


| Basic Information | |
|---|---|
| Family ID | F074773 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKNEKKD |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 81.51 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified bacterial viruses (53.782 % of family members) |
| NCBI Taxonomy ID | 12333 |
| Taxonomy | All Organisms → Viruses → unclassified bacterial viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (21.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.655 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (46.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.59 % |
| Unclassified | root | N/A | 29.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10248089 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 761 | Open in IMG/M |
| 3300002482|JGI25127J35165_1009544 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 2482 | Open in IMG/M |
| 3300002835|B570J40625_100709271 | Not Available | 899 | Open in IMG/M |
| 3300005940|Ga0073913_10047889 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 675 | Open in IMG/M |
| 3300006734|Ga0098073_1006120 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2378 | Open in IMG/M |
| 3300006734|Ga0098073_1034107 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 708 | Open in IMG/M |
| 3300006802|Ga0070749_10480835 | Not Available | 678 | Open in IMG/M |
| 3300006802|Ga0070749_10594101 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 597 | Open in IMG/M |
| 3300006875|Ga0075473_10401191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 554 | Open in IMG/M |
| 3300007214|Ga0103959_1279643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1859 | Open in IMG/M |
| 3300007345|Ga0070752_1222559 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 744 | Open in IMG/M |
| 3300007538|Ga0099851_1057002 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1528 | Open in IMG/M |
| 3300007538|Ga0099851_1064046 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1431 | Open in IMG/M |
| 3300007539|Ga0099849_1357939 | Not Available | 518 | Open in IMG/M |
| 3300007540|Ga0099847_1242437 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 519 | Open in IMG/M |
| 3300007541|Ga0099848_1227845 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 659 | Open in IMG/M |
| 3300007541|Ga0099848_1318540 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 531 | Open in IMG/M |
| 3300007542|Ga0099846_1066439 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1351 | Open in IMG/M |
| 3300007542|Ga0099846_1169590 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 780 | Open in IMG/M |
| 3300007542|Ga0099846_1277461 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 577 | Open in IMG/M |
| 3300007960|Ga0099850_1222745 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 735 | Open in IMG/M |
| 3300007974|Ga0105747_1138825 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 780 | Open in IMG/M |
| 3300007992|Ga0105748_10183024 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 867 | Open in IMG/M |
| 3300009009|Ga0105105_10144310 | Not Available | 1193 | Open in IMG/M |
| 3300009085|Ga0105103_10786634 | Not Available | 552 | Open in IMG/M |
| 3300009466|Ga0126448_1031037 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1259 | Open in IMG/M |
| 3300009703|Ga0114933_10195902 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1371 | Open in IMG/M |
| 3300010299|Ga0129342_1026990 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2325 | Open in IMG/M |
| 3300010299|Ga0129342_1195665 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 720 | Open in IMG/M |
| 3300010300|Ga0129351_1015550 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 3162 | Open in IMG/M |
| 3300010300|Ga0129351_1084367 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1282 | Open in IMG/M |
| 3300010300|Ga0129351_1375164 | Not Available | 532 | Open in IMG/M |
| 3300010318|Ga0136656_1025085 | Not Available | 2166 | Open in IMG/M |
| 3300010318|Ga0136656_1133433 | Not Available | 856 | Open in IMG/M |
| 3300010354|Ga0129333_11148502 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 647 | Open in IMG/M |
| 3300010368|Ga0129324_10090657 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1330 | Open in IMG/M |
| 3300010370|Ga0129336_10193986 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1158 | Open in IMG/M |
| 3300010389|Ga0136549_10030751 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3017 | Open in IMG/M |
| 3300010389|Ga0136549_10031915 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2941 | Open in IMG/M |
| 3300010389|Ga0136549_10031916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2941 | Open in IMG/M |
| 3300010389|Ga0136549_10137959 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1108 | Open in IMG/M |
| 3300010389|Ga0136549_10251209 | Not Available | 750 | Open in IMG/M |
| 3300011984|Ga0119931_1047701 | Not Available | 521 | Open in IMG/M |
| 3300012920|Ga0160423_11110792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 528 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10977596 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 512 | Open in IMG/M |
| 3300013372|Ga0177922_10794016 | Not Available | 540 | Open in IMG/M |
| 3300015050|Ga0181338_1022012 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 995 | Open in IMG/M |
| 3300015050|Ga0181338_1038257 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 718 | Open in IMG/M |
| 3300017736|Ga0181365_1127045 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 610 | Open in IMG/M |
| 3300017747|Ga0181352_1021509 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1994 | Open in IMG/M |
| 3300017774|Ga0181358_1282095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 512 | Open in IMG/M |
| 3300017778|Ga0181349_1099934 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1087 | Open in IMG/M |
| 3300017778|Ga0181349_1287133 | Not Available | 537 | Open in IMG/M |
| 3300017956|Ga0181580_10667530 | Not Available | 664 | Open in IMG/M |
| 3300020056|Ga0181574_10486757 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 696 | Open in IMG/M |
| 3300020074|Ga0194113_10706941 | Not Available | 699 | Open in IMG/M |
| 3300020161|Ga0211726_10607836 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 928 | Open in IMG/M |
| 3300020179|Ga0194134_10035475 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2952 | Open in IMG/M |
| 3300020183|Ga0194115_10229360 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 893 | Open in IMG/M |
| 3300020193|Ga0194131_10041532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3367 | Open in IMG/M |
| 3300020196|Ga0194124_10489487 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 540 | Open in IMG/M |
| 3300020380|Ga0211498_10409849 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 507 | Open in IMG/M |
| 3300020394|Ga0211497_10020812 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 3282 | Open in IMG/M |
| 3300020395|Ga0211705_10075828 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1212 | Open in IMG/M |
| 3300020433|Ga0211565_10039435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 2008 | Open in IMG/M |
| 3300020553|Ga0208855_1013676 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1281 | Open in IMG/M |
| 3300021091|Ga0194133_10470367 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 664 | Open in IMG/M |
| 3300021962|Ga0222713_10809924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 522 | Open in IMG/M |
| 3300022190|Ga0181354_1130589 | Not Available | 800 | Open in IMG/M |
| 3300022190|Ga0181354_1156370 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 709 | Open in IMG/M |
| 3300022198|Ga0196905_1083006 | Not Available | 871 | Open in IMG/M |
| 3300022198|Ga0196905_1171495 | Not Available | 552 | Open in IMG/M |
| 3300022198|Ga0196905_1192251 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 514 | Open in IMG/M |
| 3300022200|Ga0196901_1075818 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1208 | Open in IMG/M |
| 3300022200|Ga0196901_1104444 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 985 | Open in IMG/M |
| 3300022407|Ga0181351_1195206 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 682 | Open in IMG/M |
| 3300024262|Ga0210003_1157970 | Not Available | 965 | Open in IMG/M |
| 3300024262|Ga0210003_1227799 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 748 | Open in IMG/M |
| 3300025093|Ga0208794_1021475 | Not Available | 1348 | Open in IMG/M |
| 3300025132|Ga0209232_1214437 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 579 | Open in IMG/M |
| 3300025647|Ga0208160_1097645 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 765 | Open in IMG/M |
| 3300025647|Ga0208160_1111801 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 697 | Open in IMG/M |
| 3300025687|Ga0208019_1010014 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 4085 | Open in IMG/M |
| 3300025687|Ga0208019_1062940 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1237 | Open in IMG/M |
| 3300025769|Ga0208767_1046741 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2058 | Open in IMG/M |
| 3300025769|Ga0208767_1259997 | Not Available | 535 | Open in IMG/M |
| 3300025889|Ga0208644_1052059 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2262 | Open in IMG/M |
| 3300027693|Ga0209704_1175289 | Not Available | 624 | Open in IMG/M |
| 3300027732|Ga0209442_1167623 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 834 | Open in IMG/M |
| 3300027762|Ga0209288_10206289 | Not Available | 643 | Open in IMG/M |
| 3300027763|Ga0209088_10221958 | Not Available | 798 | Open in IMG/M |
| 3300027785|Ga0209246_10390160 | Not Available | 524 | Open in IMG/M |
| 3300027798|Ga0209353_10043370 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2073 | Open in IMG/M |
| 3300027900|Ga0209253_10980086 | Not Available | 586 | Open in IMG/M |
| 3300027917|Ga0209536_101783907 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 742 | Open in IMG/M |
| 3300028025|Ga0247723_1100181 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 732 | Open in IMG/M |
| 3300029306|Ga0135212_1007502 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 885 | Open in IMG/M |
| 3300031539|Ga0307380_10500485 | Not Available | 1068 | Open in IMG/M |
| 3300031673|Ga0307377_10539514 | Not Available | 843 | Open in IMG/M |
| 3300031772|Ga0315288_11316448 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 612 | Open in IMG/M |
| 3300031885|Ga0315285_10435877 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 923 | Open in IMG/M |
| 3300031963|Ga0315901_10967477 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 598 | Open in IMG/M |
| 3300031997|Ga0315278_11237137 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 731 | Open in IMG/M |
| 3300032046|Ga0315289_10118090 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3068 | Open in IMG/M |
| 3300032050|Ga0315906_11176019 | Not Available | 559 | Open in IMG/M |
| 3300032053|Ga0315284_10175723 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2793 | Open in IMG/M |
| 3300032093|Ga0315902_10559822 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 974 | Open in IMG/M |
| 3300032093|Ga0315902_11328312 | Not Available | 504 | Open in IMG/M |
| 3300032118|Ga0315277_10605211 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1075 | Open in IMG/M |
| 3300032156|Ga0315295_11190741 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 747 | Open in IMG/M |
| 3300032516|Ga0315273_10703098 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1328 | Open in IMG/M |
| 3300033994|Ga0334996_0553066 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 504 | Open in IMG/M |
| 3300034061|Ga0334987_0227979 | Not Available | 1287 | Open in IMG/M |
| 3300034063|Ga0335000_0807401 | Not Available | 504 | Open in IMG/M |
| 3300034101|Ga0335027_0460699 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 807 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.40% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.20% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 4.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.36% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.36% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.84% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.84% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.84% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.84% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.84% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.84% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.84% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.84% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025093 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_102480891 | 3300000882 | Freshwater And Marine | QLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA* |
| JGI25127J35165_10095444 | 3300002482 | Marine | QLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK* |
| B570J40625_1007092711 | 3300002835 | Freshwater | AQLQANVLSNPDKYDEKTVKQARLRQTLVGLKKNKDSKKES* |
| Ga0073913_100478891 | 3300005940 | Sand | GITTAQLQENVLSAPEKYDAETVKQARLRQTLVGLKKKKDEKKTET* |
| Ga0098073_10061205 | 3300006734 | Marine | ITSAQLQANVLANPDKYDEKTVKQARLRQTLVGLKKKKDSKKAES* |
| Ga0098073_10341071 | 3300006734 | Marine | GITSAQLQENVLSNPDEYDEKTVKQARLRQTLVGLHKKKKNKE* |
| Ga0070749_104808351 | 3300006802 | Aqueous | QLQENVLSNPDKYDDKTVKQARLRKTLVGLKQKKKSKTNG* |
| Ga0070749_105941012 | 3300006802 | Aqueous | GISPAQLQANVLSNPKKYDEKTVKQANLRRTLVGLNKKKKAK* |
| Ga0075473_104011912 | 3300006875 | Aqueous | SPAQLQANVLSNPKKYDEKTVKQANLRRTLVGLNKKKKAK* |
| Ga0103959_12796431 | 3300007214 | Freshwater Lake | VLSNPDNYDEKTVKQARLRQTLVGLHKKKKESKS* |
| Ga0070752_12225591 | 3300007345 | Aqueous | AKKKGITTAQLQENVLANPDKYDEKTVKQANLRKTLVGLHKKKKEKKAD* |
| Ga0099851_10570024 | 3300007538 | Aqueous | TSAQLQENVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKKSEE* |
| Ga0099851_10640461 | 3300007538 | Aqueous | ENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE* |
| Ga0099849_13579391 | 3300007539 | Aqueous | KKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKDSKKTEE* |
| Ga0099847_12424371 | 3300007540 | Aqueous | KKGITTAQLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE* |
| Ga0099848_12278451 | 3300007541 | Aqueous | VLANPEKYDEKTVKQANLRKTLVGLKKKKKEKQG* |
| Ga0099848_13185401 | 3300007541 | Aqueous | QENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK* |
| Ga0099846_10664391 | 3300007542 | Aqueous | RKGITTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG* |
| Ga0099846_11695901 | 3300007542 | Aqueous | LQENVLANPEKYDEKTVKQARLRQTLVGLNKKKKEKKTEG* |
| Ga0099846_12774611 | 3300007542 | Aqueous | GITTAQLQENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK* |
| Ga0099850_12227452 | 3300007960 | Aqueous | VLANPDKYDEKTVKQANLRKTLVGLHKKKKEKKAD* |
| Ga0105747_11388252 | 3300007974 | Estuary Water | AQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKSEKKG* |
| Ga0105747_13401232 | 3300007974 | Estuary Water | VLAEPDKYDEKTIKQATLRKTLVQLNKNKKEKVTDG* |
| Ga0105748_101830241 | 3300007992 | Estuary Water | NVLSDPDKYDDTTVKQANLRKTLVGLHQKKKADKAED* |
| Ga0105105_101443101 | 3300009009 | Freshwater Sediment | AQLQANVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKES* |
| Ga0105103_107866341 | 3300009085 | Freshwater Sediment | TAQLQENVLSNPDDYDDKTVKQARLRQTLVGLKKKKDKK* |
| Ga0126448_10310371 | 3300009466 | Meromictic Pond | LQENVLSNPDEYDEKTVKQARLRKTLVGLKKRKDKK* |
| Ga0114933_101959021 | 3300009703 | Deep Subsurface | NVLADPDKYDEKTVKQARLRKTLVGLNKKKKAKEE* |
| Ga0129342_10269901 | 3300010299 | Freshwater To Marine Saline Gradient | KKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKYSKKAEE* |
| Ga0129342_11956651 | 3300010299 | Freshwater To Marine Saline Gradient | LQENVLSNPDDYDEKTVKQARLRKTLVGLKKRKDKK* |
| Ga0129351_10155501 | 3300010300 | Freshwater To Marine Saline Gradient | NPEKYDDKTVKQANLRKTLVGLHKDKKSKANKKD* |
| Ga0129351_10843673 | 3300010300 | Freshwater To Marine Saline Gradient | GITSAQLQENVLADPEKYDERTVKQARLRKTLVGLHGKKKSKK* |
| Ga0129351_13751642 | 3300010300 | Freshwater To Marine Saline Gradient | KKRGITSAQLQANVLANPEKYDDKTVKQANLRKTLVGLHKDKKSKANKKD* |
| Ga0136656_10250851 | 3300010318 | Freshwater To Marine Saline Gradient | ITSAQLQKNVLSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAEN* |
| Ga0136656_11334331 | 3300010318 | Freshwater To Marine Saline Gradient | LQANVLANPDKYDEKTVKQARLRKTLVGLKKKKGSKED* |
| Ga0129333_111485022 | 3300010354 | Freshwater To Marine Saline Gradient | NVLANPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG* |
| Ga0129324_100906573 | 3300010368 | Freshwater To Marine Saline Gradient | QENVLANPEKYDEKTVKQANLRKTLVGLHKKKKSNKAD* |
| Ga0129336_101939861 | 3300010370 | Freshwater To Marine Saline Gradient | LQENVLSNPDEYDEKTVKQARLRKTLVGLRKRKDKE* |
| Ga0136549_100307511 | 3300010389 | Marine Methane Seep Sediment | VLANPDKYDEKTVKQARLRKTLVGLKKKKDSKKTEE* |
| Ga0136549_100319151 | 3300010389 | Marine Methane Seep Sediment | KRKGITSAQLQENVLADPDKYDEKTVKQARLRQTLVGLHKKKKQKQTES* |
| Ga0136549_100319161 | 3300010389 | Marine Methane Seep Sediment | KRKGITSAQLQENVLADPDKYDEKTVKQARLRQTLVGLHKKKKQKQTED* |
| Ga0136549_101379593 | 3300010389 | Marine Methane Seep Sediment | QENVLSNPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG* |
| Ga0136549_102512092 | 3300010389 | Marine Methane Seep Sediment | NPEKYDDKTVKQANLRKTLVGLNKDKKSKAKNKD* |
| Ga0139557_10604101 | 3300011010 | Freshwater | LAEPDKYDEKTIKQATLRKTLVQLNKNKKEKVTDG* |
| Ga0119931_10477011 | 3300011984 | Drinking Water Treatment Plant | GITTAQLQENVLSNPDDYDEKTVKQARLRQTLVGLKKKKDKK* |
| Ga0160423_111107921 | 3300012920 | Surface Seawater | TTAQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK* |
| (restricted) Ga0172372_109775962 | 3300013132 | Freshwater | VLSNPEKYDEKTVKQARLRQTLVGLKKKKKEKSEG* |
| Ga0177922_107940162 | 3300013372 | Freshwater | SKGITTAQLQENVLADPDKYDKSTVRQANLRKTLVSLKKKKYRKAEED* |
| Ga0181338_10220123 | 3300015050 | Freshwater Lake | LANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG* |
| Ga0181338_10382571 | 3300015050 | Freshwater Lake | QLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG* |
| Ga0181365_11270451 | 3300017736 | Freshwater Lake | GITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPEDXWRKTQGLT |
| Ga0181352_10215094 | 3300017747 | Freshwater Lake | ITSAQLQENVLSSPDEYDEKTVKQARLRQTLVGLKKKKKQRADT |
| Ga0181358_12820952 | 3300017774 | Freshwater Lake | LANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG |
| Ga0181349_10999341 | 3300017778 | Freshwater Lake | KGITTAQLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA |
| Ga0181349_12871331 | 3300017778 | Freshwater Lake | KKGITSAQLQENVLSAPDKYDDKTVKQANLRRTLVGLQKKKTKK |
| Ga0181580_106675301 | 3300017956 | Salt Marsh | NVLSNPDKYDDKTVKQARLRKTLVGLKQRKKAKENG |
| Ga0181575_102118733 | 3300020055 | Salt Marsh | LSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAED |
| Ga0181574_104867572 | 3300020056 | Salt Marsh | RRGITSAQLQKNVLSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAED |
| Ga0194113_107069411 | 3300020074 | Freshwater Lake | ITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKNKDNKQES |
| Ga0211726_106078361 | 3300020161 | Freshwater | QLQENVLSNPEKYDEKTVKQANLRKTLVGLHKKKKEKTEDXWLEIHAWN |
| Ga0194134_100354751 | 3300020179 | Freshwater Lake | KKGITSAQLQENVLSNPEKYDEKTVKQARLRKTLVGLKKKKNKNNG |
| Ga0194115_102293601 | 3300020183 | Freshwater Lake | TAQLQENVLSNPEKYDEKTVKQARLRQTLVGLHNKKKAKS |
| Ga0194131_100415326 | 3300020193 | Freshwater Lake | NVLANPDKYDEKTVKQARLRKTLVGLKKNKDNKQES |
| Ga0194124_104894872 | 3300020196 | Freshwater Lake | ENVLANPEKYDERTVKQANLRKTLVGLHNKKKNKE |
| Ga0211498_104098491 | 3300020380 | Marine | QLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK |
| Ga0211497_100208126 | 3300020394 | Marine | NVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK |
| Ga0211705_100758281 | 3300020395 | Marine | LQENVLSNPDDYDEKTVKQANLRKTLVRLQKNKKAKKEXKTIG |
| Ga0211565_100394351 | 3300020433 | Marine | AEKKGITTAQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK |
| Ga0208855_10136763 | 3300020553 | Freshwater | KKGITSAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG |
| Ga0194133_104703672 | 3300021091 | Freshwater Lake | KGITSAQLQENVLSNPEKYDEKTVKQARLRKTLVGLKKKKNKNNG |
| Ga0222713_108099241 | 3300021962 | Estuarine Water | AQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKNEKKD |
| Ga0181354_11305891 | 3300022190 | Freshwater Lake | TTAQLQENVLADPDKYDKSTVRQANLRKTLVSLKKKKYRKAEED |
| Ga0181354_11563701 | 3300022190 | Freshwater Lake | QLQENVLSNPDEYNAETIKQARLRQTLVGLKKKKDAKKTEG |
| Ga0196905_10830061 | 3300022198 | Aqueous | RKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKGSKED |
| Ga0196905_11714952 | 3300022198 | Aqueous | LQANVLANPDKYDEKTVKQARLRQTLVGLKKNKDSKKSED |
| Ga0196905_11922511 | 3300022198 | Aqueous | QLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKEKQG |
| Ga0196901_10758183 | 3300022200 | Aqueous | KRKGITTAQLQENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK |
| Ga0196901_11044443 | 3300022200 | Aqueous | LQENVLSNPDKYDEKTVKQARLRQTLVGLHKKKKESKK |
| Ga0181351_11952062 | 3300022407 | Freshwater Lake | ITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0210003_11579701 | 3300024262 | Deep Subsurface | SNVLGNPDKYDEKTVKQARLRQTLVGLHKKKKAKEENS |
| Ga0210003_12277992 | 3300024262 | Deep Subsurface | GITSSQLQENVLAEPAKYDDKTVKQARLRKTLVGLHNKKKDKE |
| Ga0208794_10214751 | 3300025093 | Marine | AKRKGITTAQLQANVEANPEKYDEKTQKQARLRKTLVGLNKKKKAKE |
| Ga0209232_12144372 | 3300025132 | Marine | AKKRGITSAQLQENVLANPDEYDEKTVKQANLRKTLVGLDKKKKAKK |
| Ga0208160_10976452 | 3300025647 | Aqueous | LQENVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKKSEE |
| Ga0208160_11118011 | 3300025647 | Aqueous | LQENVLANPEKYDEKTVKQARLRQTLVGLNKKKKEKKTEG |
| Ga0208019_10100146 | 3300025687 | Aqueous | SAQLQANVLADPDKYDEKTVKQANLRKTLVGIQKRKKEKKNEGSST |
| Ga0208019_10629403 | 3300025687 | Aqueous | SAQLQENVLSNPDKYDKKTVKQARLRQTLVGLHKKKKESKK |
| Ga0208767_10467414 | 3300025769 | Aqueous | ENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE |
| Ga0208767_12599971 | 3300025769 | Aqueous | AQLQENVLSNPDKYDDKTVKQARLRKTLVGLKQKKKSKTNG |
| Ga0208644_10520594 | 3300025889 | Aqueous | RKGITSAQLQENVLSNPDKYDEKTVKQARLRKTLVSLKKNKTNKPEE |
| Ga0209704_11752892 | 3300027693 | Freshwater Sediment | AQLQENVLANPDDYDKSTVKQANLRKTLVSLKKKKYRKAEED |
| Ga0209442_11676231 | 3300027732 | Freshwater Lake | NVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0209288_102062891 | 3300027762 | Freshwater Sediment | SAQLQANVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKES |
| Ga0209088_102219582 | 3300027763 | Freshwater Lake | TSAQLQENVLASPEKYDDKTVKQARLRETLVGLHKKKQGKK |
| Ga0209246_103901602 | 3300027785 | Freshwater Lake | QENVLSAPDKYDDKTIKQANLRKTLVGLQKKKTKK |
| Ga0209353_100433701 | 3300027798 | Freshwater Lake | LQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0209354_100873121 | 3300027808 | Freshwater Lake | SQLQENVLAEPDKYDEKTIKQANLRKTLVKLNNRKKEKAS |
| Ga0209253_109800862 | 3300027900 | Freshwater Lake Sediment | KGITTAQLQENVLSSPEKYDERTVKQARLRETLVGLHGKKKQKS |
| Ga0209536_1017839072 | 3300027917 | Marine Sediment | RGITTAQLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE |
| Ga0247723_11001812 | 3300028025 | Deep Subsurface Sediment | NVLSNPEKYDEKTVKQARLRQTLVGLKKKKKEKSEG |
| Ga0135212_10075021 | 3300029306 | Marine Harbor | LQENVLSNPDDYDEKTVRQARLRKTLVGLKKRRDDQPKKEKKDA |
| Ga0307380_105004853 | 3300031539 | Soil | LQENVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEEN |
| Ga0307377_105395141 | 3300031673 | Soil | LQENVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEED |
| Ga0315288_113164482 | 3300031772 | Sediment | AQLQENVLANPDEYNAETIKQARLRQTLVGLKKKKDAKKTEA |
| Ga0315285_104358771 | 3300031885 | Sediment | LANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA |
| Ga0315901_109674772 | 3300031963 | Freshwater | KGITSAQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKDSKKSEE |
| Ga0315278_112371371 | 3300031997 | Sediment | RKGITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0315289_101180901 | 3300032046 | Sediment | SQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0315906_111760191 | 3300032050 | Freshwater | TAQLQENVLSNPDDYDDKTVKQARLRQTLVGLKKKKDKK |
| Ga0315284_101757231 | 3300032053 | Sediment | ENVLSDPDKYDETTQKQANLRKTLVGLHHKKKAKKAED |
| Ga0315902_105598221 | 3300032093 | Freshwater | KKKGITTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLHGKKKKAKG |
| Ga0315902_113283122 | 3300032093 | Freshwater | KSKGITTAQLQENVLADPEKYDKSTVRQANLRKTLVSLKKKKYRKAEED |
| Ga0315277_106052113 | 3300032118 | Sediment | VLSDPDKYDETTQKQANLRKTLVGLHHKKKAKKAED |
| Ga0315295_111907412 | 3300032156 | Sediment | VLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0315273_107030981 | 3300032516 | Sediment | KGITTSQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED |
| Ga0334996_0553066_369_503 | 3300033994 | Freshwater | TTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG |
| Ga0334987_0227979_1172_1285 | 3300034061 | Freshwater | NVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEED |
| Ga0335000_0807401_380_502 | 3300034063 | Freshwater | QLQANVLSNPDKYDEKTVKQARLRQTLVGLKKNKDSKKES |
| Ga0335027_0460699_679_807 | 3300034101 | Freshwater | AQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG |
| ⦗Top⦘ |