


| Basic Information | |
|---|---|
| Family ID | F074665 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 47 residues |
| Representative Sequence | PLGPIALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.56 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 92.44 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.277 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.050 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.252 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.420 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.68% β-sheet: 22.08% Coil/Unstructured: 53.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF14478 | DUF4430 | 24.37 |
| PF04909 | Amidohydro_2 | 8.40 |
| PF01497 | Peripla_BP_2 | 5.88 |
| PF13193 | AMP-binding_C | 5.04 |
| PF12681 | Glyoxalase_2 | 2.52 |
| PF00005 | ABC_tran | 1.68 |
| PF13669 | Glyoxalase_4 | 0.84 |
| PF03720 | UDPG_MGDP_dh_C | 0.84 |
| PF00111 | Fer2 | 0.84 |
| PF03480 | DctP | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.88 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.88 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.88 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.88 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.28 % |
| Unclassified | root | N/A | 6.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10068227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10087768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300001978|JGI24747J21853_1034966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 583 | Open in IMG/M |
| 3300002917|JGI25616J43925_10067689 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300005332|Ga0066388_106044873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300005332|Ga0066388_106563811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005332|Ga0066388_108431744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300005363|Ga0008090_15904717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300005365|Ga0070688_100459870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 953 | Open in IMG/M |
| 3300005434|Ga0070709_11582343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 533 | Open in IMG/M |
| 3300005445|Ga0070708_101849417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 560 | Open in IMG/M |
| 3300005540|Ga0066697_10250526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300005549|Ga0070704_101072976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300005713|Ga0066905_100097235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1988 | Open in IMG/M |
| 3300005713|Ga0066905_100166849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1607 | Open in IMG/M |
| 3300005713|Ga0066905_100514519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300005764|Ga0066903_101057454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300005764|Ga0066903_101407562 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300005764|Ga0066903_102487839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300005764|Ga0066903_102647568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300005764|Ga0066903_106578573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300005764|Ga0066903_107052158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300005764|Ga0066903_107798133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300005981|Ga0081538_10332793 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006794|Ga0066658_10623446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300006797|Ga0066659_10592889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300006844|Ga0075428_101056403 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006845|Ga0075421_100207269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2423 | Open in IMG/M |
| 3300006853|Ga0075420_101312076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300006953|Ga0074063_10121418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1823 | Open in IMG/M |
| 3300006953|Ga0074063_10135545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300006969|Ga0075419_10230848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1232 | Open in IMG/M |
| 3300009094|Ga0111539_13459644 | Not Available | 507 | Open in IMG/M |
| 3300009553|Ga0105249_10751101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1038 | Open in IMG/M |
| 3300009792|Ga0126374_10129033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1494 | Open in IMG/M |
| 3300009840|Ga0126313_11499944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 560 | Open in IMG/M |
| 3300010043|Ga0126380_11459152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300010045|Ga0126311_11272407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 610 | Open in IMG/M |
| 3300010046|Ga0126384_11553662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010047|Ga0126382_11341488 | Not Available | 649 | Open in IMG/M |
| 3300010047|Ga0126382_12067377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300010048|Ga0126373_12003159 | Not Available | 641 | Open in IMG/M |
| 3300010360|Ga0126372_12094200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300010361|Ga0126378_13112729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300010366|Ga0126379_10444078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1357 | Open in IMG/M |
| 3300010366|Ga0126379_11289420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010366|Ga0126379_13064258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300010376|Ga0126381_101850712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300010398|Ga0126383_11201207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300010398|Ga0126383_11518483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300012198|Ga0137364_10231809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300012199|Ga0137383_11267739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300012200|Ga0137382_10036087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2997 | Open in IMG/M |
| 3300012201|Ga0137365_11253342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012359|Ga0137385_11450389 | Not Available | 550 | Open in IMG/M |
| 3300012972|Ga0134077_10321031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300013306|Ga0163162_10275732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1814 | Open in IMG/M |
| 3300014968|Ga0157379_10781159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 900 | Open in IMG/M |
| 3300015077|Ga0173483_10302969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 783 | Open in IMG/M |
| 3300015371|Ga0132258_10563623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2856 | Open in IMG/M |
| 3300016357|Ga0182032_10455696 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300016371|Ga0182034_11178663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300021339|Ga0193706_1103479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 775 | Open in IMG/M |
| 3300021418|Ga0193695_1042257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 988 | Open in IMG/M |
| 3300021478|Ga0210402_10767770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300025918|Ga0207662_10758972 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025941|Ga0207711_11061921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 750 | Open in IMG/M |
| 3300025942|Ga0207689_10369184 | Not Available | 1194 | Open in IMG/M |
| 3300026326|Ga0209801_1169809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300026846|Ga0208273_102082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 651 | Open in IMG/M |
| 3300027523|Ga0208890_1028432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 834 | Open in IMG/M |
| 3300027703|Ga0207862_1210636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300027874|Ga0209465_10183697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300027909|Ga0209382_11861663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300028711|Ga0307293_10195513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300028712|Ga0307285_10125075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 692 | Open in IMG/M |
| 3300028712|Ga0307285_10212890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 543 | Open in IMG/M |
| 3300028714|Ga0307309_10026864 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300028771|Ga0307320_10435781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 527 | Open in IMG/M |
| 3300028778|Ga0307288_10341507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 602 | Open in IMG/M |
| 3300028885|Ga0307304_10456002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 582 | Open in IMG/M |
| 3300031545|Ga0318541_10063588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1920 | Open in IMG/M |
| 3300031564|Ga0318573_10056192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1935 | Open in IMG/M |
| 3300031573|Ga0310915_10335569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300031680|Ga0318574_10079406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1787 | Open in IMG/M |
| 3300031680|Ga0318574_10515339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300031719|Ga0306917_10312600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300031720|Ga0307469_10918807 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031736|Ga0318501_10075213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1640 | Open in IMG/M |
| 3300031736|Ga0318501_10213810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300031744|Ga0306918_10185985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1558 | Open in IMG/M |
| 3300031747|Ga0318502_10217535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300031765|Ga0318554_10803659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300031769|Ga0318526_10056229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1511 | Open in IMG/M |
| 3300031771|Ga0318546_10068443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2260 | Open in IMG/M |
| 3300031782|Ga0318552_10065550 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300031793|Ga0318548_10066380 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300031796|Ga0318576_10076399 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300031796|Ga0318576_10149188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300031798|Ga0318523_10112053 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300031798|Ga0318523_10329103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031831|Ga0318564_10105618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1252 | Open in IMG/M |
| 3300031879|Ga0306919_10032334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3312 | Open in IMG/M |
| 3300031893|Ga0318536_10633167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031894|Ga0318522_10124068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
| 3300031941|Ga0310912_10739346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031942|Ga0310916_11185327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300032001|Ga0306922_10207001 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300032025|Ga0318507_10072525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1398 | Open in IMG/M |
| 3300032041|Ga0318549_10053428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1673 | Open in IMG/M |
| 3300032041|Ga0318549_10059979 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300032059|Ga0318533_11229548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300032064|Ga0318510_10044858 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300032075|Ga0310890_10177535 | Not Available | 1438 | Open in IMG/M |
| 3300032090|Ga0318518_10165128 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300032091|Ga0318577_10147850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300033290|Ga0318519_10010046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3838 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026846 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100682273 | 3300000597 | Forest Soil | AHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| AF_2010_repII_A001DRAFT_100877681 | 3300000793 | Forest Soil | GGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| JGI24747J21853_10349661 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKRARDLWKRFG* |
| JGI25616J43925_100676891 | 3300002917 | Grasslands Soil | LVAHRVVNGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| Ga0066388_1011502943 | 3300005332 | Tropical Forest Soil | PIALLAHRVTDGRVTSVGLRLPEDEAAPTTLAARLKKVARDLWALWG* |
| Ga0066388_1060448732 | 3300005332 | Tropical Forest Soil | KRRPKQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDALPATLPAKLKKAARDLWSRLG |
| Ga0066388_1065638112 | 3300005332 | Tropical Forest Soil | PLGPIALVAHRVVNGRVTSVGLRLAEDEAPATLPAKLKKAARDLWSRLG* |
| Ga0066388_1084317442 | 3300005332 | Tropical Forest Soil | AHRVTGGRVASIGLRLAEDDAPPATLPAKLKKAARDLWSRLG* |
| Ga0008090_159047173 | 3300005363 | Tropical Rainforest Soil | VAHRVANGRVTSVGLRLAEDDAPPATLPAKLKKAARDLWSRLW* |
| Ga0070688_1004598701 | 3300005365 | Switchgrass Rhizosphere | ALVAHRVADGRVSSVGLRLAEDDTPPATVSARLKKLARDLWRRFG* |
| Ga0070709_115823432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MASGRVTSVGLRLAEDDTPPATISGRIKKLARDLWKRFG* |
| Ga0070708_1018494172 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GPIALLAHQVANGRVTSVGLRLPEDDEEPTTVPARLRLAARNLWQRIR* |
| Ga0066697_102505261 | 3300005540 | Soil | GPIALVAHRVTDGRLSNVGLRLAQEEEPPATLAAKIKKTARELWSRLG* |
| Ga0070704_1010729761 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGPIALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| Ga0066905_1000972354 | 3300005713 | Tropical Forest Soil | PLGPIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKRAARDLWSRLG* |
| Ga0066905_1001668491 | 3300005713 | Tropical Forest Soil | ALVAHRVANGRVVSIGLRLAEDDAPPATLPAKLKKAARDLWSRLG* |
| Ga0066905_1005145191 | 3300005713 | Tropical Forest Soil | VVPLGPIALVAHRVTDGRLASVGLRLAQADEPPATLAAKLKKAARDLWSRLG* |
| Ga0066903_1010574545 | 3300005764 | Tropical Forest Soil | IALVAHRVANGRVASIGLRLAEDEAPPATLPAKLKKAARDLWSRLG* |
| Ga0066903_1014075622 | 3300005764 | Tropical Forest Soil | RVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| Ga0066903_1024878391 | 3300005764 | Tropical Forest Soil | PLGPIALVAHRVANGRVASIGLRLAEDEAPPATLPAKLKRAARDLWSRLG* |
| Ga0066903_1026475683 | 3300005764 | Tropical Forest Soil | GPIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKRAARDLWSRLG* |
| Ga0066903_1065785731 | 3300005764 | Tropical Forest Soil | AHRVNRGRVTSVGLRLAEDEELAATIAGKLRKAARDLWARLG* |
| Ga0066903_1070521581 | 3300005764 | Tropical Forest Soil | IALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKKAARDLWSRLG* |
| Ga0066903_1077981332 | 3300005764 | Tropical Forest Soil | AHRVTDGRVTSVGLRLPEDDAEPATLAAKLKKAARDLWTRLS* |
| Ga0081538_103327931 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AHRVANGRVSSVGLRLADDDAAPTTLAARLKNAARDLWAWWG* |
| Ga0066658_106234461 | 3300006794 | Soil | LMIIPGHADLACDVVPLGPIALVAHRVTDGRLSNVGLRLAQEEEPPATLAAKIKKTARELWSRLG* |
| Ga0066659_105928893 | 3300006797 | Soil | ALVAHRVTDGRLASVGLRLAQEEELPATLAAKIKKTARDLWLRLG* |
| Ga0075428_1010564032 | 3300006844 | Populus Rhizosphere | GDIVPLGPIALLAHRVTDGRVTSVGLRLAEDDAGPTTLATRLKKVARDLWARWG* |
| Ga0075421_1002072691 | 3300006845 | Populus Rhizosphere | DIVPLGPIALLAHRVTDGRVTSVGLRLAEDDAGPTTLATRLKKVARDLWARWG* |
| Ga0075420_1013120762 | 3300006853 | Populus Rhizosphere | QLGPIALVAHRVADGRVSSVGLRLAEDDTPPATVSARLKKLARDLWRRFG* |
| Ga0074063_101214181 | 3300006953 | Soil | QLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKRARDLWKRFG* |
| Ga0074063_101355452 | 3300006953 | Soil | QLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKLARDLWKRFG* |
| Ga0075419_102308482 | 3300006969 | Populus Rhizosphere | RPRQDDIVPLGPIALLAHRVTDGRVTSVGLRLAEDDAGPTTLATRLKKVARDLWARWG* |
| Ga0111539_134596442 | 3300009094 | Populus Rhizosphere | LGPIALVAHRVANGRLASVGLRLAQDEEPATLAAKLKKAARDLWSRLE* |
| Ga0105249_107511011 | 3300009553 | Switchgrass Rhizosphere | GPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKLARDLWKRFG* |
| Ga0126374_101290334 | 3300009792 | Tropical Forest Soil | VASIGLRLAEDEAPPATLPAKLKRAARDLWSRLG* |
| Ga0126313_114999441 | 3300009840 | Serpentine Soil | HRVASGRVTNVGVRLAEDDTPPATISGRIKKLARDLWKRFG* |
| Ga0126380_114591522 | 3300010043 | Tropical Forest Soil | VPLGPIALVAHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| Ga0126311_112724072 | 3300010045 | Serpentine Soil | ASGRVTNVGLRLAEDDTPPATISGRIKKLARDLWKRFG* |
| Ga0126384_115536622 | 3300010046 | Tropical Forest Soil | GRVASIGLRLAEDDAPPATLPAKLKRAARDLWSRLG* |
| Ga0126382_113414882 | 3300010047 | Tropical Forest Soil | PLGPIALVAHRVADGRLASVGLRLAQDEEPATLAAKLKKAARDLWSRLG* |
| Ga0126382_120673771 | 3300010047 | Tropical Forest Soil | LGPIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKRAARDLWSRLG* |
| Ga0126373_120031591 | 3300010048 | Tropical Forest Soil | PLGPIALVAHRVANGRLASVGLRLAQDEEPTTLAAKLKKAASDLWSRLG* |
| Ga0126372_120942001 | 3300010360 | Tropical Forest Soil | KQGDIVPLGPIAFVAHRVTGGRVVSIGLRLAEDDAPATLPAKLKKAARDLWSRLG* |
| Ga0126378_131127291 | 3300010361 | Tropical Forest Soil | KQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDVPATLPAKLKKAARDLWSRLG* |
| Ga0126379_104440781 | 3300010366 | Tropical Forest Soil | LVAHRVANGRLASVGLRLAQDEEPATLAAKLKKAARDLWARLG* |
| Ga0126379_112894202 | 3300010366 | Tropical Forest Soil | LGPIALVAHRVVNGRVTSVGLRLAEDEAPATLPAKLKKAARDLWSRLG* |
| Ga0126379_130642581 | 3300010366 | Tropical Forest Soil | PIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKKAARDLWSRLG* |
| Ga0126381_1018507121 | 3300010376 | Tropical Forest Soil | VPLGPIALVAHRVANGRVASIGLRLAEDEAPPATLPAKLKKAARDLWSRLG* |
| Ga0126383_112012072 | 3300010398 | Tropical Forest Soil | VPLGPIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKRAARDLWSRLG* |
| Ga0126383_115184832 | 3300010398 | Tropical Forest Soil | VPLGPIALVAHRVTGGRVASIGLRLAEDDAPPATLPAKLKKAVRDLWSRLG* |
| Ga0137364_102318093 | 3300012198 | Vadose Zone Soil | PLGPIALVAHRVTDGRLASVGLRLAQDEEPATLVAKVKKAARDLWARLG* |
| Ga0137383_112677391 | 3300012199 | Vadose Zone Soil | HRVVNGRVTSVGLRLAEEEVPATLPAKLKKAARDLWSRFG* |
| Ga0137382_100360874 | 3300012200 | Vadose Zone Soil | ALVAHRVTAGRLASVGLRLAQDEEPATLAAKLKKAARDLWARLG* |
| Ga0137365_112533422 | 3300012201 | Vadose Zone Soil | GAIALVAHRDTDGRLMSVGLRLAQDEEPPANLVAKLKKAARDLWTRLG* |
| Ga0137371_103767161 | 3300012356 | Vadose Zone Soil | HRVTEGRLASVGLRLAREEELPATLAAKIKKTARELWSRLG* |
| Ga0137385_114503891 | 3300012359 | Vadose Zone Soil | PLGPIALLAHQVVNGRVTSVGLRLPEDDEEPTTVMARLKQAARKLWKRIG* |
| Ga0134077_103210311 | 3300012972 | Grasslands Soil | VPLGPIALVAHRVTDGRLANVGLRLAQEEEPPATLAAKIKKTARELWSRLG* |
| Ga0163162_102757324 | 3300013306 | Switchgrass Rhizosphere | LVAHRVANGRLASVGLRLAQDEEPATLAAKLKKAARDLWSHLG* |
| Ga0157379_107811592 | 3300014968 | Switchgrass Rhizosphere | VVQLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKRARDLWKRFG* |
| Ga0173483_103029692 | 3300015077 | Soil | GPIALVAHRVADGRVSSVGLRLAEDDTPPATVSARLKKLARDLWRRFG* |
| Ga0132258_105636236 | 3300015371 | Arabidopsis Rhizosphere | LVAHRVADGRLASVGLRLAQDEEPATLAAKLKKAARDLWSRLG* |
| Ga0182032_104556963 | 3300016357 | Soil | PLGPIALVAHRVADGRLASVGLRLAEDEESPATLAAKIKKAVRDVWSFLG |
| Ga0182034_111786631 | 3300016371 | Soil | PIALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0193706_11034792 | 3300021339 | Soil | VASGRVTNVGLRLAEDDTPPATISGRIKKLARDLWKRFG |
| Ga0193695_10422571 | 3300021418 | Soil | VVQLGPIALVAHRVANGRVSSVGLRLAEDDAPPTTISGRLKKLAWDLWKRFG |
| Ga0210402_107677702 | 3300021478 | Soil | VVPLGPIALLVHQVTSGRVTSVGLRLPEDDEQPATTLARLKQVARNLWKRLG |
| Ga0207662_107589722 | 3300025918 | Switchgrass Rhizosphere | VAHRVADGRVSSVGLRLAEDDTPPATVSARLKKLARDLWRRFG |
| Ga0207711_110619212 | 3300025941 | Switchgrass Rhizosphere | VQLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKLARDLWKRFG |
| Ga0207689_103691841 | 3300025942 | Miscanthus Rhizosphere | ALVAHRVANGRLASVGLRLAQDEEPATLVAKLKKAARDLWSRLE |
| Ga0209801_11698093 | 3300026326 | Soil | ALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0208273_1020822 | 3300026846 | Soil | RVTSVGLRLAEDDTPPATISGRIKKVARDLWKRFG |
| Ga0208890_10284321 | 3300027523 | Soil | GPIALVAHRVANGRVSSVGLRLAEDDAPPTTMSGRLKKLASDLWKRFG |
| Ga0207862_12106361 | 3300027703 | Tropical Forest Soil | VVPLGPIALIAHRVTDGRVTSIGLRLAEEDVEPTTIVARLKKSVRDLWSAIG |
| Ga0209465_101836971 | 3300027874 | Tropical Forest Soil | ALVAHRVTGGRVASIGLRLAVDDAPATLPAKLKKAARDLWSRLG |
| Ga0209382_118616632 | 3300027909 | Populus Rhizosphere | PIALVAHRVANGRLASVGLRLAQDEEPATLAAKLKKAARDLWARWG |
| Ga0307293_101955132 | 3300028711 | Soil | RVTSVGLRLPEDDEEPATVVARLKKAARDLRKRLG |
| Ga0307285_101250751 | 3300028712 | Soil | QGDVVQLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGKIKKLARDLWKRFG |
| Ga0307285_102128901 | 3300028712 | Soil | VVQLGPIALVAHRVANGRVISVGLRLADDDAPPTTMSGRLKKLAWDLWKRFG |
| Ga0307309_100268641 | 3300028714 | Soil | DVVQLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGKIKKLARDLWKRFG |
| Ga0307320_104357812 | 3300028771 | Soil | ANGRVSSVGLRLADDDAPPTTMSGRLKKLAWDLWKRFG |
| Ga0307288_103415072 | 3300028778 | Soil | ASGRVTSVGLRLAEDDTPPATISGKIKKLARDLWKRFG |
| Ga0307304_104560021 | 3300028885 | Soil | LGPIALVAHRVANGRVSSVGLRLADDDAPPTTMSGRLKKLAWDLWKRFG |
| Ga0318541_100635885 | 3300031545 | Soil | LLSLAGSVASVGLRLAEDDAPATLPAKLKRAARDLWSRLG |
| Ga0318573_100561922 | 3300031564 | Soil | GDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAPATLAAKLKKAARDLWSRLG |
| Ga0310915_103355693 | 3300031573 | Soil | PKQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0318574_100794064 | 3300031680 | Soil | LGPIALVAHRVANGRITSVGLRLAEDDAPTTLPAKLKRAARDLWSRLG |
| Ga0318574_105153391 | 3300031680 | Soil | ASYLADELKRKPKQGDVMPLGPIALIAHRVTDGRVTSIGLRLAEEEIEPTTFVARLKKSMRDLWSVIG |
| Ga0306917_103126003 | 3300031719 | Soil | KQGDVVPLGPIALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0307469_109188071 | 3300031720 | Hardwood Forest Soil | GPIALLAHRVTDGRVTSVGLRLPEDDAEPTTLATRLKKAARDLWALWG |
| Ga0318501_100752134 | 3300031736 | Soil | PLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0318501_102138102 | 3300031736 | Soil | LGPIALVAHRVVNGRVTSVGLRLAEDEAPATLAAKLKKAARDLWSRLG |
| Ga0306918_101859854 | 3300031744 | Soil | LGPIALVAHRVANGRVTSVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0318502_102175351 | 3300031747 | Soil | KRRPKQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0318554_108036592 | 3300031765 | Soil | AIGPSGTIALLAHQVANGRVTSVGLRLPEDDEEPATAVARLKLGARKLWQHIK |
| Ga0318526_100562294 | 3300031769 | Soil | LVTRPIALVAHRVANGRVTNVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0318546_100684435 | 3300031771 | Soil | LGPIALVAHRVANGRVASVGLRLAEDDAPATLPAKLKRAARDLWSRLG |
| Ga0318552_100655502 | 3300031782 | Soil | AHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318548_100663804 | 3300031793 | Soil | VANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318576_100763994 | 3300031796 | Soil | HRVANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318576_101491881 | 3300031796 | Soil | GDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLMKAARDLWARLG |
| Ga0318523_101120533 | 3300031798 | Soil | QGDVVPLGPIALVTHRVANGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318523_103291032 | 3300031798 | Soil | IKHRPKQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARL |
| Ga0318564_101056183 | 3300031831 | Soil | KQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLW |
| Ga0306919_100323341 | 3300031879 | Soil | GRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318536_106331672 | 3300031893 | Soil | LVAHRVANGRVASVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318522_101240683 | 3300031894 | Soil | VPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0310912_107393461 | 3300031941 | Soil | HRPKQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0310916_111853272 | 3300031942 | Soil | LVAHRVVNGRVTSMGLRLAEDEAPATLPAKLKRVARDLWSRLG |
| Ga0306922_102070014 | 3300032001 | Soil | NGRVTSVGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0318507_100725254 | 3300032025 | Soil | DIVPLGPIALVAHRVTGGRVASIGLRLAEDDAQPATLPAKLKKAARDLWARLG |
| Ga0318549_100534284 | 3300032041 | Soil | PLGPIALVAHRVANGRVTNVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0318549_100599791 | 3300032041 | Soil | VPLGPIALVAHRVTGGRVASIGLRLAEDDAPATLAAKLKKAARDLWSRLG |
| Ga0318533_112295481 | 3300032059 | Soil | GTIALVAHRVTDGRASTIGLRLAGEEEKPASLVGKVKKTVHDLWSAFG |
| Ga0318510_100448582 | 3300032064 | Soil | KQGDIVPLGPIALVAHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| Ga0310890_101775352 | 3300032075 | Soil | VVQLGPIALVAHRMASGRVTSVGLRLAEDDTPPATISGRIKKLARDLWKRFG |
| Ga0318518_101651281 | 3300032090 | Soil | VADGRLASVGLRLAEDEESPATLAAKIKKAVRDVWSFLG |
| Ga0318577_101478503 | 3300032091 | Soil | NGRVTNVGLRLAEDDAPATLPAKLKKVARDLWSRLG |
| Ga0318519_100100464 | 3300033290 | Soil | IALVAHRVTGGRVASIGLRLAEDDAPATLPAKLKKAARDLWSRLG |
| ⦗Top⦘ |