


| Basic Information | |
|---|---|
| Family ID | F074641 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 78.99 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.319 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.370 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.81% β-sheet: 0.00% Coil/Unstructured: 44.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 11.76 |
| PF09721 | Exosortase_EpsH | 4.20 |
| PF00005 | ABC_tran | 1.68 |
| PF13650 | Asp_protease_2 | 1.68 |
| PF09723 | Zn-ribbon_8 | 1.68 |
| PF02518 | HATPase_c | 1.68 |
| PF05494 | MlaC | 1.68 |
| PF11066 | DUF2867 | 0.84 |
| PF00196 | GerE | 0.84 |
| PF09992 | NAGPA | 0.84 |
| PF01329 | Pterin_4a | 0.84 |
| PF01979 | Amidohydro_1 | 0.84 |
| PF02705 | K_trans | 0.84 |
| PF04226 | Transgly_assoc | 0.84 |
| PF00665 | rve | 0.84 |
| PF15780 | ASH | 0.84 |
| PF13174 | TPR_6 | 0.84 |
| PF09335 | SNARE_assoc | 0.84 |
| PF03958 | Secretin_N | 0.84 |
| PF00589 | Phage_integrase | 0.84 |
| PF07536 | HWE_HK | 0.84 |
| PF00355 | Rieske | 0.84 |
| PF12724 | Flavodoxin_5 | 0.84 |
| PF13551 | HTH_29 | 0.84 |
| PF00885 | DMRL_synthase | 0.84 |
| PF13486 | Dehalogenase | 0.84 |
| PF01381 | HTH_3 | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF13683 | rve_3 | 0.84 |
| PF02738 | MoCoBD_1 | 0.84 |
| PF08241 | Methyltransf_11 | 0.84 |
| PF01548 | DEDD_Tnp_IS110 | 0.84 |
| PF07690 | MFS_1 | 0.84 |
| PF07311 | Dodecin | 0.84 |
| PF00857 | Isochorismatase | 0.84 |
| PF04973 | NMN_transporter | 0.84 |
| PF03928 | HbpS-like | 0.84 |
| PF07963 | N_methyl | 0.84 |
| PF06826 | Asp-Al_Ex | 0.84 |
| PF03061 | 4HBT | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 11.76 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.84 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.84 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.84 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.84 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.84 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.84 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.84 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.84 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.84 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.84 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.84 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.84 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.84 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.84 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.84 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.32 % |
| Unclassified | root | N/A | 1.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005174|Ga0066680_10919968 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005177|Ga0066690_10011444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4573 | Open in IMG/M |
| 3300005177|Ga0066690_10146598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
| 3300005186|Ga0066676_10337799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1005 | Open in IMG/M |
| 3300005186|Ga0066676_10559194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300005332|Ga0066388_103001599 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005445|Ga0070708_100231875 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300005445|Ga0070708_100695191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 957 | Open in IMG/M |
| 3300005445|Ga0070708_100958698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 802 | Open in IMG/M |
| 3300005445|Ga0070708_101580803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300005467|Ga0070706_100149506 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300005471|Ga0070698_100094250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2973 | Open in IMG/M |
| 3300005471|Ga0070698_100106199 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300005471|Ga0070698_100279386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300005471|Ga0070698_100695844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300005471|Ga0070698_101962211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis orientalis | 538 | Open in IMG/M |
| 3300005518|Ga0070699_100833089 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005536|Ga0070697_100198141 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300005552|Ga0066701_10307737 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005557|Ga0066704_10447827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300005559|Ga0066700_10656037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300005764|Ga0066903_101273077 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300006049|Ga0075417_10023608 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300006796|Ga0066665_10264266 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300006797|Ga0066659_11191196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300006844|Ga0075428_100232506 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300006844|Ga0075428_101158886 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006844|Ga0075428_102519899 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006845|Ga0075421_100142839 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300006852|Ga0075433_10105373 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300006852|Ga0075433_11095732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 692 | Open in IMG/M |
| 3300006854|Ga0075425_101786328 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006871|Ga0075434_100826157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 942 | Open in IMG/M |
| 3300006904|Ga0075424_100090936 | All Organisms → cellular organisms → Bacteria | 3210 | Open in IMG/M |
| 3300006904|Ga0075424_102145377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300006969|Ga0075419_10862985 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300007076|Ga0075435_100644506 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300007076|Ga0075435_100694134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
| 3300007255|Ga0099791_10234244 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009012|Ga0066710_101991510 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300009100|Ga0075418_10586496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1199 | Open in IMG/M |
| 3300009137|Ga0066709_104207634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300009137|Ga0066709_104528089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300009147|Ga0114129_11374828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 872 | Open in IMG/M |
| 3300009147|Ga0114129_11700951 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009156|Ga0111538_11944345 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 740 | Open in IMG/M |
| 3300009162|Ga0075423_10363860 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300009792|Ga0126374_11425842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens | 565 | Open in IMG/M |
| 3300009799|Ga0105075_1064688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300009817|Ga0105062_1096381 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010043|Ga0126380_11668898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300010046|Ga0126384_10069863 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300010046|Ga0126384_10148999 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300010303|Ga0134082_10160511 | Not Available | 911 | Open in IMG/M |
| 3300010358|Ga0126370_11861969 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010359|Ga0126376_10098213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2225 | Open in IMG/M |
| 3300010359|Ga0126376_12264104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300010360|Ga0126372_12584235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300010360|Ga0126372_12618330 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010360|Ga0126372_12941032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300010398|Ga0126383_10644820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1134 | Open in IMG/M |
| 3300010403|Ga0134123_10313740 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300012189|Ga0137388_11674561 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300012203|Ga0137399_10340297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1245 | Open in IMG/M |
| 3300012205|Ga0137362_10005512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8734 | Open in IMG/M |
| 3300012205|Ga0137362_11056377 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012361|Ga0137360_10118882 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300012361|Ga0137360_10526064 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012362|Ga0137361_10064029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3087 | Open in IMG/M |
| 3300012922|Ga0137394_10747734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 821 | Open in IMG/M |
| 3300012929|Ga0137404_10755231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 882 | Open in IMG/M |
| 3300012929|Ga0137404_12027250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
| 3300012948|Ga0126375_10048457 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300012948|Ga0126375_10209586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1287 | Open in IMG/M |
| 3300012975|Ga0134110_10335218 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 659 | Open in IMG/M |
| 3300012977|Ga0134087_10764605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300015264|Ga0137403_10012561 | All Organisms → cellular organisms → Bacteria | 9283 | Open in IMG/M |
| 3300015374|Ga0132255_101759050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 941 | Open in IMG/M |
| 3300016422|Ga0182039_11625318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 590 | Open in IMG/M |
| 3300018468|Ga0066662_10042700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2818 | Open in IMG/M |
| 3300025907|Ga0207645_10909002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300025910|Ga0207684_10113828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2316 | Open in IMG/M |
| 3300025910|Ga0207684_10817270 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
| 3300026325|Ga0209152_10342771 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026326|Ga0209801_1202402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 794 | Open in IMG/M |
| 3300026332|Ga0209803_1342697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300026335|Ga0209804_1013013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4466 | Open in IMG/M |
| 3300026335|Ga0209804_1133949 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300026538|Ga0209056_10441821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300026552|Ga0209577_10209000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1494 | Open in IMG/M |
| 3300027655|Ga0209388_1090768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 878 | Open in IMG/M |
| 3300027748|Ga0209689_1012932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5418 | Open in IMG/M |
| 3300028381|Ga0268264_10847440 | Not Available | 915 | Open in IMG/M |
| 3300031544|Ga0318534_10003805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6845 | Open in IMG/M |
| 3300031544|Ga0318534_10041239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2563 | Open in IMG/M |
| 3300031680|Ga0318574_10139247 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300031720|Ga0307469_10186444 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300031720|Ga0307469_10194967 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300031720|Ga0307469_10302514 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300031720|Ga0307469_10619806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300031720|Ga0307469_12180380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300031747|Ga0318502_10580797 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300031770|Ga0318521_10874554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300031771|Ga0318546_10577281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 790 | Open in IMG/M |
| 3300031771|Ga0318546_10709057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 708 | Open in IMG/M |
| 3300031781|Ga0318547_10824735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300031820|Ga0307473_10500413 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031820|Ga0307473_11272359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300031910|Ga0306923_10101991 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300031910|Ga0306923_11190147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300031912|Ga0306921_10548886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1340 | Open in IMG/M |
| 3300031954|Ga0306926_10475278 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300032174|Ga0307470_10007518 | All Organisms → cellular organisms → Bacteria | 4359 | Open in IMG/M |
| 3300032180|Ga0307471_100097586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2653 | Open in IMG/M |
| 3300032180|Ga0307471_100316507 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300032180|Ga0307471_100551714 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300032180|Ga0307471_100622265 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300032205|Ga0307472_100060666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2413 | Open in IMG/M |
| 3300032205|Ga0307472_100613599 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.13% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 11.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066680_109199682 | 3300005174 | Soil | AQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066690_100114441 | 3300005177 | Soil | RKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS* |
| Ga0066690_101465982 | 3300005177 | Soil | KQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066676_103377993 | 3300005186 | Soil | QGKTAKQALVVVAVKLLHAVYAMLKHRQPFNPSRLLVAPAMIHT* |
| Ga0066676_105591941 | 3300005186 | Soil | QGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066388_1030015993 | 3300005332 | Tropical Forest Soil | ARGRALYQPKTAQGKTAKQALIVVAVKWLHTADAMLKHRIPYDPSCLAGMPATPST* |
| Ga0070708_1002318751 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS* |
| Ga0070708_1006951913 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KAKQALIVVAVKLLHTVYAMLKHRQPYNPSRLLVAPPTIGT* |
| Ga0070708_1009586981 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KAQGKPAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070708_1015808033 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLGAPATIGS* |
| Ga0070706_1001495061 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TIYLRKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070698_1000942501 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS* |
| Ga0070698_1001061991 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLIAPATIGS* |
| Ga0070698_1002793861 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070698_1006958442 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070698_1019622111 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IYLRKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070699_1008330892 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0070697_1001981411 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066701_103077371 | 3300005552 | Soil | VVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066704_104478273 | 3300005557 | Soil | QGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066700_106560372 | 3300005559 | Soil | TIYLRKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGS* |
| Ga0066903_1012730771 | 3300005764 | Tropical Forest Soil | VLVVVVVKLLHAVYAMLKHRQPYNPSRLLVAPATIRS* |
| Ga0075417_100236081 | 3300006049 | Populus Rhizosphere | KTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAAATIGS* |
| Ga0066665_102642661 | 3300006796 | Soil | VVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS* |
| Ga0066659_111911961 | 3300006797 | Soil | KTAKQALVVVAVKLPHAVYAMLKHRQPYNPSRLLVAPATIGT* |
| Ga0075428_1002325064 | 3300006844 | Populus Rhizosphere | AQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0075428_1011588863 | 3300006844 | Populus Rhizosphere | RAQGKSAKQALIVVAVKLLHTLYAMLKHRRPYNPSRLLVATATIGT* |
| Ga0075428_1025198991 | 3300006844 | Populus Rhizosphere | IVVAVKLLHTLYAMLKHRRPYNPSRLLVAAATIGT* |
| Ga0075421_1001428394 | 3300006845 | Populus Rhizosphere | MRAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAAATLGLDIS |
| Ga0075433_101053735 | 3300006852 | Populus Rhizosphere | GEWRTIYLRKKAQGKTAQQALVVVAVKLLHALYAMLKHRPPYNPSRLLVAPATIGS* |
| Ga0075433_110957321 | 3300006852 | Populus Rhizosphere | LVVVAVKLIHALYAMLKHRQPYNPSRLLVAPATIGT* |
| Ga0075425_1017863282 | 3300006854 | Populus Rhizosphere | YLRKKAQGKTAKQALVVVAVKLIHALYAMLKHRQPYNPSRLLVAPATIGT* |
| Ga0075434_1008261574 | 3300006871 | Populus Rhizosphere | YLRKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAAATIGS* |
| Ga0075424_1000909368 | 3300006904 | Populus Rhizosphere | AKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAAATIGS* |
| Ga0075424_1021453772 | 3300006904 | Populus Rhizosphere | YLRKKAQGKTAKQALIVVAVRLLHPLYAMLKHQQPYNPSRLLVAPATIRT* |
| Ga0075419_108629853 | 3300006969 | Populus Rhizosphere | AKQALIVVAVKLLHTLYAMLKHRRPYNPSRLLVATATIGT* |
| Ga0075435_1006445061 | 3300007076 | Populus Rhizosphere | TIYLRKKAQGKTAKQALVVVAVKLLHALYAMLKHRPPYNPSRLLVAPATIGS* |
| Ga0075435_1006941341 | 3300007076 | Populus Rhizosphere | MPKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0099791_102342441 | 3300007255 | Vadose Zone Soil | KQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT* |
| Ga0066710_1019915101 | 3300009012 | Grasslands Soil | KAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0075418_105864964 | 3300009100 | Populus Rhizosphere | VYLRKKAQGKTAKQAMVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066709_1042076341 | 3300009137 | Grasslands Soil | MTLRAKDARKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0066709_1045280891 | 3300009137 | Grasslands Soil | KKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0114129_113748281 | 3300009147 | Populus Rhizosphere | VVAVKLLHALYAMLKHRQPYNPSRLLVAAATIGS* |
| Ga0114129_117009512 | 3300009147 | Populus Rhizosphere | GKSAKQALIVVAVKLLHTLYAMLKHRRPYNPSRLLVATATIGT* |
| Ga0111538_119443451 | 3300009156 | Populus Rhizosphere | ALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPAKIRT* |
| Ga0075423_103638603 | 3300009162 | Populus Rhizosphere | IYLRKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPAPIGS* |
| Ga0126374_114258422 | 3300009792 | Tropical Forest Soil | AVAVKWLHTAYAMLKHRAPYDPSRLVATLATISP* |
| Ga0105075_10646882 | 3300009799 | Groundwater Sand | LVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT* |
| Ga0105062_10963811 | 3300009817 | Groundwater Sand | VVAGKLLHAIYAMLKHRQPYNPSRLLVAPLTIHT* |
| Ga0126380_116688982 | 3300010043 | Tropical Forest Soil | KTGKQALVVVAVKLLHAVYAMLKHRQPYNPFRLLVAPATITS* |
| Ga0126384_100698631 | 3300010046 | Tropical Forest Soil | IAVAVKWLHTAYAMLKHRAPYDPSRLVATLATISP* |
| Ga0126384_101489991 | 3300010046 | Tropical Forest Soil | QALVVVAVKLLHAVYAMLKNREPYNPSRLLVASATIGS* |
| Ga0134082_101605111 | 3300010303 | Grasslands Soil | KKAQGKTGKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT* |
| Ga0126370_118619691 | 3300010358 | Tropical Forest Soil | VVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGT* |
| Ga0126376_100982131 | 3300010359 | Tropical Forest Soil | VVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIRT* |
| Ga0126376_122641041 | 3300010359 | Tropical Forest Soil | QALVVVAVKLLHAVYAMLKHREPYNPSRLLVAPATMRT* |
| Ga0126372_125842352 | 3300010360 | Tropical Forest Soil | HGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSCLLVAPATIRS* |
| Ga0126372_126183301 | 3300010360 | Tropical Forest Soil | KTAQGKTAKQALIVVAVKWLHAAYAMLKHRIPYDPSRLADRP* |
| Ga0126372_129410322 | 3300010360 | Tropical Forest Soil | VVAVKLLHAVYAMLKHRQPYNPSRLLVAPATMGY* |
| Ga0126383_106448202 | 3300010398 | Tropical Forest Soil | VVAVKLLHALYAMLKHRQPYNPSRLLVAPATSRT* |
| Ga0134123_103137401 | 3300010403 | Terrestrial Soil | KAQGKSAKQALIVVAVKLLHTLYAMLKHRRPYNPSRLLVATATIGT* |
| Ga0137388_116745611 | 3300012189 | Vadose Zone Soil | ALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137399_103402972 | 3300012203 | Vadose Zone Soil | VVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137362_1000551211 | 3300012205 | Vadose Zone Soil | VVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137362_110563773 | 3300012205 | Vadose Zone Soil | GKPAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137360_101188825 | 3300012361 | Vadose Zone Soil | GKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137360_105260641 | 3300012361 | Vadose Zone Soil | GKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137361_100640291 | 3300012362 | Vadose Zone Soil | ALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0137394_107477341 | 3300012922 | Vadose Zone Soil | TGKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT* |
| Ga0137404_107552311 | 3300012929 | Vadose Zone Soil | KKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGT* |
| Ga0137404_120272502 | 3300012929 | Vadose Zone Soil | VVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT* |
| Ga0126375_100484571 | 3300012948 | Tropical Forest Soil | TIYLRKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0126375_102095861 | 3300012948 | Tropical Forest Soil | AKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIRT* |
| Ga0134110_103352182 | 3300012975 | Grasslands Soil | YLRKKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0134087_107646051 | 3300012977 | Grasslands Soil | KTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGS* |
| Ga0137403_1001256110 | 3300015264 | Vadose Zone Soil | RKKAQGKTGKQALVVVAVKLLHAVYAMLKHRQPSNPSRLLVASATIGT* |
| Ga0132255_1017590501 | 3300015374 | Arabidopsis Rhizosphere | LRKKAQGKTAKQALIVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS* |
| Ga0182039_116253181 | 3300016422 | Soil | RKKAQGKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVPPATIGT |
| Ga0066662_100427001 | 3300018468 | Grasslands Soil | RKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS |
| Ga0207645_109090022 | 3300025907 | Miscanthus Rhizosphere | QGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPTTMGS |
| Ga0207684_101138286 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS |
| Ga0207684_108172701 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0209152_103427711 | 3300026325 | Soil | TGKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT |
| Ga0209801_12024021 | 3300026326 | Soil | RKAQGKPAKQALVVVAVKLLHAVYAMLKHRQPCNPSRLLVAPARIGS |
| Ga0209803_13426972 | 3300026332 | Soil | KQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0209804_10130136 | 3300026335 | Soil | LRKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAAATIGS |
| Ga0209804_11339492 | 3300026335 | Soil | KQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0209056_104418211 | 3300026538 | Soil | QALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0209577_102090004 | 3300026552 | Soil | YLRKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVSPATIGS |
| Ga0209388_10907683 | 3300027655 | Vadose Zone Soil | VVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGT |
| Ga0209689_10129321 | 3300027748 | Soil | RKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPDNPSRLLVSPATIGS |
| Ga0268264_108474402 | 3300028381 | Switchgrass Rhizosphere | GKPAKQALIVVAVKLLHTLYAMLKHRRPYNPSRLLVAAATSGT |
| Ga0318534_100038051 | 3300031544 | Soil | QALVVVAVKLLHAVYAMLKHREPYNPSRLLVAPATIGT |
| Ga0318534_100412395 | 3300031544 | Soil | IYLRKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0318574_101392473 | 3300031680 | Soil | LRKKAQGKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVPPATIGT |
| Ga0307469_101864441 | 3300031720 | Hardwood Forest Soil | VVVAVKLLHAVYAMLKHREPYNPSRLLAAPATIGT |
| Ga0307469_101949673 | 3300031720 | Hardwood Forest Soil | KTGKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPMTMGS |
| Ga0307469_103025142 | 3300031720 | Hardwood Forest Soil | RKKAQGKTAKQALVVVAVKLLHALYAMLKHRQPYNPSRLLVASATIGT |
| Ga0307469_106198061 | 3300031720 | Hardwood Forest Soil | TAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0307469_121803801 | 3300031720 | Hardwood Forest Soil | KQALIVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIRS |
| Ga0318502_105807971 | 3300031747 | Soil | AQGKPAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0318521_108745541 | 3300031770 | Soil | ALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0318546_105772811 | 3300031771 | Soil | AQGKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVAPATIGT |
| Ga0318546_107090572 | 3300031771 | Soil | GKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVPPATIGT |
| Ga0318547_108247352 | 3300031781 | Soil | KAQGKTAKPALVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0307473_105004131 | 3300031820 | Hardwood Forest Soil | GQGKKPKQALIAVAVKWLHTAYAMLKHRAPYDPSRLVATLATISP |
| Ga0307473_112723592 | 3300031820 | Hardwood Forest Soil | GKTSKQALVVVAVKLLHAVYAMLKHREPYNPSRLLAAPATIGT |
| Ga0306923_101019911 | 3300031910 | Soil | KKAQGKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVAPATIGT |
| Ga0306923_111901471 | 3300031910 | Soil | VVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0306921_105488861 | 3300031912 | Soil | LVVVAVKLLHALYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0306926_104752781 | 3300031954 | Soil | LRKKAQGKTAKQALVVVAVKLLHAVYAMLKHREPYNPSRLLVAPATIGT |
| Ga0307470_100075185 | 3300032174 | Hardwood Forest Soil | QALVVVAVKLLHAVYAMLKHREPYNPSRLLAAPATIGS |
| Ga0307471_1000975865 | 3300032180 | Hardwood Forest Soil | VVVAVKLLHALYAMLKHRQPYNPSRLLVAPATTGS |
| Ga0307471_1003165071 | 3300032180 | Hardwood Forest Soil | KKAQGKPAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0307471_1005517141 | 3300032180 | Hardwood Forest Soil | QALVVVAVKLLHAVYAMLKHRQPYNPSRLLVASATIGS |
| Ga0307471_1006222653 | 3300032180 | Hardwood Forest Soil | GKTAKQALVVVAVKLLHAVYAMLKHRQPYYPSRLLVAPATIGS |
| Ga0307472_1000606661 | 3300032205 | Hardwood Forest Soil | KAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| Ga0307472_1006135993 | 3300032205 | Hardwood Forest Soil | KKAQGKTAKQALVVVAVKLLHAVYAMLKHRQPYNPSRLLVAPATIGS |
| ⦗Top⦘ |