


| Basic Information | |
|---|---|
| Family ID | F074678 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | DVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.20 % |
| % of genes near scaffold ends (potentially truncated) | 89.92 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.261 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 15.94% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 24.37 |
| PF05685 | Uma2 | 7.56 |
| PF04909 | Amidohydro_2 | 6.72 |
| PF00296 | Bac_luciferase | 5.88 |
| PF12838 | Fer4_7 | 5.04 |
| PF08241 | Methyltransf_11 | 4.20 |
| PF05013 | FGase | 3.36 |
| PF01850 | PIN | 2.52 |
| PF08281 | Sigma70_r4_2 | 1.68 |
| PF00903 | Glyoxalase | 1.68 |
| PF00578 | AhpC-TSA | 1.68 |
| PF00535 | Glycos_transf_2 | 1.68 |
| PF03328 | HpcH_HpaI | 1.68 |
| PF02604 | PhdYeFM_antitox | 0.84 |
| PF00501 | AMP-binding | 0.84 |
| PF12862 | ANAPC5 | 0.84 |
| PF00583 | Acetyltransf_1 | 0.84 |
| PF02775 | TPP_enzyme_C | 0.84 |
| PF01042 | Ribonuc_L-PSP | 0.84 |
| PF02739 | 5_3_exonuc_N | 0.84 |
| PF13701 | DDE_Tnp_1_4 | 0.84 |
| PF00561 | Abhydrolase_1 | 0.84 |
| PF02668 | TauD | 0.84 |
| PF00528 | BPD_transp_1 | 0.84 |
| PF00672 | HAMP | 0.84 |
| PF02225 | PA | 0.84 |
| PF12681 | Glyoxalase_2 | 0.84 |
| PF00529 | CusB_dom_1 | 0.84 |
| PF13649 | Methyltransf_25 | 0.84 |
| PF04073 | tRNA_edit | 0.84 |
| PF16694 | Cytochrome_P460 | 0.84 |
| PF01244 | Peptidase_M19 | 0.84 |
| PF12275 | DUF3616 | 0.84 |
| PF01855 | POR_N | 0.84 |
| PF13193 | AMP-binding_C | 0.84 |
| PF13490 | zf-HC2 | 0.84 |
| PF03061 | 4HBT | 0.84 |
| PF07885 | Ion_trans_2 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 7.56 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 5.88 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 3.36 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 3.36 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.68 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 1.68 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 1.68 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.84 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.84 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.84 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.84 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.84 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.64 % |
| Unclassified | root | N/A | 3.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101526454 | Not Available | 707 | Open in IMG/M |
| 3300000956|JGI10216J12902_111246625 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300002243|C687J29039_10271448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300002560|JGI25383J37093_10109495 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300002561|JGI25384J37096_10134894 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300002562|JGI25382J37095_10141311 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300003996|Ga0055467_10302372 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300004463|Ga0063356_100017239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6674 | Open in IMG/M |
| 3300004633|Ga0066395_10077254 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300005174|Ga0066680_10287533 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005180|Ga0066685_10493353 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005181|Ga0066678_10907533 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005184|Ga0066671_10014166 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300005332|Ga0066388_106585944 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005444|Ga0070694_101049996 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005539|Ga0068853_101103718 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005552|Ga0066701_10376609 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005553|Ga0066695_10400927 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005569|Ga0066705_10530782 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005569|Ga0066705_10579951 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005574|Ga0066694_10392761 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005598|Ga0066706_10120143 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300005617|Ga0068859_102927203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300005713|Ga0066905_100277919 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005713|Ga0066905_101626685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005713|Ga0066905_102064383 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005764|Ga0066903_100321301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2472 | Open in IMG/M |
| 3300006031|Ga0066651_10018055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2995 | Open in IMG/M |
| 3300006794|Ga0066658_10105656 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300006796|Ga0066665_10040622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3136 | Open in IMG/M |
| 3300006797|Ga0066659_10969729 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006852|Ga0075433_10001127 | All Organisms → cellular organisms → Bacteria | 19352 | Open in IMG/M |
| 3300006854|Ga0075425_101579134 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300006854|Ga0075425_103080169 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006903|Ga0075426_10284588 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006904|Ga0075424_100726889 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300006904|Ga0075424_101341351 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006904|Ga0075424_101999532 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006914|Ga0075436_100805379 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006914|Ga0075436_101163996 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300007004|Ga0079218_10989281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300009012|Ga0066710_100024271 | All Organisms → cellular organisms → Bacteria | 6847 | Open in IMG/M |
| 3300009088|Ga0099830_10156874 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300009088|Ga0099830_10210754 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300009089|Ga0099828_10166642 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300009137|Ga0066709_100045911 | All Organisms → cellular organisms → Bacteria | 4866 | Open in IMG/M |
| 3300009137|Ga0066709_100104254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3487 | Open in IMG/M |
| 3300009157|Ga0105092_10584403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 644 | Open in IMG/M |
| 3300009162|Ga0075423_11004104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 886 | Open in IMG/M |
| 3300009176|Ga0105242_13239468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 506 | Open in IMG/M |
| 3300009553|Ga0105249_11021778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 896 | Open in IMG/M |
| 3300010043|Ga0126380_12148470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
| 3300010046|Ga0126384_10105894 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300010303|Ga0134082_10100153 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010304|Ga0134088_10484380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 608 | Open in IMG/M |
| 3300010320|Ga0134109_10387388 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010322|Ga0134084_10094185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 948 | Open in IMG/M |
| 3300010325|Ga0134064_10107560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 925 | Open in IMG/M |
| 3300010333|Ga0134080_10205371 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 855 | Open in IMG/M |
| 3300010333|Ga0134080_10593870 | Not Available | 538 | Open in IMG/M |
| 3300010359|Ga0126376_11011282 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300010360|Ga0126372_11239258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 772 | Open in IMG/M |
| 3300010362|Ga0126377_11800187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 688 | Open in IMG/M |
| 3300010375|Ga0105239_11700735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 730 | Open in IMG/M |
| 3300010397|Ga0134124_10502626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1173 | Open in IMG/M |
| 3300012096|Ga0137389_10215997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1602 | Open in IMG/M |
| 3300012189|Ga0137388_11569005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300012198|Ga0137364_10015435 | All Organisms → cellular organisms → Bacteria | 4536 | Open in IMG/M |
| 3300012199|Ga0137383_10451733 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300012206|Ga0137380_10149238 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300012410|Ga0134060_1047358 | Not Available | 647 | Open in IMG/M |
| 3300012929|Ga0137404_10610258 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300013100|Ga0157373_11013838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
| 3300014150|Ga0134081_10018356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1949 | Open in IMG/M |
| 3300015264|Ga0137403_10305055 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300015372|Ga0132256_101508030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 783 | Open in IMG/M |
| 3300015373|Ga0132257_102352408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 691 | Open in IMG/M |
| 3300017654|Ga0134069_1070443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1117 | Open in IMG/M |
| 3300017659|Ga0134083_10030875 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300017792|Ga0163161_10983098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
| 3300018063|Ga0184637_10724436 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 540 | Open in IMG/M |
| 3300018433|Ga0066667_11228980 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300019377|Ga0190264_12335836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300020018|Ga0193721_1166818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300021080|Ga0210382_10383349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300021344|Ga0193719_10374599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300022694|Ga0222623_10421021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300025900|Ga0207710_10410508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300025921|Ga0207652_10331799 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300025934|Ga0207686_11456772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300025961|Ga0207712_10735472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 863 | Open in IMG/M |
| 3300026089|Ga0207648_12054927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300026312|Ga0209153_1094452 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1117 | Open in IMG/M |
| 3300026329|Ga0209375_1046291 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300026330|Ga0209473_1040067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2083 | Open in IMG/M |
| 3300026334|Ga0209377_1051737 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300026528|Ga0209378_1004864 | All Organisms → cellular organisms → Bacteria | 8845 | Open in IMG/M |
| 3300026538|Ga0209056_10469652 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 687 | Open in IMG/M |
| 3300026540|Ga0209376_1088105 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300026547|Ga0209156_10175674 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300026548|Ga0209161_10412962 | Not Available | 593 | Open in IMG/M |
| 3300027646|Ga0209466_1022270 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300027748|Ga0209689_1332021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300027862|Ga0209701_10387723 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300028809|Ga0247824_10642550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 641 | Open in IMG/M |
| 3300028878|Ga0307278_10245964 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300030619|Ga0268386_10148874 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300031545|Ga0318541_10669557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 580 | Open in IMG/M |
| 3300031546|Ga0318538_10045408 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300031561|Ga0318528_10249806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 951 | Open in IMG/M |
| 3300031564|Ga0318573_10017765 | All Organisms → cellular organisms → Bacteria | 3152 | Open in IMG/M |
| 3300031781|Ga0318547_10099790 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300031846|Ga0318512_10087386 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300031908|Ga0310900_10675599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 824 | Open in IMG/M |
| 3300032010|Ga0318569_10583624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300032179|Ga0310889_10311532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 762 | Open in IMG/M |
| 3300032180|Ga0307471_100747060 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300032205|Ga0307472_101787114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 610 | Open in IMG/M |
| 3300034147|Ga0364925_0076184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1167 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015264543 | 3300000364 | Soil | PPRVVDQTIVVDRDGFVRWFSVSRNFQVRPDPGDVLRVVRSL* |
| JGI10216J12902_1112466252 | 3300000956 | Soil | PIPTTVVLDRNGVVRWLWISNNFQVRPDPNAVLAAVRAL* |
| C687J29039_102714481 | 3300002243 | Soil | ATVVLDRDGVVRWFSVSRNYQVRPDPDDVLRAVRAL* |
| JGI25383J37093_101094951 | 3300002560 | Grasslands Soil | PDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPAPDDVLRAVRAL* |
| JGI25384J37096_101348941 | 3300002561 | Grasslands Soil | GPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| JGI25382J37095_101413111 | 3300002562 | Grasslands Soil | DVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0055467_103023722 | 3300003996 | Natural And Restored Wetlands | YGQDVPRPSTVVLDRDGLVRWVSVTRNYQVRPDPDEVLRALRALPPAR* |
| Ga0063356_1000172396 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VHVAGGQSGEDVPLPATVIVDRDGRVRWVSVTDNFQVRPDPGLVARVLREL* |
| Ga0066395_100772543 | 3300004633 | Tropical Forest Soil | EGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPGDVLRAVRAL* |
| Ga0066680_102875333 | 3300005174 | Soil | GQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVRRAVRAL* |
| Ga0066685_104933532 | 3300005180 | Soil | GQHGEDVPTPTTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL* |
| Ga0066678_109075331 | 3300005181 | Soil | LVHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL* |
| Ga0066671_100141661 | 3300005184 | Soil | DVPQPATVVLDRDGVVRWFSVSHNFQVRPDPGDVIRIVRSL* |
| Ga0066388_1065859442 | 3300005332 | Tropical Forest Soil | MQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAGRAL* |
| Ga0070694_1010499962 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ARNVLAGGAAGQDVPRPATIVVDRDGVVRWAQLADNVQVRPDAREVLRAVRSL* |
| Ga0068853_1011037181 | 3300005539 | Corn Rhizosphere | EDVPKPATIVIDRDGVVRWYKVSHNFQVRPDPGDVLKAVRAL* |
| Ga0066701_103766091 | 3300005552 | Soil | EDVPRPATVVLDRDGVVRWLSLSNNFQVRPDPGDVLRAVRAL* |
| Ga0066695_104009273 | 3300005553 | Soil | GEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL* |
| Ga0066705_105307822 | 3300005569 | Soil | GLVHAHGGPNGEDVPQPATVVLDRDGVVRWFSVSHNFQVRPDPGDVIRIVRSL* |
| Ga0066705_105799511 | 3300005569 | Soil | VVLDRDGVVRWLWVSDNFQVRPDPNDVLRAVRAL* |
| Ga0066694_103927612 | 3300005574 | Soil | VPRPATIVIDRNGIVRWVKVAANVQTRPDSREVLRAVRAL* |
| Ga0066706_101201433 | 3300005598 | Soil | VTRRVGLVHPGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL* |
| Ga0068859_1029272031 | 3300005617 | Switchgrass Rhizosphere | TVVIDRDGIVRWFSVSRNFQVRPDPGDVLRAVRAL* |
| Ga0066905_1002779193 | 3300005713 | Tropical Forest Soil | GPDGQDVPRPATVVLDRDGVVRWYSVSHNFQVRPDPGDVLRAVRAL* |
| Ga0066905_1016266852 | 3300005713 | Tropical Forest Soil | GGPDGRDVPRPATVVVDRDGVVRWFSVTRNVQVRPDPGDVLHVLRGL* |
| Ga0066905_1020643831 | 3300005713 | Tropical Forest Soil | GGAHGEDVPTPTTVVLDRDGVVRWLWISGNFQLRPDPDEVLRAVRAL* |
| Ga0066903_1003213011 | 3300005764 | Tropical Forest Soil | MQDVPRPATVVLDRDGVVRWFSTSKNAQVRFDPNDVLRAARAL* |
| Ga0066651_100180556 | 3300006031 | Soil | GGGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0066658_101056562 | 3300006794 | Soil | VPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0066665_100406221 | 3300006796 | Soil | PRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0066659_109697291 | 3300006797 | Soil | TVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0075433_1000112722 | 3300006852 | Populus Rhizosphere | ASGEDVPIPTTVVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL* |
| Ga0075425_1015791342 | 3300006854 | Populus Rhizosphere | TLVLDRDGVVRWVSVSRNFQVRPDPGDVLRAVRAL* |
| Ga0075425_1030801691 | 3300006854 | Populus Rhizosphere | VVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL* |
| Ga0075426_102845883 | 3300006903 | Populus Rhizosphere | QGGQDVPRPATVVIDRQGVVRWTAYADNFQLRPDPREVRRAIRAL* |
| Ga0075424_1007268891 | 3300006904 | Populus Rhizosphere | GGKDVPRPATVVIDRQGIVRWAAYADNVQSRPDTQDVLRAVRAL* |
| Ga0075424_1013413511 | 3300006904 | Populus Rhizosphere | HPRGGPDGQDVPRPATVLLDRNGVVRWLSLSSNYQVRPDPRDVVRAVRAL* |
| Ga0075424_1019995322 | 3300006904 | Populus Rhizosphere | QDVPRPATIVVDRDGFVRWFSVSRNFQVRPDPGDVLRVVRSL* |
| Ga0075436_1008053791 | 3300006914 | Populus Rhizosphere | ARGGADGQDVPRPATVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL* |
| Ga0075436_1011639961 | 3300006914 | Populus Rhizosphere | GEDVPIPTTVVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL* |
| Ga0079218_109892812 | 3300007004 | Agricultural Soil | VPATVVVDRAGVVRWAAYAENFQVRPDPRDVLQALKSL* |
| Ga0066710_1000242711 | 3300009012 | Grasslands Soil | GQDVPRPTTVVLDRDGVVRWFSITRNFQVRPDPGDVLRAVRAL |
| Ga0099830_101568745 | 3300009088 | Vadose Zone Soil | VVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0099830_102107541 | 3300009088 | Vadose Zone Soil | VPRPATVVLDRDGVVRWFSVSRNFQVRPDPEDVLRAVRAL* |
| Ga0099828_101666424 | 3300009089 | Vadose Zone Soil | VVLDRDGVVRWFSVSRNFQVHPDPDDVLRAVRAL* |
| Ga0066709_1000459111 | 3300009137 | Grasslands Soil | GEDVPRPATLVLDRDGVVRWLSVSRNFQVRPDPGDVLRAVRAL* |
| Ga0066709_1001042543 | 3300009137 | Grasslands Soil | VHQGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL* |
| Ga0105092_105844032 | 3300009157 | Freshwater Sediment | DVPRPATVVLDRDGVVRWVSLSDNYQVRPDPREVVRAVRAISG* |
| Ga0075423_110041041 | 3300009162 | Populus Rhizosphere | PRGGPNGEDVPRPATLVLDRDGLVRWVSVSRNFQVRPDPGDVLRAVRAL* |
| Ga0105242_132394681 | 3300009176 | Miscanthus Rhizosphere | ATIVLDRDGVVRWFSVSRNFQVRQDPGDVLRAVRAL* |
| Ga0105249_110217781 | 3300009553 | Switchgrass Rhizosphere | TIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS* |
| Ga0126380_121484702 | 3300010043 | Tropical Forest Soil | DGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0126384_101058941 | 3300010046 | Tropical Forest Soil | TVVLDKDGVVRWFSVSHNFQVRPDPEDVLRAVRAL* |
| Ga0134082_101001532 | 3300010303 | Grasslands Soil | TVVLDRDGVVRWFSVTRNFQVRPDPNDVLCAVRAL* |
| Ga0134088_104843802 | 3300010304 | Grasslands Soil | VHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL* |
| Ga0134109_103873881 | 3300010320 | Grasslands Soil | PATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0134084_100941851 | 3300010322 | Grasslands Soil | TVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL* |
| Ga0134064_101075601 | 3300010325 | Grasslands Soil | VVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL* |
| Ga0134080_102053713 | 3300010333 | Grasslands Soil | GQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0134080_105938701 | 3300010333 | Grasslands Soil | TTVVLDRAGVVRWLWVSDNFQVRPDPNEVLRAVRAL* |
| Ga0126376_110112821 | 3300010359 | Tropical Forest Soil | MQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAVRAL* |
| Ga0126372_112392581 | 3300010360 | Tropical Forest Soil | RARGHMQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAGRAL* |
| Ga0126377_118001872 | 3300010362 | Tropical Forest Soil | ATIVLDRDGVVRWFSVSSNFQVRPDPDAVLRAVRGQS* |
| Ga0105239_117007352 | 3300010375 | Corn Rhizosphere | VHARGGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS* |
| Ga0134124_105026263 | 3300010397 | Terrestrial Soil | VVLDRDGVVRWMSLSDNFQVRPAAGDVLRAVRTL* |
| Ga0137389_102159972 | 3300012096 | Vadose Zone Soil | LVHAGAGPDGQEVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0137388_115690052 | 3300012189 | Vadose Zone Soil | GQDVPRPATIVIDRNGVVRWARVADNIQTRPDAREVLRVVRAL* |
| Ga0137364_100154351 | 3300012198 | Vadose Zone Soil | GPEGQDVPRPATVVVDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0137383_104517331 | 3300012199 | Vadose Zone Soil | RPATVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL* |
| Ga0137380_101492381 | 3300012206 | Vadose Zone Soil | HAGGGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL* |
| Ga0134060_10473582 | 3300012410 | Grasslands Soil | TVVLDRDGVVRWLWISDNFQVRPDPDAVLGAVRAL* |
| Ga0137404_106102581 | 3300012929 | Vadose Zone Soil | HPGGGPDGQDVPRPATVVLDRDGVVRWFSASHNFQVRPDPGDVLRAVRAL* |
| Ga0157373_110138382 | 3300013100 | Corn Rhizosphere | PRPATIVVDRDGVVRWFSVTDNFQVRPDPGDVLRAIRGLS* |
| Ga0134081_100183561 | 3300014150 | Grasslands Soil | GPDGHDVPRPATVVLDRDGVVRWFSISRNFQVRPDPDDVLRAVRAL* |
| Ga0137403_103050553 | 3300015264 | Vadose Zone Soil | HPGGGPDGQDVPRPATVVLDRDGVVRWFSVSHNFQVRPDPGDVLRAVRAL* |
| Ga0132256_1015080302 | 3300015372 | Arabidopsis Rhizosphere | EDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS* |
| Ga0132257_1023524082 | 3300015373 | Arabidopsis Rhizosphere | GGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS* |
| Ga0134069_10704432 | 3300017654 | Grasslands Soil | VHARGGQHGEDVPTPTTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL |
| Ga0134083_100308755 | 3300017659 | Grasslands Soil | LDRDGVVRWFSVSRNFQVRPDPDDVLRAVRALYQAG |
| Ga0163161_109830982 | 3300017792 | Switchgrass Rhizosphere | VHARGGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS |
| Ga0184637_107244361 | 3300018063 | Groundwater Sediment | ATIVLDRDGVVRWFSVSSNFQVRPDPGEVLRAVRAL |
| Ga0066667_112289801 | 3300018433 | Grasslands Soil | GPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0190264_123358361 | 3300019377 | Soil | KDVPRPATVVVDKQGVVRWFSASHNFQVRPAPGEVLRVVRSLVAEKG |
| Ga0193721_11668181 | 3300020018 | Soil | DGQDVPRPATVVLDREGIVRWFSVSHNFQVRPDPGDVLRAIRAL |
| Ga0210382_103833491 | 3300021080 | Groundwater Sediment | RGGPDRQDVPRPATVVLDRAGVVRWFSASHNFQVRPAPGDVLRVVRSLVPEKG |
| Ga0193719_103745991 | 3300021344 | Soil | GGPDGQDVPRPATVVLDRAGVVRWFSVSHNFQVRPAPGDVLRVVRSLVAEKG |
| Ga0222623_104210211 | 3300022694 | Groundwater Sediment | ARGGRDGEDVPRPATVVLDRDGVVRWFSVSHNFQVRPDPGDVLRRVRSLVAERG |
| Ga0207710_104105082 | 3300025900 | Switchgrass Rhizosphere | PATIVLDRDGVVRWFSVSRNFQVRPDPGDVLRAVRAL |
| Ga0207652_103317993 | 3300025921 | Corn Rhizosphere | DVPRPATIVLDRDGVVRWFSVTDNFQVRPDPGDVLRAVRAL |
| Ga0207686_114567721 | 3300025934 | Miscanthus Rhizosphere | DRDGIVRWFSVARNFQVRPAPGDVLRVVRSLRGEKG |
| Ga0207712_107354722 | 3300025961 | Switchgrass Rhizosphere | TIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS |
| Ga0207648_120549272 | 3300026089 | Miscanthus Rhizosphere | GENGQDVPVPATVVIDRNGVVRWAAYAENFQVRPDPRDVVRAVKSL |
| Ga0209153_10944522 | 3300026312 | Soil | TTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL |
| Ga0209375_10462911 | 3300026329 | Soil | GGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0209473_10400674 | 3300026330 | Soil | GGGPEGQDVPRPATVVVDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0209377_10517372 | 3300026334 | Soil | ATVVVDRDGVVRWFSVTRNFQVGPDPDDVLRAVRAL |
| Ga0209378_10048649 | 3300026528 | Soil | ATVVLDRDGVVRWFSVSRNFQVRPDPDDVRRAVRAL |
| Ga0209056_104696522 | 3300026538 | Soil | VHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL |
| Ga0209376_10881055 | 3300026540 | Soil | RPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0209156_101756743 | 3300026547 | Soil | GQDVPRPATVVLDRDGVVRWFSITRNFQARPDPDDVLRAVRAL |
| Ga0209161_104129623 | 3300026548 | Soil | AVTRRVGLVHPGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL |
| Ga0209466_10222702 | 3300027646 | Tropical Forest Soil | PATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0209689_13320211 | 3300027748 | Soil | TVVVDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL |
| Ga0209701_103877232 | 3300027862 | Vadose Zone Soil | GQDVPRPTTVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0247824_106425501 | 3300028809 | Soil | TVAGRGGSEGQDVPRPATVVLDRNGVVRWFSVTANFQVRPDAADVLRAVRAL |
| Ga0307278_102459641 | 3300028878 | Soil | EGQDVPRPATIVLDRDGVVRWFSVSSNFQVRPDPGEVLRAVRSL |
| Ga0268386_101488741 | 3300030619 | Soil | RPATVVLDRDGVVRWFSVSRNFQIRPDPDDVRRAVRAL |
| Ga0318541_106695572 | 3300031545 | Soil | RPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0318538_100454084 | 3300031546 | Soil | RGGPDGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0318528_102498062 | 3300031561 | Soil | IHARGGPDGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0318573_100177655 | 3300031564 | Soil | DVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0318547_100997901 | 3300031781 | Soil | DVPRPATVILDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0318512_100873863 | 3300031846 | Soil | PRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0310900_106755991 | 3300031908 | Soil | PRPATIVLDRDGVVRWFSVTDNFQVRPDPGDVLRAVRAL |
| Ga0318569_105836241 | 3300032010 | Soil | ATVILDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL |
| Ga0310889_103115321 | 3300032179 | Soil | TVVVDRDGVVRWVSVSNNFQVRPDPAEVLRAVRAL |
| Ga0307471_1007470601 | 3300032180 | Hardwood Forest Soil | PATIVLDRDGVVKWFSVSRNFQVRPDPDDVLRAVRAL |
| Ga0307472_1017871141 | 3300032205 | Hardwood Forest Soil | RPATLVLDRDGVVRWLSLSDNFQVRPDPGDVLRAVRAL |
| Ga0364925_0076184_2_151 | 3300034147 | Sediment | DGQDVPRPATVVLDRDGVVRWFSASHNFQVRPDPGDVLRVVRSLMAEKG |
| ⦗Top⦘ |