0.84 |
| PF01391 | Collagen | 0.84 |
| PF01844 | HNH | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 15.13 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 12.61 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 10.92 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.52 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.52 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.52 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 2.52 |
| COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.68 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.84 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.84 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.84 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.84 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.78 % |
| Unclassified | root | N/A | 46.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100069614 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Isosphaera → Isosphaera pallida | 4687 | Open in IMG/M |
| 3300002835|B570J40625_100211352 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2084 | Open in IMG/M |
| 3300004125|Ga0066182_10128975 | Not Available | 618 | Open in IMG/M |
| 3300005525|Ga0068877_10006768 | Not Available | 8708 | Open in IMG/M |
| 3300005525|Ga0068877_10119785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 1634 | Open in IMG/M |
| 3300005525|Ga0068877_10324412 | Not Available | 885 | Open in IMG/M |
| 3300005805|Ga0079957_1000904 | All Organisms → cellular organisms → Bacteria | 27154 | Open in IMG/M |
| 3300005805|Ga0079957_1331597 | Not Available | 673 | Open in IMG/M |
| 3300006637|Ga0075461_10009898 | All Organisms → cellular organisms → Bacteria | 3156 | Open in IMG/M |
| 3300006637|Ga0075461_10063457 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300006637|Ga0075461_10147210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 723 | Open in IMG/M |
| 3300006641|Ga0075471_10030668 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300006802|Ga0070749_10074030 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2040 | Open in IMG/M |
| 3300006802|Ga0070749_10201941 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300006919|Ga0070746_10434125 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 585 | Open in IMG/M |
| 3300007216|Ga0103961_1032496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| 3300007234|Ga0075460_10148587 | Not Available | 818 | Open in IMG/M |
| 3300007234|Ga0075460_10248416 | Not Available | 593 | Open in IMG/M |
| 3300007363|Ga0075458_10274699 | Not Available | 512 | Open in IMG/M |
| 3300007363|Ga0075458_10280992 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 505 | Open in IMG/M |
| 3300008072|Ga0110929_1072920 | Not Available | 783 | Open in IMG/M |
| 3300008448|Ga0114876_1239582 | Not Available | 574 | Open in IMG/M |
| 3300009068|Ga0114973_10006197 | Not Available | 8067 | Open in IMG/M |
| 3300009068|Ga0114973_10023597 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 3790 | Open in IMG/M |
| 3300009068|Ga0114973_10026074 | Not Available | 3578 | Open in IMG/M |
| 3300009149|Ga0114918_10027547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 4118 | Open in IMG/M |
| 3300009154|Ga0114963_10008223 | Not Available | 7089 | Open in IMG/M |
| 3300009154|Ga0114963_10010206 | Not Available | 6377 | Open in IMG/M |
| 3300009154|Ga0114963_10062648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2344 | Open in IMG/M |
| 3300009154|Ga0114963_10072641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
| 3300009154|Ga0114963_10089019 | Not Available | 1900 | Open in IMG/M |
| 3300009154|Ga0114963_10089047 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300009158|Ga0114977_10392848 | Not Available | 774 | Open in IMG/M |
| 3300009183|Ga0114974_10012027 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 6259 | Open in IMG/M |
| 3300009184|Ga0114976_10622143 | Not Available | 546 | Open in IMG/M |
| 3300009504|Ga0114946_10608418 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 552 | Open in IMG/M |
| 3300010157|Ga0114964_10098035 | Not Available | 1457 | Open in IMG/M |
| 3300010334|Ga0136644_10015823 | Not Available | 5158 | Open in IMG/M |
| 3300010334|Ga0136644_10081054 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300010334|Ga0136644_10233745 | Not Available | 1085 | Open in IMG/M |
| 3300010354|Ga0129333_10025819 | All Organisms → cellular organisms → Bacteria | 5565 | Open in IMG/M |
| 3300010885|Ga0133913_10157844 | All Organisms → cellular organisms → Bacteria | 6066 | Open in IMG/M |
| 3300010885|Ga0133913_13542455 | Not Available | 1016 | Open in IMG/M |
| 3300012000|Ga0119951_1009333 | All Organisms → cellular organisms → Bacteria | 4151 | Open in IMG/M |
| 3300012000|Ga0119951_1032670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1669 | Open in IMG/M |
| 3300012000|Ga0119951_1123467 | Not Available | 589 | Open in IMG/M |
| 3300012012|Ga0153799_1000812 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 9449 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1112717 | Not Available | 1029 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10023807 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 5613 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10184018 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 1603 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10943962 | Not Available | 524 | Open in IMG/M |
| 3300013372|Ga0177922_10066561 | Not Available | 1359 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10536528 | Not Available | 650 | Open in IMG/M |
| 3300014962|Ga0134315_1002849 | Not Available | 3110 | Open in IMG/M |
| 3300020498|Ga0208050_1003148 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2135 | Open in IMG/M |
| 3300020547|Ga0208361_1000063 | All Organisms → cellular organisms → Bacteria | 40195 | Open in IMG/M |
| 3300020570|Ga0208465_1004205 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2392 | Open in IMG/M |
| 3300020570|Ga0208465_1041976 | Not Available | 582 | Open in IMG/M |
| 3300023179|Ga0214923_10004301 | Not Available | 17297 | Open in IMG/M |
| 3300023179|Ga0214923_10018603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 6362 | Open in IMG/M |
| 3300023179|Ga0214923_10027988 | Not Available | 4777 | Open in IMG/M |
| 3300023179|Ga0214923_10031210 | All Organisms → cellular organisms → Bacteria | 4427 | Open in IMG/M |
| 3300023179|Ga0214923_10058641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2862 | Open in IMG/M |
| 3300023179|Ga0214923_10075279 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2402 | Open in IMG/M |
| 3300023179|Ga0214923_10106220 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1876 | Open in IMG/M |
| 3300023179|Ga0214923_10206767 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300023179|Ga0214923_10208603 | Not Available | 1143 | Open in IMG/M |
| 3300024262|Ga0210003_1081391 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1524 | Open in IMG/M |
| 3300025135|Ga0209498_1329724 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 510 | Open in IMG/M |
| 3300025445|Ga0208424_1003264 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae | 1811 | Open in IMG/M |
| 3300025445|Ga0208424_1007897 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1192 | Open in IMG/M |
| 3300025445|Ga0208424_1017993 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 820 | Open in IMG/M |
| 3300025630|Ga0208004_1081604 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 799 | Open in IMG/M |
| 3300025872|Ga0208783_10034722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae | 2379 | Open in IMG/M |
| 3300025889|Ga0208644_1044007 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 2537 | Open in IMG/M |
| 3300025889|Ga0208644_1159991 | Not Available | 1022 | Open in IMG/M |
| 3300027581|Ga0209651_1043436 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300027734|Ga0209087_1188913 | Not Available | 798 | Open in IMG/M |
| 3300027741|Ga0209085_1003548 | All Organisms → cellular organisms → Bacteria → PVC group | 8533 | Open in IMG/M |
| 3300027741|Ga0209085_1022756 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300027741|Ga0209085_1040864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2170 | Open in IMG/M |
| 3300027741|Ga0209085_1091257 | Not Available | 1352 | Open in IMG/M |
| 3300027741|Ga0209085_1122371 | Not Available | 1124 | Open in IMG/M |
| 3300027747|Ga0209189_1011495 | Not Available | 5088 | Open in IMG/M |
| 3300027747|Ga0209189_1149536 | Not Available | 1000 | Open in IMG/M |
| 3300027747|Ga0209189_1187012 | Not Available | 862 | Open in IMG/M |
| 3300027759|Ga0209296_1030059 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 3003 | Open in IMG/M |
| 3300027793|Ga0209972_10001381 | Not Available | 21378 | Open in IMG/M |
| 3300027793|Ga0209972_10481668 | Not Available | 513 | Open in IMG/M |
| 3300027805|Ga0209229_10055566 | Not Available | 1766 | Open in IMG/M |
| 3300027971|Ga0209401_1038235 | Not Available | 2265 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1194219 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 758 | Open in IMG/M |
| 3300029930|Ga0119944_1006516 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300029930|Ga0119944_1032654 | Not Available | 664 | Open in IMG/M |
| 3300029933|Ga0119945_1015619 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031857|Ga0315909_10076243 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 2980 | Open in IMG/M |
| 3300031951|Ga0315904_11306097 | Not Available | 548 | Open in IMG/M |
| 3300032092|Ga0315905_11413486 | Not Available | 552 | Open in IMG/M |
| 3300033978|Ga0334977_0000318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32106 | Open in IMG/M |
| 3300033981|Ga0334982_0252584 | Not Available | 847 | Open in IMG/M |
| 3300033981|Ga0334982_0393208 | Not Available | 632 | Open in IMG/M |
| 3300033993|Ga0334994_0048059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2677 | Open in IMG/M |
| 3300033993|Ga0334994_0134946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1406 | Open in IMG/M |
| 3300034012|Ga0334986_0154930 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1318 | Open in IMG/M |
| 3300034012|Ga0334986_0249440 | Not Available | 965 | Open in IMG/M |
| 3300034061|Ga0334987_0004637 | All Organisms → cellular organisms → Bacteria | 13181 | Open in IMG/M |
| 3300034062|Ga0334995_0075292 | Not Available | 2641 | Open in IMG/M |
| 3300034062|Ga0334995_0610303 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 632 | Open in IMG/M |
| 3300034071|Ga0335028_0474769 | Not Available | 697 | Open in IMG/M |
| 3300034072|Ga0310127_005068 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 11502 | Open in IMG/M |
| 3300034073|Ga0310130_0011494 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 3066 | Open in IMG/M |
| 3300034092|Ga0335010_0492571 | Not Available | 646 | Open in IMG/M |
| 3300034101|Ga0335027_0054672 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300034101|Ga0335027_0817120 | Not Available | 538 | Open in IMG/M |
| 3300034103|Ga0335030_0174313 | Not Available | 1515 | Open in IMG/M |
| 3300034106|Ga0335036_0023446 | Not Available | 4926 | Open in IMG/M |
| 3300034111|Ga0335063_0526022 | Not Available | 570 | Open in IMG/M |
| 3300034118|Ga0335053_0475105 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 742 | Open in IMG/M |
| 3300034355|Ga0335039_0084663 | Not Available | 1857 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 24.37% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.52% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.68% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.68% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.68% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.84% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.84% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1000696143 | 3300002835 | Freshwater | MSAPLITFVGFVYLAVALDQWSKGSPMAIAWAGYALANVGLALAAK* |
| B570J40625_1002113523 | 3300002835 | Freshwater | MSAPLILIVGVVYLVVAVDQFRQGSPGMAIAWFGYALANVGLAMAAK* |
| Ga0066182_101289752 | 3300004125 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAR* |
| Ga0068877_1000676813 | 3300005525 | Freshwater Lake | MSAPLILGVGAVYLFVALDQYRQGSPGMAIAWFGYALANVGLSMVAK* |
| Ga0068877_101197855 | 3300005525 | Freshwater Lake | MSTPLILIVGVVYLAVAVDQFRKGDTGMAIAWFGYALANVGLAMVAK* |
| Ga0068877_103244121 | 3300005525 | Freshwater Lake | VSKTLILAVGAVYLLIACDQWLKGERGMAIAWFGYALANAGLSIAAK* |
| Ga0079957_10009043 | 3300005805 | Lake | MSTPLILFVGVIYLWVAADQAWKGSPMAIAWFGYALANVGLALAAK* |
| Ga0079957_13315972 | 3300005805 | Lake | MSSTLILCVGFVYLMVAVDQWAKGSPGMAIAWFGYALANVGLAMNAR* |
| Ga0075461_100098983 | 3300006637 | Aqueous | MSAPLILAVGVVYLVVALDQYRQGSPGMAIAWAGYALANVGLAMSAK* |
| Ga0075461_100634573 | 3300006637 | Aqueous | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSAK* |
| Ga0075461_101472102 | 3300006637 | Aqueous | MSAPLILCVGVVYLVVALDQYRQGANGMAIAWLGYALANCGLAMSAK* |
| Ga0075471_100306683 | 3300006641 | Aqueous | MSAPLILGVGVVYLLVAVDQYRQGSPGMAIAWAGYALANIGLAMAAK* |
| Ga0070749_100740304 | 3300006802 | Aqueous | VGVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSVR* |
| Ga0070749_102019412 | 3300006802 | Aqueous | MSAPLILGVGVVYIVVAYDQWSKGQAGMAIAWASYGLANIGLAMAAK* |
| Ga0070746_104341251 | 3300006919 | Aqueous | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWAGYAL |
| Ga0103961_10324963 | 3300007216 | Freshwater Lake | MSSPLILAVGAVYLFVAIDQARKGSVGMALAWLGYAVANVGLAWEAR* |
| Ga0075460_101485871 | 3300007234 | Aqueous | RAAEDGSMSAPLILCVGVVYLVVALDQYRQGANGMAIAWLGYALANCGLAMSAK* |
| Ga0075460_102484161 | 3300007234 | Aqueous | VVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSAK* |
| Ga0075458_102746992 | 3300007363 | Aqueous | VYLVVALDQYRQGANGMAIAWLGYALANCGLAMSAK* |
| Ga0075458_102809921 | 3300007363 | Aqueous | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLA |
| Ga0110929_10729203 | 3300008072 | Water Bodies | MSGPLIIGVGVVYLVVAVDQYRQGSPGMALAWLGYALANVGLAMVAK* |
| Ga0114876_12395821 | 3300008448 | Freshwater Lake | LAVSKTLILAVGAVYLLIACDQWLKGERGMAIAWFGYALANAGLSIAAK* |
| Ga0114973_1000619714 | 3300009068 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANCGLAWNAR* |
| Ga0114973_100235977 | 3300009068 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDSGMALAWLGYALANVGLAWNAK* |
| Ga0114973_100260742 | 3300009068 | Freshwater Lake | VSSTLILCVGFVYLMVGVDQFRKGDTGMALAWLGYALANVGLAWNAR* |
| Ga0114918_100275472 | 3300009149 | Deep Subsurface | VYLFVACDQWAKGDAMAIAWFGYALANVGLALAAK* |
| Ga0114963_100082232 | 3300009154 | Freshwater Lake | MSSPLILAVAVVYTFVAFDQWRAGNPGMAVAWAGYAVSNCGLAWAASR* |
| Ga0114963_100102063 | 3300009154 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAK* |
| Ga0114963_100626483 | 3300009154 | Freshwater Lake | MSAPLIIGVGVVYLVVAVDQLRHGHPGMAIAWLGYAIANVGLAWQAWR* |
| Ga0114963_100726412 | 3300009154 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQWSKGSPGMAIAWWGYALANVGLAMNAR* |
| Ga0114963_100890192 | 3300009154 | Freshwater Lake | MSAPVILFVGGIYLLVAIDQFRKGEVGMSIAWLGYAAANVGLAMAAK* |
| Ga0114963_100890474 | 3300009154 | Freshwater Lake | VSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAK* |
| Ga0114977_103928481 | 3300009158 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQFRKGDTGMALAWLGYALANVGLAWNAK* |
| Ga0114974_100120273 | 3300009183 | Freshwater Lake | VSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGCALANIGLAMAAK* |
| Ga0114976_106221431 | 3300009184 | Freshwater Lake | STLILCVGFVYLMVGVDQFRKGDTGMALAWLGYALANVGLAMNAK* |
| Ga0114946_106084182 | 3300009504 | Sediment | MSAPLILFVGGIYLLVAIDQWCKGSPMCIAWLGYAIANIGLAMAAK* |
| Ga0114964_100980351 | 3300010157 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQWSKGSPGMAIAWWGYALAN |
| Ga0136644_100158237 | 3300010334 | Freshwater Lake | MSAPLIIGVGVVYLVVAIDQLRHGHPGMAIAWLGYALANVGLAWQAWR* |
| Ga0136644_100810544 | 3300010334 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQFRKGDPGMALAWLGYALANVGLAWNAR* |
| Ga0136644_102337453 | 3300010334 | Freshwater Lake | MSSPLIIGVGVVYLVVAVDQWRAGHPGMAIAWLGYALANVGLAWQAWR* |
| Ga0129333_100258198 | 3300010354 | Freshwater To Marine Saline Gradient | VYLYVACEQAAKGSPMAIAWFGYALANVGLALASK* |
| Ga0133913_101578442 | 3300010885 | Freshwater Lake | VSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGYALANIGLAMAAK* |
| Ga0133913_135424552 | 3300010885 | Freshwater Lake | MSAPLILSVAVVYTFVAFDQWRAGNPGMAVAWAGYAVSNCGLAWAASR* |
| Ga0119951_10093336 | 3300012000 | Freshwater | VSSPLILSVGAVYLLVAADQLRNGHPGMAIAWLGYAIANVGLAWQAWR* |
| Ga0119951_10326705 | 3300012000 | Freshwater | MSSPLILAVGAVYLAVAVDQARKGETGMAIAWFGYAIANIGLAMSSR* |
| Ga0119951_11234671 | 3300012000 | Freshwater | LAVGAVYLVVAVDQARKGDTGMAIAWFGYAIANIGLAMSSR* |
| Ga0153799_10008122 | 3300012012 | Freshwater | MSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGYALANIGLAMAAK* |
| (restricted) Ga0172374_11127172 | 3300013122 | Freshwater | MSSFLIVCVGVVYAVVACDQWRKGECGMALAWLGYAIANVGLAMNAR* |
| (restricted) Ga0172367_100238076 | 3300013126 | Freshwater | MSAPLIWFVGVIYLAVALDQWAKGSPMAIAWAGYALANVGLALAAK* |
| (restricted) Ga0172372_101840183 | 3300013132 | Freshwater | GPQDGGMSAPLILFVALIYLAVALEQWAKGSPMAIEWAGYALANVGLALSSK* |
| (restricted) Ga0172372_109439621 | 3300013132 | Freshwater | DGGMSAPLILCVGVVYLVVAVDQYRQGSTGMAIAWAGYALANVGLAMSAK* |
| Ga0177922_100665612 | 3300013372 | Freshwater | MSAPLILGVGVVYLVVALDQYRQGSTGMAIAWAGYALANIGLAMAAK* |
| (restricted) Ga0172376_105365281 | 3300014720 | Freshwater | GDHGPQDGGMSAPLILFVALIYLAVALDQWAKGSPMAIAWAGYALANVGLALAAK* |
| Ga0134315_10028494 | 3300014962 | Surface Water | MSAPLILCVGVVYLAVAIDQAMKGSWMGLAWAGYALANVGLALSAK* |
| Ga0208050_10031483 | 3300020498 | Freshwater | MSAPLITFVGFVYLAVALDQWSKGSPMAIAWAGYALANVGLALAAK |
| Ga0208361_100006331 | 3300020547 | Freshwater | MSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGYALANIGLAMAAK |
| Ga0208465_10042054 | 3300020570 | Freshwater | MSAPLILGVGVVYLVVALDQYRQGSTGMAIAWAGYALANIGLAMAAK |
| Ga0208465_10419761 | 3300020570 | Freshwater | VTRGTDMSAPLILFVGALYVYVAFEQMVRGNTGMAIAWAGYALANVGLAMAAK |
| Ga0214923_1000430118 | 3300023179 | Freshwater | MSSTLILAVGCVYLVVAIDQARKGSPMAIAWFGYALANVGLALSAK |
| Ga0214923_1001860311 | 3300023179 | Freshwater | VSSPLILAVGAVYLAVAVDQARKGETGMAIAWFGYAIANIGLAMSSR |
| Ga0214923_100279886 | 3300023179 | Freshwater | MSAPLILAVGGVYLFVAFDQWRQGNQGMAVAWAGYAVANVGLAWAASR |
| Ga0214923_100312108 | 3300023179 | Freshwater | VYLYVAFDQCVKGNTGMAIAWAGYAVANVGLAMSAK |
| Ga0214923_100586414 | 3300023179 | Freshwater | MSAPLILAVGGIYLFVAFDQWRRGEHGMAIAWLGYALANCGLAWAAK |
| Ga0214923_100752797 | 3300023179 | Freshwater | MSAPLILFVGALYVYVAFEQMVRGNTGMAIAWAGYAIANVGLAMAAK |
| Ga0214923_101062206 | 3300023179 | Freshwater | MSAPLILAVGAVYLFVAWDQAMRGNHGMSLAWFGYAVANVGLAWAA |
| Ga0214923_102067673 | 3300023179 | Freshwater | MSAPLILGVGVVYLVVALDQFRQGSPGMALAWFGYAVANVGLAMVAK |
| Ga0214923_102086034 | 3300023179 | Freshwater | MSAPLILAVGAVYLFVAWDQAMRGNHGMSLAWFGYALANVGLAMAAK |
| Ga0210003_10813912 | 3300024262 | Deep Subsurface | VSATLIWIVGGVYLFVACDQWAKGDAMAIAWFGYALANVGLALAAK |
| Ga0209498_13297242 | 3300025135 | Sediment | MSAPLILFVGGIYLLVAIDQWCKGSPMCIAWLGYAIANIGLAMAAK |
| Ga0208424_10032643 | 3300025445 | Aqueous | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSVR |
| Ga0208424_10078972 | 3300025445 | Aqueous | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSAK |
| Ga0208424_10179933 | 3300025445 | Aqueous | MSAPLILAVGVVYLVVALDQYRQGSPGMAIAWAGYALANVGLAMSAK |
| Ga0208004_10816042 | 3300025630 | Aqueous | MSAPLILCVGVVYLVVALDQYRQGANGMAIAWLGYALANCGLAMSAK |
| Ga0208783_100347223 | 3300025872 | Aqueous | MSAPLILGVGVVYLLVAVDQYRQGSPGMAIAWAGYALANIGLAMAAK |
| Ga0208644_10440071 | 3300025889 | Aqueous | GVVYLVVAVDQYRQGSPGMAIAWAGYALANVGLAMSVR |
| Ga0208644_11599912 | 3300025889 | Aqueous | MSAPLILGVGVVYIVVAYDQWSKGQAGMAIAWASYGLANIGLAMAAK |
| Ga0209651_10434363 | 3300027581 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAR |
| Ga0209087_11889132 | 3300027734 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQFRKGDTGMALAWLGYALANVGLAWNAK |
| Ga0209085_10035486 | 3300027741 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQWSKGSPGMAIAWWGYALANVGLAMNAR |
| Ga0209085_10227564 | 3300027741 | Freshwater Lake | VSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAK |
| Ga0209085_10408644 | 3300027741 | Freshwater Lake | MSAPLIIGVGVVYLVVAVDQLRHGHPGMAIAWLGYAIANVGLAWQAWR |
| Ga0209085_10912573 | 3300027741 | Freshwater Lake | MSSPLILAVAVVYTFVAFDQWRAGNPGMAVAWAGYAVSNCGLAWAASR |
| Ga0209085_11223712 | 3300027741 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANVGLAWNAK |
| Ga0209189_10114956 | 3300027747 | Freshwater Lake | MSAPLIIGVGVVYLVVAIDQLRHGHPGMAIAWLGYALANVGLAWQAWR |
| Ga0209189_11495364 | 3300027747 | Freshwater Lake | MSSTLILCVGFVYLMVGIDQFRKGDPGMALAWLGYALANVGLAMNAR |
| Ga0209189_11870123 | 3300027747 | Freshwater Lake | MSSPLIIGVGVVYLVVAVDQWRAGHPGMAIAWLGYALANVGLAWQAWR |
| Ga0209296_10300594 | 3300027759 | Freshwater Lake | VSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGYALANIGLAMAAK |
| Ga0209972_100013818 | 3300027793 | Freshwater Lake | MSAPLILGVGAVYLFVALDQYRQGSPGMAIAWFGYALANVGLSMVAK |
| Ga0209972_104816682 | 3300027793 | Freshwater Lake | VSKTLILAVGAVYLLIACDQWLKGERGMAIAWFGYALANAGLSIAAK |
| Ga0209229_100555664 | 3300027805 | Freshwater And Sediment | MSAPLIIGVGLVYLVVALDQYRQGSPGMAIAWFGYALANVGLAMVAK |
| Ga0209401_10382352 | 3300027971 | Freshwater Lake | MSSTLILCVGFVYLMVGVDQFRKGDPGMALAWLGYALANCGLAWNAR |
| (restricted) Ga0247831_11942193 | 3300028559 | Freshwater | AVGVVYLVVAVDQYRQGSPGMAIAWFGYALANVGLAMAAK |
| Ga0119944_10065162 | 3300029930 | Aquatic | MSTPLILIVGVVYLAVAVDQFRKGDTGMAIAWFGYALANVGLAMVAK |
| Ga0119944_10326542 | 3300029930 | Aquatic | MSAPLILGVGVVYLVVALDQYRQGATGMAIAWFGYALANVGLAMVAK |
| Ga0119945_10156192 | 3300029933 | Aquatic | MSTPLILIVGVVYLAVAVDQFRKGDSGMAIAWFGYALANVGLAMVAK |
| Ga0315909_100762432 | 3300031857 | Freshwater | MSAPLILAVGVVYLVVAVDQYRQGSPGMAIAWFGYALANVGLAMAAK |
| Ga0315904_113060972 | 3300031951 | Freshwater | MSAPLILGVGVVYLVVALDQYRQGSPGMALAWFGYALANVGLAMVAK |
| Ga0315905_114134861 | 3300032092 | Freshwater | ILGVGAVYLFVALDQYRQGSPGMAIAWFGYALANVGLSMVAK |
| Ga0334977_0000318_7258_7401 | 3300033978 | Freshwater | MSSTLILCVGFVYLMVGIDQWSKGSPGMAIAWFGYALANVGLAMNAK |
| Ga0334982_0252584_1_105 | 3300033981 | Freshwater | MSAPLILAVGGVYLIVSLDQYRQGCPGMAIAWFGY |
| Ga0334982_0393208_184_327 | 3300033981 | Freshwater | MSAPLILIVGVVYLVVAVDQFRQGSPGMAIAWFGYALANVGLAMAAK |
| Ga0334994_0048059_886_1029 | 3300033993 | Freshwater | MSSTLILCVGFVYLMVAVDQWAKGSPGMAIAWFGYALANVGLAMNAR |
| Ga0334994_0134946_527_670 | 3300033993 | Freshwater | VSAPLILAVGGVYLIVSLDQYRQGSPGMAIAWLGYALANVGLAMVAK |
| Ga0334986_0154930_1124_1267 | 3300034012 | Freshwater | MSAPLILGVGVVYIVVAYDQWSKGQAGMAIAWAGYGLANIGLAMAAK |
| Ga0334986_0249440_209_370 | 3300034012 | Freshwater | MQEYVAVSAPLILAVGVVYLVVAFDQYRQGSPGMAIAWFGYALANVGLSMVAK |
| Ga0334987_0004637_3646_3786 | 3300034061 | Freshwater | MSAPLILAVGAVYLYVACEQAAKGSPMAIAWFGYALANVGLALAAK |
| Ga0334995_0075292_833_976 | 3300034062 | Freshwater | MSSPLILAVGVVYLIVAVDQLRKGSPGMAIAWFGYALSNVGLAMAAR |
| Ga0334995_0610303_375_518 | 3300034062 | Freshwater | MSAPLILGVGVVYLIVALDQYRQGHMGMALAWLGYALANVGLAMAAR |
| Ga0335028_0474769_121_264 | 3300034071 | Freshwater | MSAPLILAVGAVYVYVAFEQAMRGNTGMAIAWAGYAIANVGLAMAAK |
| Ga0310127_005068_7904_8047 | 3300034072 | Fracking Water | MSAPLILGVGVVYLVVALDQYRQGSTGMAIAWAGYAIANIGLAMAAK |
| Ga0310130_0011494_1829_1972 | 3300034073 | Fracking Water | MSAPLILGVGVVYLAVACDQWSKGSTGMAIAWAGYAIANIGLAMAAK |
| Ga0335010_0492571_1_126 | 3300034092 | Freshwater | MSSTLILCVGFVYLMVAVDQWAKGSPGMAIAWFGYALANVGL |
| Ga0335027_0054672_699_842 | 3300034101 | Freshwater | MSAPLILCVGVVYLVVALDQYRQGSTGMAIAWAGYAIANIGLAMAAK |
| Ga0335027_0817120_48_191 | 3300034101 | Freshwater | MSSPLILAVGVVYLVVAVDQYRQGATGMAIAWFGYALANVGLAMAAR |
| Ga0335030_0174313_30_173 | 3300034103 | Freshwater | MSAPLILAVGGVYLIVSLDQYRQGSPGMAIAWFGYALANVGLAMVAK |
| Ga0335036_0023446_1505_1648 | 3300034106 | Freshwater | MSSPLILAVGAVYLVVAVDQARKGEAGMAIAWFGYAVANVGLAMSAR |
| Ga0335063_0526022_2_127 | 3300034111 | Freshwater | LAVGGVYLIVSLDQYRQGSPGMAIAWLGYALANVGLAMVAK |
| Ga0335053_0475105_2_130 | 3300034118 | Freshwater | MITFVGFVYLAVALDQWSKGSPMAIAWAGYALANVGLALAAK |
| Ga0335039_0084663_1494_1637 | 3300034355 | Freshwater | MSSGLILAVGVVYLVVAVDQYRQGAPGMAIAWFGYALANVGLAMAAK |
| ⦗Top⦘ |