


| Basic Information | |
|---|---|
| Family ID | F074798 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASRKVVEAVRARLSR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.61 % |
| % of genes near scaffold ends (potentially truncated) | 36.97 % |
| % of genes from short scaffolds (< 2000 bps) | 79.83 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.378 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 12.16% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF03576 | Peptidase_S58 | 2.52 |
| PF01989 | AcnX_swivel_put | 2.52 |
| PF00472 | RF-1 | 1.68 |
| PF13379 | NMT1_2 | 1.68 |
| PF03551 | PadR | 1.68 |
| PF01738 | DLH | 1.68 |
| PF13620 | CarboxypepD_reg | 1.68 |
| PF03473 | MOSC | 1.68 |
| PF00144 | Beta-lactamase | 1.68 |
| PF07676 | PD40 | 1.68 |
| PF14534 | DUF4440 | 1.68 |
| PF12704 | MacB_PCD | 1.68 |
| PF02687 | FtsX | 1.68 |
| PF06197 | DUF998 | 1.68 |
| PF07721 | TPR_4 | 1.68 |
| PF04235 | DUF418 | 1.68 |
| PF13564 | DoxX_2 | 0.84 |
| PF00449 | Urease_alpha | 0.84 |
| PF00199 | Catalase | 0.84 |
| PF00583 | Acetyltransf_1 | 0.84 |
| PF11918 | Peptidase_S41_N | 0.84 |
| PF13485 | Peptidase_MA_2 | 0.84 |
| PF12441 | CopG_antitoxin | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| PF03572 | Peptidase_S41 | 0.84 |
| PF08837 | DUF1810 | 0.84 |
| PF01494 | FAD_binding_3 | 0.84 |
| PF01609 | DDE_Tnp_1 | 0.84 |
| PF04191 | PEMT | 0.84 |
| PF13420 | Acetyltransf_4 | 0.84 |
| PF04140 | ICMT | 0.84 |
| PF13614 | AAA_31 | 0.84 |
| PF01381 | HTH_3 | 0.84 |
| PF00701 | DHDPS | 0.84 |
| PF02517 | Rce1-like | 0.84 |
| PF02896 | PEP-utilizers_C | 0.84 |
| PF07606 | DUF1569 | 0.84 |
| PF13520 | AA_permease_2 | 0.84 |
| PF13649 | Methyltransf_25 | 0.84 |
| PF00753 | Lactamase_B | 0.84 |
| PF12697 | Abhydrolase_6 | 0.84 |
| PF02861 | Clp_N | 0.84 |
| PF08734 | GYD | 0.84 |
| PF10502 | Peptidase_S26 | 0.84 |
| PF07927 | HicA_toxin | 0.84 |
| PF06826 | Asp-Al_Ex | 0.84 |
| PF10604 | Polyketide_cyc2 | 0.84 |
| PF00782 | DSPc | 0.84 |
| PF09285 | Elong-fact-P_C | 0.84 |
| PF12833 | HTH_18 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 5.04 |
| COG1786 | Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway) | Lipid transport and metabolism [I] | 2.52 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.68 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.68 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.68 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.68 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.68 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.68 |
| COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 1.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.68 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.68 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.84 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.84 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.84 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG0804 | Urease alpha subunit | Amino acid transport and metabolism [E] | 0.84 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.84 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.84 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.84 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.84 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.84 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.84 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.84 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.84 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.39 % |
| Unclassified | root | N/A | 33.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10067307 | All Organisms → cellular organisms → Bacteria | 6437 | Open in IMG/M |
| 3300004019|Ga0055439_10260096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 567 | Open in IMG/M |
| 3300004114|Ga0062593_100589273 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300004114|Ga0062593_100894962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300004114|Ga0062593_101814375 | Not Available | 671 | Open in IMG/M |
| 3300004156|Ga0062589_100646538 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300004156|Ga0062589_101193242 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004157|Ga0062590_101032530 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300004463|Ga0063356_100544821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1550 | Open in IMG/M |
| 3300004463|Ga0063356_101092443 | Not Available | 1148 | Open in IMG/M |
| 3300004463|Ga0063356_103038985 | Not Available | 723 | Open in IMG/M |
| 3300004643|Ga0062591_100183431 | Not Available | 1512 | Open in IMG/M |
| 3300004643|Ga0062591_100184520 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300004643|Ga0062591_103002352 | Not Available | 501 | Open in IMG/M |
| 3300005294|Ga0065705_10265910 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005328|Ga0070676_11427022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300005332|Ga0066388_101714783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1112 | Open in IMG/M |
| 3300005334|Ga0068869_100129388 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300005340|Ga0070689_100079258 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2576 | Open in IMG/M |
| 3300005345|Ga0070692_10204833 | Not Available | 1158 | Open in IMG/M |
| 3300005354|Ga0070675_100273781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1482 | Open in IMG/M |
| 3300005406|Ga0070703_10044890 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300005444|Ga0070694_101064659 | Not Available | 673 | Open in IMG/M |
| 3300005471|Ga0070698_100409986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 1289 | Open in IMG/M |
| 3300005536|Ga0070697_102076596 | Not Available | 509 | Open in IMG/M |
| 3300005546|Ga0070696_101211991 | Not Available | 638 | Open in IMG/M |
| 3300005549|Ga0070704_100737973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
| 3300005566|Ga0066693_10139884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. KBS0703 | 903 | Open in IMG/M |
| 3300005719|Ga0068861_102101097 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005843|Ga0068860_102768117 | Not Available | 509 | Open in IMG/M |
| 3300006046|Ga0066652_100054724 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
| 3300006049|Ga0075417_10518679 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006640|Ga0075527_10107405 | Not Available | 774 | Open in IMG/M |
| 3300006845|Ga0075421_100448940 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300006845|Ga0075421_101168563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300006847|Ga0075431_102199203 | Not Available | 506 | Open in IMG/M |
| 3300006852|Ga0075433_10058167 | All Organisms → cellular organisms → Bacteria | 3381 | Open in IMG/M |
| 3300006852|Ga0075433_10104801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2505 | Open in IMG/M |
| 3300006852|Ga0075433_11272284 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006854|Ga0075425_100743988 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300006854|Ga0075425_101333532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 813 | Open in IMG/M |
| 3300006880|Ga0075429_100922358 | Not Available | 764 | Open in IMG/M |
| 3300006894|Ga0079215_10121030 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300006904|Ga0075424_100477790 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300007076|Ga0075435_100349472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1267 | Open in IMG/M |
| 3300007076|Ga0075435_100698561 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300009091|Ga0102851_13515306 | Not Available | 503 | Open in IMG/M |
| 3300009147|Ga0114129_12288176 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009177|Ga0105248_12995893 | Not Available | 538 | Open in IMG/M |
| 3300009609|Ga0105347_1002108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7994 | Open in IMG/M |
| 3300009840|Ga0126313_10893375 | Not Available | 725 | Open in IMG/M |
| 3300010045|Ga0126311_10593065 | Not Available | 876 | Open in IMG/M |
| 3300010166|Ga0126306_10597064 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300010293|Ga0116204_1295736 | Not Available | 503 | Open in IMG/M |
| 3300010373|Ga0134128_11823245 | Not Available | 669 | Open in IMG/M |
| 3300010375|Ga0105239_13278432 | Not Available | 527 | Open in IMG/M |
| 3300010399|Ga0134127_11314081 | Not Available | 792 | Open in IMG/M |
| 3300012163|Ga0137355_1046053 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012173|Ga0137327_1071295 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300012201|Ga0137365_10114858 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300012206|Ga0137380_10118135 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300012469|Ga0150984_100876618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SG8_38_2 | 737 | Open in IMG/M |
| 3300012532|Ga0137373_10290657 | Not Available | 1303 | Open in IMG/M |
| 3300012916|Ga0157310_10028927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300012951|Ga0164300_10225589 | Not Available | 935 | Open in IMG/M |
| 3300012961|Ga0164302_11059760 | Not Available | 637 | Open in IMG/M |
| 3300014300|Ga0075321_1035405 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300015371|Ga0132258_13001870 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300015374|Ga0132255_100877535 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1340 | Open in IMG/M |
| 3300018051|Ga0184620_10106350 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300018061|Ga0184619_10243656 | Not Available | 827 | Open in IMG/M |
| 3300018075|Ga0184632_10470491 | Not Available | 519 | Open in IMG/M |
| 3300019878|Ga0193715_1003669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 3331 | Open in IMG/M |
| 3300019879|Ga0193723_1014455 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300020003|Ga0193739_1088784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 784 | Open in IMG/M |
| 3300020068|Ga0184649_1484096 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300021090|Ga0210377_10086219 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300021344|Ga0193719_10015223 | All Organisms → cellular organisms → Bacteria | 3260 | Open in IMG/M |
| 3300021344|Ga0193719_10205349 | Not Available | 840 | Open in IMG/M |
| 3300025115|Ga0209835_1180377 | Not Available | 503 | Open in IMG/M |
| 3300025324|Ga0209640_10060036 | All Organisms → cellular organisms → Bacteria | 3296 | Open in IMG/M |
| 3300025899|Ga0207642_10051347 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300025908|Ga0207643_11112577 | Not Available | 509 | Open in IMG/M |
| 3300025918|Ga0207662_10386855 | Not Available | 946 | Open in IMG/M |
| 3300025923|Ga0207681_10311967 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300025927|Ga0207687_11703535 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025933|Ga0207706_10346421 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300026075|Ga0207708_10330685 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300026142|Ga0207698_11613226 | Not Available | 664 | Open in IMG/M |
| 3300027360|Ga0209969_1001865 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300027378|Ga0209981_1070881 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027513|Ga0208685_1009562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2386 | Open in IMG/M |
| 3300027636|Ga0214469_1162893 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300027682|Ga0209971_1033683 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300027717|Ga0209998_10009124 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10038176 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10043635 | Not Available | 1510 | Open in IMG/M |
| 3300027886|Ga0209486_10271739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300027909|Ga0209382_12184765 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028380|Ga0268265_10042388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3377 | Open in IMG/M |
| 3300028819|Ga0307296_10371670 | Not Available | 781 | Open in IMG/M |
| 3300028824|Ga0307310_10079112 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300030620|Ga0302046_10128611 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300031228|Ga0299914_10208663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1731 | Open in IMG/M |
| 3300031538|Ga0310888_10093717 | Not Available | 1513 | Open in IMG/M |
| 3300031562|Ga0310886_10212165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1063 | Open in IMG/M |
| 3300031716|Ga0310813_11365105 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031731|Ga0307405_11099287 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031824|Ga0307413_11829524 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031854|Ga0310904_10075415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1775 | Open in IMG/M |
| 3300031903|Ga0307407_10297419 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300031949|Ga0214473_11941683 | Not Available | 576 | Open in IMG/M |
| 3300032075|Ga0310890_10265824 | Not Available | 1216 | Open in IMG/M |
| 3300033407|Ga0214472_10012839 | All Organisms → cellular organisms → Bacteria | 8701 | Open in IMG/M |
| 3300033475|Ga0310811_10112300 | All Organisms → cellular organisms → Bacteria | 3508 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.20% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.68% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_100673077 | 3300000953 | Soil | MIHGKYGEFKILVDNEIVVDGGGLGFLGVLPSGREVLKV |
| Ga0055439_102600962 | 3300004019 | Natural And Restored Wetlands | MVHGRYGEYQVLVDGEVVIDGGMLAMLGVVPARQKVVDAVRT |
| Ga0062593_1005892733 | 3300004114 | Soil | MVHGHYAEYKVLVDGQIVADGGALTALGVVPSSNKIVEAVRAKLTGESSA* |
| Ga0062593_1008949622 | 3300004114 | Soil | MIHGDYAEYKVLVDGEVVIQGGALTALGIAPSGRKVLDAVRARLAEAR* |
| Ga0062593_1018143752 | 3300004114 | Soil | MVHGRYAEYQVLVDGECVADGGALAVLGIVPARKKVVEAIRAQLIRSDASSPPTTR* |
| Ga0062589_1006465382 | 3300004156 | Soil | LGIEPEMVHGRYGEYKVLVDGKVVIDGGPLTALGVVPASKKVVEAVRARLSR* |
| Ga0062589_1011932421 | 3300004156 | Soil | MVHGQYGEYKVLVDGETVIDGGALAALGIVPARRKVVEAVRAHLSR* |
| Ga0062590_1010325301 | 3300004157 | Soil | MVHGQYGEYKVLVDGETVIDGGALAALGIVPARRKVVEAVRAHLST* |
| Ga0063356_1005448212 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVHGRYGEFTVLVDGETVVDGGPLAVVGVLPSGPRVVAAVRARLSG* |
| Ga0063356_1010924431 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVRGRYGELKVLVDGETVVDGGTLAAFGVLPSGRKIVEVVRDRLSR* |
| Ga0063356_1030389852 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QHGRYGEYKVLVDGETVVDGGALAVLGAVPSGRKVVAAVRDRLSV* |
| Ga0062591_1001834311 | 3300004643 | Soil | MVHGRYAEYQVLVDGECVADGGALAVLGIVPARKKVVEAIRAQLIRSDATSQPTTR* |
| Ga0062591_1001845202 | 3300004643 | Soil | MVRGRYGEFLVLVDGETVVDGGALAALGVLPSGRKVLDAVRARLSG* |
| Ga0062591_1030023521 | 3300004643 | Soil | MVHGRYGEYKVLVDGKVVIDGGPLTALGVVPASKKVVEAVRARLSR* |
| Ga0065705_102659102 | 3300005294 | Switchgrass Rhizosphere | MIHGRYGEYQVLVDGEVAIDGGALATLGIVPARRKVVEIVRARLSKVSDG* |
| Ga0070676_114270221 | 3300005328 | Miscanthus Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASKKVVEAVRARLSR* |
| Ga0066388_1017147832 | 3300005332 | Tropical Forest Soil | MIHGGYGEFTVLVDGETVVDSGALAALGVLPSAAKVAKAVQ |
| Ga0068869_1001293882 | 3300005334 | Miscanthus Rhizosphere | MIRGKYGEFKILVDGETVIDAGALAVVGVLPSGRKIVEAVRARLGS* |
| Ga0070689_1000792582 | 3300005340 | Switchgrass Rhizosphere | MIPGRYAEYKVLVDGKVVIDGGALTALGVVPGSKKVVDTVRAHLK* |
| Ga0070692_102048332 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRGKYGEFKILVDGEAVIDAGALAVVGVLPSGRKIVEAVRARLGS* |
| Ga0070675_1002737812 | 3300005354 | Miscanthus Rhizosphere | MVPGHYAEYKVLVDGKVVIDGGALTALGVVPGSKKVVDTVRAHLK* |
| Ga0070703_100448902 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRGKYGEFKILVDGETVIDAGALAVVGVLPSGRKIVEAVRARLGR* |
| Ga0070694_1010646592 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VEMVRGHYGEYKVLVDGAIVVDGGKLAALGVLPSGRKVVEVVRASLARSAPG* |
| Ga0070698_1004099862 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVPGGFGEFRVLVDGDPVIEGGAFAALGVLPSGRKVLEAVRARLASL* |
| Ga0070697_1020765961 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LVHGPYGQYKVLVDGEVVIDGGSLAFLGVLPSMPTIVETVRTRLAKN |
| Ga0070696_1012119911 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRGKYGEFKILVDGETMIDAGALAVVGVLPSGRKIVEAVRARLGS* |
| Ga0070704_1007379732 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | STEVDLVHGPYGQYKVLVDGEVIIDGGSLAFLGVLPSMPTIVETVRTRLAKNG* |
| Ga0066693_101398842 | 3300005566 | Soil | LAIDVEMVHGRYGEYKVLVDGQTVIDGGPLTALGVVPASRKVVEAVRAHIAR* |
| Ga0068861_1021010971 | 3300005719 | Switchgrass Rhizosphere | RDLGIEPEMVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASKKVVDAVRARLAR* |
| Ga0068860_1027681171 | 3300005843 | Switchgrass Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASRKVVDAVRARLSR* |
| Ga0066652_1000547243 | 3300006046 | Soil | MQHGSYAEYKVLVDGQTVINGGALTALGIVPARRKVVEVVRAHLSPR* |
| Ga0075417_105186791 | 3300006049 | Populus Rhizosphere | MIHGGYGEFTVLVDGETVVDGGAFAALGVLPSGAKVVKAVK |
| Ga0075527_101074051 | 3300006640 | Arctic Peat Soil | RYGEYKVLVDGEIVVDGGALAVLGVLPSGRKSVSAVRDRLSRS* |
| Ga0075421_1004489403 | 3300006845 | Populus Rhizosphere | MIHGGYGEFTVLVDGETVVDGGAFAALGVLPSGAKVVKAVKGRLSGTSQVRPS* |
| Ga0075421_1011685632 | 3300006845 | Populus Rhizosphere | MVKGRYGEFQVLVDGEVVVDGGALAALGVLPSGRNVVAVVRTKLSG* |
| Ga0075431_1021992031 | 3300006847 | Populus Rhizosphere | MIHGGYGEFTVLVDGETVVDGGAFAALGVLPSGAKVVKAVKGRLSGTSRPS* |
| Ga0075433_100581671 | 3300006852 | Populus Rhizosphere | MVHGGYGEFTVLVDGETAVDGGALAALGVLPSGATVVKTVKERLAAREDRLL* |
| Ga0075433_101048013 | 3300006852 | Populus Rhizosphere | MVHGPYGQFHVLVDGETLIDGGALAALGVLPSARKIVDAVRQRLAA* |
| Ga0075433_112722842 | 3300006852 | Populus Rhizosphere | MVHGRYGEYKIEVDGETVVDGGALAVLGIASSGRKAVEAVRARLTKP* |
| Ga0075425_1007439881 | 3300006854 | Populus Rhizosphere | MVHGRYGEYKIEVDGETVVDGGALAVLGIASSGRKAVEAV |
| Ga0075425_1013335322 | 3300006854 | Populus Rhizosphere | MVRGGYGEFTVLVDGETVVDGGALAALGVLPSGAKVVKAVKERLSSGTGPSAS* |
| Ga0075429_1009223582 | 3300006880 | Populus Rhizosphere | MVHGPYGQFHVLVEGELVIDGGPLAALGVLPSSRKVVEVVRARLAAA* |
| Ga0079215_101210303 | 3300006894 | Agricultural Soil | YKVLVDDETVIDGGALTALGVVPGDNKVIAAVRDRLSRA* |
| Ga0075424_1004777903 | 3300006904 | Populus Rhizosphere | MVHGPYGQFHILVDGETLIDGGALAALGVLPSARKIVDAVRQRLAA* |
| Ga0075435_1003494722 | 3300007076 | Populus Rhizosphere | MVHGGYGEFTVLVDGETAVDGGALAALGVLPSGATVVKTVKERLGAREDRLL* |
| Ga0075435_1006985611 | 3300007076 | Populus Rhizosphere | MVHGRYGEYKIEVDGETVVDGGALAVLGIASSGRKAVEAVRARL |
| Ga0102851_135153061 | 3300009091 | Freshwater Wetlands | GQFKVLVDGQTAIDAGGWAALGILPSGRKVVDAVREKLSP* |
| Ga0114129_122881762 | 3300009147 | Populus Rhizosphere | MVHGRYGEYKVLVDGETVVDGGALAALGIVPSSGKIVNAVRDRLSA |
| Ga0105248_129958932 | 3300009177 | Switchgrass Rhizosphere | MVHGRYGEYKVLVDGELVIAGGPLTALGVVPASKKVVEAVRARLSR* |
| Ga0105347_10021085 | 3300009609 | Soil | MVKGRYGEFQVLVDGEPVVDAGPLAALGVLPSGRKVIAAVRAKLG* |
| Ga0126313_108933752 | 3300009840 | Serpentine Soil | VRGRYGELKVLVDGETVVDGGTLAALGVLPSARKIVQAVRDRLSR* |
| Ga0126311_105930652 | 3300010045 | Serpentine Soil | MEHGSYGEYKVLVDGQTVIDGGALTALGIVPARRKVVEVVRTYLSPR* |
| Ga0126306_105970642 | 3300010166 | Serpentine Soil | DVDMVRGRYGELKVLVDGETVVDGGTLAAFGVLSSGRKIVEVVRDRLSR* |
| Ga0116204_12957361 | 3300010293 | Anoxic Lake Water | LVHGRYGEYKVLVDGKVAVDGGAGVILGIVPSAGAVVAAVRERLRK* |
| Ga0134128_118232451 | 3300010373 | Terrestrial Soil | SYGEYKVLVDGQTVIDGGALAALGIVPARRKVVETVRASLLP* |
| Ga0105239_132784322 | 3300010375 | Corn Rhizosphere | YGEYKVLVDGEVVVNGGALAALGVLPSAHKTVKVVRDRLSRLAG* |
| Ga0134127_113140812 | 3300010399 | Terrestrial Soil | MIRGGYGEFTVLVDGETVVDGGALAALGVLPSGAKVVKAVKERLSGSRANN* |
| Ga0137355_10460532 | 3300012163 | Soil | VRGPYGQFKVLVDGETTVDGGALAALGVLPSGRKVVEAVRTRLSAERS* |
| Ga0137327_10712953 | 3300012173 | Soil | GIEVEMEHGSYGEYKVLVDGQTVVDGGALTALGVVPARRKVVETVRAHLSA* |
| Ga0137365_101148582 | 3300012201 | Vadose Zone Soil | MVHGRYGEYKVLVDGQTVIDGGALTTLGVVPARRKIVEAVRAHLSP* |
| Ga0137380_101181351 | 3300012206 | Vadose Zone Soil | MLKGKYGEFRVLVDGQTVVDGGALAALGVLPSARKVVEAVRARLGSSTRDSSS* |
| Ga0150984_1008766182 | 3300012469 | Avena Fatua Rhizosphere | VELVQGHYGEYTVLVDDHTVIDGGPLTALGVVPASQKVVDAVREAIAK* |
| Ga0137373_102906571 | 3300012532 | Vadose Zone Soil | MVPGRYGQFLVQVDGQTVVDAGAWAVLGLLPSGRKVVEAVKARLP* |
| Ga0157310_100289272 | 3300012916 | Soil | MIKGRYGEFRVLVDGQTVVDGGALAALGVLPSARRVVDAVKAKLD* |
| Ga0164300_102255892 | 3300012951 | Soil | MVHGHYAEYKVLVDGQIVADGGALTALGVVPSSNKIVEAVRARLKSEPSA* |
| Ga0164302_110597602 | 3300012961 | Soil | MIEGRHGEFKVLVDGETVVDAGALAALGVLPSGRKVVDAVKAKLG* |
| Ga0075321_10354051 | 3300014300 | Natural And Restored Wetlands | MVRGRYGEYKVLVDGATVVDGGKLAALGVLPSGRKVIEA |
| Ga0132258_130018702 | 3300015371 | Arabidopsis Rhizosphere | MVHGRYGEYKVLVDGETVVDGGALAALGIVPSGHKVLSAVRDRLSK* |
| Ga0132256_1016210512 | 3300015372 | Arabidopsis Rhizosphere | MVRGGYGEFKVLVDGTPVIDGGALAALGVLPSARRIIR |
| Ga0132255_1008775351 | 3300015374 | Arabidopsis Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGGVPASKKVVEAVRARLSR* |
| Ga0184620_101063501 | 3300018051 | Groundwater Sediment | LGIDVEMVHGRYGEYKILVDGQTVIDGGALTALGVVPTGRKVVEAVRAHLSPE |
| Ga0184619_102436563 | 3300018061 | Groundwater Sediment | EYRILVDGQTVIDGGALTVLGIVPARRTAVEAVRAHLSRDSGANAV |
| Ga0184632_104704912 | 3300018075 | Groundwater Sediment | VEMVHGRYGEYKILVDGETAIDGGALTALGIVPARRKVVEAVRARLSRGKG |
| Ga0193715_10036691 | 3300019878 | Soil | MVHGRYGEYRILVDGETVIDGGALTVLGIVPARRKAVEAVRAHLSRRPGPSSKDR |
| Ga0193723_10144551 | 3300019879 | Soil | MVRGRYGEFLVLVDGETVIDGGALAALGVLPSGRKVLDAVRARLSG |
| Ga0193739_10887842 | 3300020003 | Soil | MVRGGVGEFKVLVDGDTVIEGGIFAALGVLPSGRKIVDAVRARLAR |
| Ga0184649_14840961 | 3300020068 | Groundwater Sediment | VDLAHGPYGQFKVLVDGATIVDGGKWAALGVLPSGPEVVVAVRARLGTT |
| Ga0210377_100862191 | 3300021090 | Groundwater Sediment | LVGGPYGQFKVLVDGETAVDGGKWAALGVLPSGRTVVEAVRGKLGKP |
| Ga0193719_100152233 | 3300021344 | Soil | MEHGFYGEYKVLVDGQTVIDGGALTALGIVPARRRVVETVRAHLSP |
| Ga0193719_102053491 | 3300021344 | Soil | MVHGRYGEYRILVDGETVIDGGALTVLGIVPARRKAVEAVRAHLSRRP |
| Ga0209835_11803772 | 3300025115 | Anoxic Lake Water | LVHGRYGEYKVLVDGKVAVDGGAGVILGIVPSAGAVVAAVRERLRK |
| Ga0209640_100600363 | 3300025324 | Soil | MVRGGYGQFKVLVDGDTVVDGGALAALGVLPSYRKVLAAVQARYRGQPSNP |
| Ga0207642_100513472 | 3300025899 | Miscanthus Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASKKVVEAVRARLSR |
| Ga0207643_111125771 | 3300025908 | Miscanthus Rhizosphere | MIRGKYGEFKILVDGETVIDAGALAVVGVLPSGRKIVEAVR |
| Ga0207662_103868552 | 3300025918 | Switchgrass Rhizosphere | MVHGHYAEYKVLVDGQIVADGGALTALGVVPSSNKIVEAVRAKLTGESSA |
| Ga0207681_103119672 | 3300025923 | Switchgrass Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASRKVVEAVRARLSR |
| Ga0207687_117035352 | 3300025927 | Miscanthus Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASKKVVEAVR |
| Ga0207706_103464212 | 3300025933 | Corn Rhizosphere | MVHGRYGEYKVLVDGEVVIDGGPLTALGVVPASRKVVDAVRARLSR |
| Ga0207708_103306851 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MVHGRYGEYKVLVDGKVVIDGGPLTALGVVPASKKVVEAVRARLSR |
| Ga0207698_116132262 | 3300026142 | Corn Rhizosphere | RRDLGIEPEMVHGRYGEYKVLVDGKVVIDGGPLTALGVVPASRKVVDAVRARLSR |
| Ga0256867_100528112 | 3300026535 | Soil | MIHGRYGEYKILVDDDVVIDAGALSAIGIVPSDRKVVDAVRRRLA |
| Ga0209969_10018653 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MIHGRYGEYQVLVDGEVAIDGGALATLGIVPARRKVVEVVRARLSKVSGG |
| Ga0209981_10708812 | 3300027378 | Arabidopsis Thaliana Rhizosphere | MIHGRYGEYQVLVDGEVAIDGGALATLGIVPARRKVVEVVRARLSKVSDG |
| Ga0208685_10095623 | 3300027513 | Soil | RYGEFQVLVDGEPVVDAGPLAALGVLPSGRKVIAAVRAKLG |
| Ga0214469_11628932 | 3300027636 | Soil | LRTEVEMVRGRYGEFQVLVDGKTVVDGGALAALGVLPSGRKVLDAVRATLSG |
| Ga0209971_10336832 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MVHGRYGEYKVLVDGETVVDGGALAALGIVPSGHKVLSAVRDRLSK |
| Ga0207862_10058333 | 3300027703 | Tropical Forest Soil | MVRGRYGEFKILVDGQTVIDGGAAAFLGVLPSGRKVVAAVQAVMSS |
| Ga0209998_100091243 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MIHGRYGEHQVLVDGEVAIDGGALATLGIVPARRKVVEVVRARLSKVSGG |
| (restricted) Ga0233416_100381762 | 3300027799 | Sediment | MDVDMVRGRYAEFKVLVDGETVIDGGAMAFLGVLPSGRKVVDAVRERLSGR |
| (restricted) Ga0233416_100436352 | 3300027799 | Sediment | MVRGRYAEFKVLVDGQTVIDGGALAALGILPSGRKIVEAVRGRLSR |
| Ga0209486_102717391 | 3300027886 | Agricultural Soil | GRYGEYKILVDNVVVVDGGPLLALGVMPAARKTVAAVRTKLGL |
| Ga0209382_121847651 | 3300027909 | Populus Rhizosphere | MIHGGYGEFTVLVDGETVVDGGAFAALGVLPSGAKVVKAVKGRLSGTSQVRPS |
| Ga0268265_100423882 | 3300028380 | Switchgrass Rhizosphere | MIRGKYGEFKILVDGETVIDAGALAVVGVLPSGRKIVEAVRARLGS |
| Ga0307296_103716703 | 3300028819 | Soil | VEMVHGRYGEYTILVDGQTVIDGGALTALGVVPTGRKVVEAVRAHLSPE |
| Ga0307310_100791124 | 3300028824 | Soil | IDVEMVHGRYGEYTILVDGQTVIDGGALTALGVVPTGRKVVEAVRAHLSPE |
| Ga0302046_101286114 | 3300030620 | Soil | LVGGPYGQFKVLVDGETAVDGGRWAALGVLPSGRTVVEAVRGKLGKP |
| Ga0299914_102086632 | 3300031228 | Soil | MVRGRYGEFQVLVDGKTVVDGGALAALGVLPSGRKVLAAVRATLSG |
| Ga0310888_100937172 | 3300031538 | Soil | MVHGRYAEYQVLVDGQTVIDGGALTALGIVPARRKVVEAIRARLQS |
| Ga0310886_102121651 | 3300031562 | Soil | MIRGRYGQFKVLMDGETVVDGGALAALGVLPSSRKVVDTVRAKNSQ |
| Ga0310813_113651051 | 3300031716 | Soil | MVHGRYGEYKIEVDGATVVDGGALAVLGIASSGRKAVEAVRARL |
| Ga0307405_110992872 | 3300031731 | Rhizosphere | MIHGRYAEYQVLVDGETVIDGGALTALGVVPARRKVVEAIRARLEKNDKART |
| Ga0307413_118295241 | 3300031824 | Rhizosphere | MVRGRYGQFKVLVDGEPVIDAGALAALGVLPSAGRVIEAVRDRLAG |
| Ga0310904_100754152 | 3300031854 | Soil | MIRGRYGQFKVLMDGETVVDGGALAALGVLPSSRKVVDTVRAKNSQEKRDAPN |
| Ga0307407_102974193 | 3300031903 | Rhizosphere | DVDMVRGRYGQFKVLVDGEPVIDAGALAALGVLPSAGRVIEAVRDRLAG |
| Ga0308174_113187622 | 3300031939 | Soil | MVHGQYGEYKVLVDGETVIDGGALAALGIVPARRKV |
| Ga0214473_119416831 | 3300031949 | Soil | EYKVLVDGEIVVDGGALAILGLLPSARKTVSAVRDRISR |
| Ga0310890_102658242 | 3300032075 | Soil | VEFSRPPGLVDGQTVVDAGALAALGVLPSGRKVVDTVKAQLG |
| Ga0214472_100128391 | 3300033407 | Soil | LVGGPYGQFKVLVDGETAVDGGRWAALGVLPSGRTVV |
| Ga0310811_101123003 | 3300033475 | Soil | MVHGRYGEYQVLVDGQTVIDGGALAALGIVPARTKVVEAVRFHLAQ |
| ⦗Top⦘ |