


| Basic Information | |
|---|---|
| Family ID | F074677 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.68 % |
| % of genes near scaffold ends (potentially truncated) | 96.64 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 8.40 |
| PF14595 | Thioredoxin_9 | 8.40 |
| PF01314 | AFOR_C | 6.72 |
| PF03928 | HbpS-like | 5.88 |
| PF00296 | Bac_luciferase | 4.20 |
| PF08240 | ADH_N | 4.20 |
| PF07690 | MFS_1 | 4.20 |
| PF02627 | CMD | 2.52 |
| PF01636 | APH | 2.52 |
| PF00067 | p450 | 2.52 |
| PF02515 | CoA_transf_3 | 2.52 |
| PF01042 | Ribonuc_L-PSP | 1.68 |
| PF00903 | Glyoxalase | 1.68 |
| PF01769 | MgtE | 1.68 |
| PF05685 | Uma2 | 1.68 |
| PF00206 | Lyase_1 | 0.84 |
| PF04392 | ABC_sub_bind | 0.84 |
| PF05378 | Hydant_A_N | 0.84 |
| PF14833 | NAD_binding_11 | 0.84 |
| PF12695 | Abhydrolase_5 | 0.84 |
| PF00378 | ECH_1 | 0.84 |
| PF07969 | Amidohydro_3 | 0.84 |
| PF01186 | Lysyl_oxidase | 0.84 |
| PF02803 | Thiolase_C | 0.84 |
| PF13546 | DDE_5 | 0.84 |
| PF02417 | Chromate_transp | 0.84 |
| PF04909 | Amidohydro_2 | 0.84 |
| PF03706 | LPG_synthase_TM | 0.84 |
| PF07676 | PD40 | 0.84 |
| PF05638 | T6SS_HCP | 0.84 |
| PF02738 | MoCoBD_1 | 0.84 |
| PF12704 | MacB_PCD | 0.84 |
| PF08241 | Methyltransf_11 | 0.84 |
| PF00932 | LTD | 0.84 |
| PF12697 | Abhydrolase_6 | 0.84 |
| PF00202 | Aminotran_3 | 0.84 |
| PF00857 | Isochorismatase | 0.84 |
| PF06155 | GBBH-like_N | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 6.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.20 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 2.52 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.52 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.52 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 2.52 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.68 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.68 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 1.68 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 1.68 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.68 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.84 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.84 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.84 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.84 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.12 % |
| Unclassified | root | N/A | 5.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108160920 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300001661|JGI12053J15887_10561174 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300001661|JGI12053J15887_10620023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300005341|Ga0070691_10458827 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005345|Ga0070692_11128800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300005406|Ga0070703_10256008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 712 | Open in IMG/M |
| 3300005440|Ga0070705_100159315 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300005446|Ga0066686_10884829 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005468|Ga0070707_100564039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300005530|Ga0070679_100136955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2430 | Open in IMG/M |
| 3300005540|Ga0066697_10205204 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300005540|Ga0066697_10302184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 941 | Open in IMG/M |
| 3300005549|Ga0070704_101718326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300005558|Ga0066698_10546090 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005561|Ga0066699_10151451 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300005561|Ga0066699_10317263 | Not Available | 1111 | Open in IMG/M |
| 3300005598|Ga0066706_10099666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2106 | Open in IMG/M |
| 3300005764|Ga0066903_102501594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 1000 | Open in IMG/M |
| 3300005921|Ga0070766_10910776 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005985|Ga0081539_10306506 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006031|Ga0066651_10024705 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300006031|Ga0066651_10056344 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300006046|Ga0066652_100928528 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006049|Ga0075417_10621964 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006794|Ga0066658_10107349 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300006845|Ga0075421_102227321 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006847|Ga0075431_100545595 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300006847|Ga0075431_100941249 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006852|Ga0075433_11135636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300007255|Ga0099791_10488470 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300007255|Ga0099791_10567722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300009137|Ga0066709_103555702 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009137|Ga0066709_103689163 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009147|Ga0114129_11695412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 771 | Open in IMG/M |
| 3300009156|Ga0111538_11041315 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300009174|Ga0105241_11765053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300009177|Ga0105248_10450028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1451 | Open in IMG/M |
| 3300009807|Ga0105061_1042307 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010046|Ga0126384_10093106 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
| 3300010046|Ga0126384_10687192 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300010046|Ga0126384_10786585 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300010047|Ga0126382_11750027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300010301|Ga0134070_10336877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 582 | Open in IMG/M |
| 3300010303|Ga0134082_10250180 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010304|Ga0134088_10130704 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300010362|Ga0126377_11441405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 762 | Open in IMG/M |
| 3300010362|Ga0126377_11935625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 665 | Open in IMG/M |
| 3300010373|Ga0134128_11784850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300010376|Ga0126381_104511985 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010391|Ga0136847_12307707 | Not Available | 596 | Open in IMG/M |
| 3300010398|Ga0126383_11131007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 873 | Open in IMG/M |
| 3300012198|Ga0137364_10080248 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300012204|Ga0137374_10022783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7052 | Open in IMG/M |
| 3300012360|Ga0137375_11239325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300012397|Ga0134056_1238389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300012918|Ga0137396_11089838 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012922|Ga0137394_10030992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4341 | Open in IMG/M |
| 3300012922|Ga0137394_10155217 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300012948|Ga0126375_11431665 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012971|Ga0126369_11687506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300012971|Ga0126369_13061375 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012988|Ga0164306_10891334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
| 3300013100|Ga0157373_10915735 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300014166|Ga0134079_10101155 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300014873|Ga0180066_1043111 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300015245|Ga0137409_11528036 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium | 517 | Open in IMG/M |
| 3300015259|Ga0180085_1232709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 544 | Open in IMG/M |
| 3300015261|Ga0182006_1165355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 744 | Open in IMG/M |
| 3300017657|Ga0134074_1018464 | Not Available | 2288 | Open in IMG/M |
| 3300018027|Ga0184605_10029066 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300018063|Ga0184637_10070000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2149 | Open in IMG/M |
| 3300018429|Ga0190272_13033951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300018431|Ga0066655_11169418 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300018433|Ga0066667_10047359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2567 | Open in IMG/M |
| 3300018482|Ga0066669_10041860 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300019229|Ga0180116_1314672 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300019360|Ga0187894_10021556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4517 | Open in IMG/M |
| 3300019360|Ga0187894_10366689 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300019487|Ga0187893_10594250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300019789|Ga0137408_1152473 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300019886|Ga0193727_1130486 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300020082|Ga0206353_10189581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300020580|Ga0210403_10373541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1166 | Open in IMG/M |
| 3300021088|Ga0210404_10168611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300021178|Ga0210408_10024869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4758 | Open in IMG/M |
| 3300025001|Ga0209618_1052913 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300025327|Ga0209751_10197248 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300025549|Ga0210094_1083259 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025921|Ga0207652_10165959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1980 | Open in IMG/M |
| 3300025922|Ga0207646_11926890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300025961|Ga0207712_10799370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 829 | Open in IMG/M |
| 3300026088|Ga0207641_11438407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300026301|Ga0209238_1032258 | Not Available | 1942 | Open in IMG/M |
| 3300026323|Ga0209472_1158683 | Not Available | 834 | Open in IMG/M |
| 3300026324|Ga0209470_1255164 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300026374|Ga0257146_1075980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300026528|Ga0209378_1158512 | Not Available | 880 | Open in IMG/M |
| 3300027654|Ga0209799_1052548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 911 | Open in IMG/M |
| 3300027846|Ga0209180_10058323 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300027909|Ga0209382_10757809 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300027909|Ga0209382_11657072 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300027947|Ga0209868_1012805 | Not Available | 829 | Open in IMG/M |
| 3300028381|Ga0268264_10626661 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300028809|Ga0247824_10381641 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1109363 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031720|Ga0307469_11371018 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031720|Ga0307469_12525400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300031740|Ga0307468_101508099 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300031765|Ga0318554_10003797 | All Organisms → cellular organisms → Bacteria | 6861 | Open in IMG/M |
| 3300031820|Ga0307473_11222432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300031854|Ga0310904_10772097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
| 3300031901|Ga0307406_11279485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300031949|Ga0214473_12013388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 563 | Open in IMG/M |
| 3300032001|Ga0306922_10169320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2340 | Open in IMG/M |
| 3300032180|Ga0307471_104012604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300032516|Ga0315273_11200950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 955 | Open in IMG/M |
| 3300033407|Ga0214472_11014058 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 733 | Open in IMG/M |
| 3300033813|Ga0364928_0062420 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300033814|Ga0364930_0336220 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 2.52% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.84% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1081609203 | 3300000955 | Soil | QRVTAKLAPRYEKPFSAYGEYRPWRTGVASNIERTFAMVS* |
| JGI12053J15887_105611742 | 3300001661 | Forest Soil | ALAPTYEKPFSVYGDYRPWRAGLLRNIERTYAMVS* |
| JGI12053J15887_106200232 | 3300001661 | Forest Soil | RVTDKLAPTYEKPFSTYGDYRPWRAGLLLNIERTYAMVS* |
| Ga0070691_104588272 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVKQRVTARLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS* |
| Ga0070692_111288002 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | KQRVTAKLAPRYEKPFSAYGEYRPWRTGLAANIERTFGMVG* |
| Ga0070703_102560082 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | EETKRRVTDKLAPTYEKPFSAYGDYRPWRGGLALNIERTYAMVG* |
| Ga0070705_1001593151 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QRVIAKLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS* |
| Ga0066686_108848292 | 3300005446 | Soil | DEVKQRVTAKLAPRYEKPFSTYGDYRPWRTGLAANIERTFGMVS* |
| Ga0070707_1005640392 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KERLPAVLGPVYEKPFSVYGDYRPWRLGLLGNIERTYAMVS* |
| Ga0070679_1001369553 | 3300005530 | Corn Rhizosphere | EVKQRVTAALAPTYEKPFSAYGEYRPWRTGLAGNVERTFAMVS* |
| Ga0066697_102052042 | 3300005540 | Soil | RVPERLALVYEKPFSLYGHYRPWRQGLRSNIERTYTMVS* |
| Ga0066697_103021843 | 3300005540 | Soil | EALAATYEKPFSAYGVYRPWRTGLLLNIERTYAMVS* |
| Ga0070704_1017183261 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VKQRVIAKLAPRHEKTFLAYNDYRPWRTGAAANIERTFAMVS* |
| Ga0066698_105460901 | 3300005558 | Soil | KQRVTAKLAPRYEKPFSVYGEYRPWRTGVLANIERTFAMVS* |
| Ga0066699_101514511 | 3300005561 | Soil | QRRVPEALAPTYEKPFSAYGDYRPWRAGLLLNIERTYAMVS* |
| Ga0066699_103172632 | 3300005561 | Soil | EVKQRVTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS* |
| Ga0066706_100996661 | 3300005598 | Soil | VTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS* |
| Ga0066903_1025015942 | 3300005764 | Tropical Forest Soil | DRLAPAYEQAFSKYGTYRPWRTGILTNIERTFAMVS* |
| Ga0070766_109107761 | 3300005921 | Soil | VPARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS* |
| Ga0081539_103065062 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYAMVS* |
| Ga0066651_100247051 | 3300006031 | Soil | RVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS* |
| Ga0066651_100563443 | 3300006031 | Soil | RLAPVYEKPFSLYGHYRPWRAALRANIERTYAMVS* |
| Ga0066652_1009285283 | 3300006046 | Soil | PEALAPTYEKPFSAYGDYRPWRAGLLLNIERTYAMVS* |
| Ga0075417_106219641 | 3300006049 | Populus Rhizosphere | QRVTAALAPAYERPFSAYGDYRPWRAGLAANIERTFAMVS* |
| Ga0066658_101073491 | 3300006794 | Soil | TLEEVQQRVPERLAPVYEKPFSLYGHYRPWRAALRSNIERTYAMVS* |
| Ga0075421_1022273211 | 3300006845 | Populus Rhizosphere | TTRLAPTYEPVFSTHQHYRPWRQGLLANIERTYAMVS* |
| Ga0075431_1005455952 | 3300006847 | Populus Rhizosphere | LDEVKARVPAKLAQIYEKPFSTYGEYRPWRTGILANIERTYAMVS* |
| Ga0075431_1009412493 | 3300006847 | Populus Rhizosphere | TAKLAPRYEKPFSAYGEYRPWRTGLAANIERTFGMVG* |
| Ga0075433_111356361 | 3300006852 | Populus Rhizosphere | KLAPRYEKPFSAYGDYRPWRTGAAANIERTFGMVS* |
| Ga0099791_104884701 | 3300007255 | Vadose Zone Soil | VPAALAGTYEKPFSVYADYRPWRTGILANVERTYAMVS* |
| Ga0099791_105677221 | 3300007255 | Vadose Zone Soil | VTAKLAPRYEKPFSAYGEYRPWRTGVAANIERTFGMVS* |
| Ga0066709_1035557022 | 3300009137 | Grasslands Soil | EVKERVPPKLAPAHEKPFSAYPDYRPWRQGLLGNIERTYALLSQVK* |
| Ga0066709_1036891632 | 3300009137 | Grasslands Soil | LEEAQQRVPERLALVYEKPFSLYGHYRPWRQGLRGNIERTYAMVV* |
| Ga0114129_116954121 | 3300009147 | Populus Rhizosphere | EVKQRVPAALAGTYEKPFSKYGDYRPWRTGILANIERTYAMVS* |
| Ga0111538_110413153 | 3300009156 | Populus Rhizosphere | SALAPTYEKAFSVYGEYRPWRAGLAANVERTFAMVS* |
| Ga0105241_117650532 | 3300009174 | Corn Rhizosphere | VLGPIYEKPFSVYGDYRPWRAGLLGNIERTYAMVS* |
| Ga0105248_104500281 | 3300009177 | Switchgrass Rhizosphere | PRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS* |
| Ga0105061_10423072 | 3300009807 | Groundwater Sand | LAPTYEKPFSAYGEYRPWRTGLAGNIERTFTMVS* |
| Ga0126384_100931063 | 3300010046 | Tropical Forest Soil | VKQRVPEKLAPAYEKPFSKYGEYRPWRAGLLANIERTFAMVS* |
| Ga0126384_106871921 | 3300010046 | Tropical Forest Soil | RLAPTYEPAFATYNHYRPWRAGLLANIERTYPMVS* |
| Ga0126384_107865851 | 3300010046 | Tropical Forest Soil | ATLDEVKQRVIAKLAPRYEKPSSAYGEYRPWRTGAAANIERTFGTVS* |
| Ga0126382_117500271 | 3300010047 | Tropical Forest Soil | IANLAPRYEKPFSTYGEYRPWRTGAAANVERTFGMVS* |
| Ga0134070_103368772 | 3300010301 | Grasslands Soil | TDRLAPAYEKPFSAYGDYRPWRAGLALNIQRTYAMVS* |
| Ga0134082_102501801 | 3300010303 | Grasslands Soil | AKLAPTYEKPFSTYGHYRPWRQGILGNIERAYAMVS* |
| Ga0134088_101307041 | 3300010304 | Grasslands Soil | LEEAQQRVPERLALVYEKPFSLYGHYLPLRQGLRSNIERTYTMVS* |
| Ga0126377_114414051 | 3300010362 | Tropical Forest Soil | PPKLAPTYEKAFSTYGDYRPWRQGLLANIERTYAMVA* |
| Ga0126377_119356251 | 3300010362 | Tropical Forest Soil | TQRRVTDKLAPAYEKPFSAYGDYRPWRAGLARNIERTFAMVS* |
| Ga0134128_117848502 | 3300010373 | Terrestrial Soil | AALAGTYEKPFSKYGDYRPWRAGILANIERTYAMVS* |
| Ga0126381_1045119852 | 3300010376 | Tropical Forest Soil | RRVTDSLVPDYEKPFSTYGDYRPLRAGLARNIERTYSTVS* |
| Ga0136847_123077072 | 3300010391 | Freshwater Sediment | VPERLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS* |
| Ga0126383_111310071 | 3300010398 | Tropical Forest Soil | DKLAPAYEKPFSAYGDYRPWRAGLARNVERTYAMIS* |
| Ga0137364_100802485 | 3300012198 | Vadose Zone Soil | LAPTYEKAFSAYGDYRPWRTGVLGNIERTYAVVS* |
| Ga0137374_100227831 | 3300012204 | Vadose Zone Soil | TLEEVQRRVTDRLAPAYEKPFSAYGDYRPWRAGLALNVQRTYAMVS* |
| Ga0137375_112393251 | 3300012360 | Vadose Zone Soil | VKQRVTAKLAPRYEKPFSTYGDYRPWRTGVLANIERTFAMVS* |
| Ga0134056_12383891 | 3300012397 | Grasslands Soil | AKLAPTYEKAFSVYGHYRPWRQGIMANIERTYAMVG* |
| Ga0137396_110898381 | 3300012918 | Vadose Zone Soil | KLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS* |
| Ga0137394_100309921 | 3300012922 | Vadose Zone Soil | RVPARLAPTYEKAFATYEHYRPWRAGLHANIERTYAMVS* |
| Ga0137394_101552171 | 3300012922 | Vadose Zone Soil | TARLAPTYEPAFAAYQHYRPWRQGLLGNIERTYPMVS* |
| Ga0126375_114316651 | 3300012948 | Tropical Forest Soil | KLAPRYEKPFSTYGDYRPWRTGVLANIERTFGMVS* |
| Ga0126369_116875063 | 3300012971 | Tropical Forest Soil | KLAPTYEKAFSTYGDYRPWRQGLLANIERTYAMVG* |
| Ga0126369_130613752 | 3300012971 | Tropical Forest Soil | LGPAYEKSFSVYGEYRPWRAGLLGNIERTYAMVS* |
| Ga0164306_108913342 | 3300012988 | Soil | QRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS* |
| Ga0157373_109157351 | 3300013100 | Corn Rhizosphere | RVTARLSPTHEKAFAEYNDYRPWRTGLLGNIERTFAMVS* |
| Ga0134079_101011551 | 3300014166 | Grasslands Soil | LAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS* |
| Ga0180066_10431111 | 3300014873 | Soil | LDRLAETYEPAFAAYQHYRPWRQGLLANIERTYPMVS* |
| Ga0137409_115280361 | 3300015245 | Vadose Zone Soil | PAALAGTYEKPFSRYGDYRPWRTGILANIERTYAMVS* |
| Ga0180085_12327091 | 3300015259 | Soil | VQQRVPERLAPTYEKPFSTYGNYRPWRAGLLRNIERTYAMVS* |
| Ga0182006_11653551 | 3300015261 | Rhizosphere | VKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS* |
| Ga0134074_10184643 | 3300017657 | Grasslands Soil | VQQRVPAKLAPTYEKSFSVYGHYRPWRQGIMANIERAYAMVG |
| Ga0184605_100290664 | 3300018027 | Groundwater Sediment | QRVTAALAPTYEKAFSAYGEYRPWRTGLAGNIERTFAMVS |
| Ga0184637_100700001 | 3300018063 | Groundwater Sediment | AALAPTYEKPFSAYGEYRPWRTGLAANIERTFAMVS |
| Ga0190272_130339512 | 3300018429 | Soil | LLGPVYEKPFSAYGDYRPWRLGLLGNIERTYAMVS |
| Ga0066655_111694181 | 3300018431 | Grasslands Soil | TAKLAPRYEKPFSVYGEYRPWRTGVLANIERTFAMVS |
| Ga0066667_100473593 | 3300018433 | Grasslands Soil | PAKLAPTYEKPFSTYGHYRPWRQGILGNIERAYAMVS |
| Ga0066669_100418603 | 3300018482 | Grasslands Soil | RVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS |
| Ga0180116_13146721 | 3300019229 | Groundwater Sediment | RVTDKLAPTYEKPFSAYGDYRPWRAGLARNIERTYAMVS |
| Ga0187894_100215563 | 3300019360 | Microbial Mat On Rocks | MDCCVHDAPTYEPAFAAYQHYRPWRQGLLANIERTHPMVS |
| Ga0187894_103666892 | 3300019360 | Microbial Mat On Rocks | RVTAKLAPVHEKSFSAYADYRPWRAGLLGNIERTFAMVS |
| Ga0187893_105942502 | 3300019487 | Microbial Mat On Rocks | MDCCGHEGPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS |
| Ga0137408_11524733 | 3300019789 | Vadose Zone Soil | RVSAKLAPRYEKPFSAYGEYRPWSTGVLANIERTFAMVS |
| Ga0193727_11304861 | 3300019886 | Soil | QRVTARLAPTYEPAFAAYQHYRPWRQGLLGNIERTYPMVS |
| Ga0206353_101895812 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | PPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS |
| Ga0210403_103735413 | 3300020580 | Soil | RVPARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS |
| Ga0210404_101686113 | 3300021088 | Soil | ARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS |
| Ga0210408_100248696 | 3300021178 | Soil | EVKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYAMVS |
| Ga0209618_10529131 | 3300025001 | Soil | RLAPIYEPAFSTYQHYRPWRQGLLANIERTYAMVS |
| Ga0209751_101972481 | 3300025327 | Soil | RLAPKYEKPFSTYGDYRPWRAGLLRNIERTYAMVS |
| Ga0210094_10832591 | 3300025549 | Natural And Restored Wetlands | QRRVTDKLAPTYERAFSAYGDYRPWRAGLALNVERTYAMVN |
| Ga0207652_101659593 | 3300025921 | Corn Rhizosphere | DEVKQRVTAALAPTYEKPFSAYGEYRPWRTGLAGNVERTFAMVS |
| Ga0207646_119268902 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KERLPAVLGPIYEKPFSVYGDYRPWRLGLLGNIERTYAMVS |
| Ga0207712_107993702 | 3300025961 | Switchgrass Rhizosphere | VKHRVPPKLAPTYEKAFSTYGDYRPWRQGLLANIERTYSMVG |
| Ga0207641_114384071 | 3300026088 | Switchgrass Rhizosphere | RVIAKLAPRHEKTFLAYNDYRPWRTGAAANIERTFAMVS |
| Ga0209238_10322582 | 3300026301 | Grasslands Soil | EEVQQRVPAKLAPTYEKSFSVYGHYRPWRQGIMANIERTYAMVG |
| Ga0209472_11586832 | 3300026323 | Soil | KQRVTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS |
| Ga0209470_12551642 | 3300026324 | Soil | KQRVTAKLAPRYEKPFSAYGDYRPWRTGLAANIERTFGMVS |
| Ga0257146_10759801 | 3300026374 | Soil | VKQRVIAKLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS |
| Ga0209378_11585121 | 3300026528 | Soil | LLVDERVPERLALVYEKPFSLYGHYRPWRQGLRSNIERTYTMVS |
| Ga0209799_10525481 | 3300027654 | Tropical Forest Soil | EETQRRVTDRLAPAYEKPFSTYGDYRPWRTGLARNIERTFSMVS |
| Ga0209180_100583231 | 3300027846 | Vadose Zone Soil | RLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMAS |
| Ga0209382_107578091 | 3300027909 | Populus Rhizosphere | VKARVPAKLAQIYEKPFSTYGEYRPWRTGILANIERTYAMVS |
| Ga0209382_116570721 | 3300027909 | Populus Rhizosphere | TTRLAPTYEPVFSTHQHYRPWRQGLLANIERTYAMVS |
| Ga0209868_10128052 | 3300027947 | Groundwater Sand | TAKLAPRYEKPFSTYGDYRPWRTGVLANIERTFAMVS |
| Ga0268264_106266612 | 3300028381 | Switchgrass Rhizosphere | RRVTERLAPAYEKPFSVYGDYRPWRAGLALNIQRTYTMVS |
| Ga0247824_103816411 | 3300028809 | Soil | RAVTRCLTSSRLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS |
| (restricted) Ga0255312_11093631 | 3300031248 | Sandy Soil | VKQRVTTKLAPVYEKPFSAYGDYRPWRAGLAANVERTFAMVS |
| Ga0307469_113710182 | 3300031720 | Hardwood Forest Soil | ATAKLAPRYEKAFSAYGDYRPWRTGVLANIERTFGMVS |
| Ga0307469_125254002 | 3300031720 | Hardwood Forest Soil | TDRLAPAYEKPFSAYGDYRPWRAGLALNIQRTYAMVS |
| Ga0307468_1015080992 | 3300031740 | Hardwood Forest Soil | RVPAALAGTYEKPFSKYGDYRPWRTGILANIERTYAMVS |
| Ga0318554_1000379710 | 3300031765 | Soil | VKQRVIAKLAPRYEKPFSAYGEYRPWRTGVAANIERTFGMVS |
| Ga0307473_112224322 | 3300031820 | Hardwood Forest Soil | TLEETQRRVTERLAPTYEKPFSTYGDYRPWRAGLLRNVERAYAMVG |
| Ga0310904_107720971 | 3300031854 | Soil | KLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS |
| Ga0307406_112794851 | 3300031901 | Rhizosphere | QVKERVTARLAPIHEAKFAAYADYRPWRAGLAGNVERTFAMVS |
| Ga0214473_120133882 | 3300031949 | Soil | KQRVPAKLAAAYEKPFSAYADYRPWRTGVLGNIERTYAMVS |
| Ga0306922_101693203 | 3300032001 | Soil | PDRLAPAYEQAFSKYGAYRPWRTGILTNIERVFAMVS |
| Ga0307471_1040126041 | 3300032180 | Hardwood Forest Soil | KQRVSAKLAPRYEKPFSAYGDYRPWRTGVLANIERTFPMVS |
| Ga0315273_112009503 | 3300032516 | Sediment | AQRRVPDRLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS |
| Ga0214472_110140582 | 3300033407 | Soil | PDRLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS |
| Ga0364928_0062420_3_113 | 3300033813 | Sediment | ARLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS |
| Ga0364930_0336220_387_503 | 3300033814 | Sediment | VPDELAPVYEQAFSKYAAYRPWRQGILTNIERIFATVG |
| ⦗Top⦘ |