


| Basic Information | |
|---|---|
| Family ID | F074627 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.68 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 91.60 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.513 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.891 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.74% β-sheet: 0.00% Coil/Unstructured: 80.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF02781 | G6PD_C | 10.92 |
| PF01878 | EVE | 8.40 |
| PF00378 | ECH_1 | 4.20 |
| PF01594 | AI-2E_transport | 4.20 |
| PF01979 | Amidohydro_1 | 3.36 |
| PF00892 | EamA | 3.36 |
| PF00528 | BPD_transp_1 | 3.36 |
| PF00072 | Response_reg | 1.68 |
| PF04392 | ABC_sub_bind | 1.68 |
| PF00293 | NUDIX | 1.68 |
| PF01243 | Putative_PNPOx | 1.68 |
| PF02720 | DUF222 | 1.68 |
| PF03150 | CCP_MauG | 1.68 |
| PF00005 | ABC_tran | 1.68 |
| PF04909 | Amidohydro_2 | 1.68 |
| PF00753 | Lactamase_B | 1.68 |
| PF01425 | Amidase | 1.68 |
| PF02826 | 2-Hacid_dh_C | 0.84 |
| PF03992 | ABM | 0.84 |
| PF03447 | NAD_binding_3 | 0.84 |
| PF07969 | Amidohydro_3 | 0.84 |
| PF00939 | Na_sulph_symp | 0.84 |
| PF12852 | Cupin_6 | 0.84 |
| PF00480 | ROK | 0.84 |
| PF01610 | DDE_Tnp_ISL3 | 0.84 |
| PF05544 | Pro_racemase | 0.84 |
| PF00881 | Nitroreductase | 0.84 |
| PF07732 | Cu-oxidase_3 | 0.84 |
| PF12833 | HTH_18 | 0.84 |
| PF02515 | CoA_transf_3 | 0.84 |
| PF07685 | GATase_3 | 0.84 |
| PF00106 | adh_short | 0.84 |
| PF02627 | CMD | 0.84 |
| PF13458 | Peripla_BP_6 | 0.84 |
| PF13561 | adh_short_C2 | 0.84 |
| PF07228 | SpoIIE | 0.84 |
| PF04542 | Sigma70_r2 | 0.84 |
| PF01738 | DLH | 0.84 |
| PF15919 | HicB_lk_antitox | 0.84 |
| PF07992 | Pyr_redox_2 | 0.84 |
| PF14319 | Zn_Tnp_IS91 | 0.84 |
| PF13302 | Acetyltransf_3 | 0.84 |
| PF13466 | STAS_2 | 0.84 |
| PF04187 | Cofac_haem_bdg | 0.84 |
| PF02954 | HTH_8 | 0.84 |
| PF01717 | Meth_synt_2 | 0.84 |
| PF01315 | Ald_Xan_dh_C | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 10.92 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 8.40 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 8.40 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 4.20 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.68 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.68 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.68 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.84 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.84 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.84 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.84 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.84 |
| COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 0.84 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.84 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.51 % |
| Unclassified | root | N/A | 18.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459017|G14TP7Y01A0PMV | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300004114|Ga0062593_100875095 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300004157|Ga0062590_100248912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1336 | Open in IMG/M |
| 3300004633|Ga0066395_10761482 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005174|Ga0066680_10429765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 836 | Open in IMG/M |
| 3300005175|Ga0066673_10020610 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
| 3300005179|Ga0066684_10312208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1046 | Open in IMG/M |
| 3300005181|Ga0066678_10527895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 784 | Open in IMG/M |
| 3300005186|Ga0066676_10145547 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300005186|Ga0066676_10342726 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005295|Ga0065707_10299667 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005330|Ga0070690_101665959 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005332|Ga0066388_100051160 | All Organisms → cellular organisms → Bacteria | 4245 | Open in IMG/M |
| 3300005332|Ga0066388_100939469 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005332|Ga0066388_102905898 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005332|Ga0066388_103801853 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005332|Ga0066388_106940738 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005332|Ga0066388_107622991 | Not Available | 543 | Open in IMG/M |
| 3300005353|Ga0070669_100466636 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005441|Ga0070700_100070684 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300005444|Ga0070694_101151402 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005450|Ga0066682_10097485 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300005454|Ga0066687_10391513 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005540|Ga0066697_10390285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 809 | Open in IMG/M |
| 3300005543|Ga0070672_100381778 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005546|Ga0070696_100843976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300005549|Ga0070704_100555856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1003 | Open in IMG/M |
| 3300005552|Ga0066701_10692187 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005553|Ga0066695_10436636 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005555|Ga0066692_10106247 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005555|Ga0066692_10548526 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005713|Ga0066905_100360001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1166 | Open in IMG/M |
| 3300005840|Ga0068870_10135033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300006049|Ga0075417_10420147 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006796|Ga0066665_10934485 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006844|Ga0075428_102336555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 550 | Open in IMG/M |
| 3300006845|Ga0075421_100601758 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300006847|Ga0075431_100517486 | Not Available | 1183 | Open in IMG/M |
| 3300006847|Ga0075431_101845090 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006852|Ga0075433_10881647 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300006853|Ga0075420_100383281 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300006854|Ga0075425_100223444 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300006871|Ga0075434_100924939 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300006871|Ga0075434_102410137 | Not Available | 528 | Open in IMG/M |
| 3300006903|Ga0075426_10235781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1331 | Open in IMG/M |
| 3300009038|Ga0099829_10285794 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300009090|Ga0099827_10603377 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009090|Ga0099827_11573864 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009090|Ga0099827_11596027 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009094|Ga0111539_12170258 | Not Available | 644 | Open in IMG/M |
| 3300009094|Ga0111539_13336483 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009137|Ga0066709_100035921 | All Organisms → cellular organisms → Bacteria | 5355 | Open in IMG/M |
| 3300009147|Ga0114129_10880093 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300009147|Ga0114129_12217862 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009553|Ga0105249_11039124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 889 | Open in IMG/M |
| 3300009792|Ga0126374_11157256 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010320|Ga0134109_10408887 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010360|Ga0126372_10888471 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010376|Ga0126381_100115845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3457 | Open in IMG/M |
| 3300010398|Ga0126383_10702421 | Not Available | 1090 | Open in IMG/M |
| 3300010399|Ga0134127_11541316 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010401|Ga0134121_12955150 | Not Available | 522 | Open in IMG/M |
| 3300011269|Ga0137392_10901329 | Not Available | 728 | Open in IMG/M |
| 3300012201|Ga0137365_10350342 | Not Available | 1091 | Open in IMG/M |
| 3300012205|Ga0137362_10388143 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012357|Ga0137384_10581620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 915 | Open in IMG/M |
| 3300012532|Ga0137373_10802551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
| 3300012685|Ga0137397_10092980 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300012918|Ga0137396_10340462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1110 | Open in IMG/M |
| 3300012929|Ga0137404_10294918 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300012929|Ga0137404_11606511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300012975|Ga0134110_10173367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 897 | Open in IMG/M |
| 3300012977|Ga0134087_10240390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 826 | Open in IMG/M |
| 3300013306|Ga0163162_10794132 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300013307|Ga0157372_12365227 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300014269|Ga0075302_1143071 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300015357|Ga0134072_10387699 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300015373|Ga0132257_104318729 | Not Available | 517 | Open in IMG/M |
| 3300016341|Ga0182035_11640859 | Not Available | 580 | Open in IMG/M |
| 3300017659|Ga0134083_10035989 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300017789|Ga0136617_10713921 | Not Available | 777 | Open in IMG/M |
| 3300018027|Ga0184605_10021097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2612 | Open in IMG/M |
| 3300018031|Ga0184634_10219177 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300018056|Ga0184623_10013022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3613 | Open in IMG/M |
| 3300019883|Ga0193725_1001995 | All Organisms → cellular organisms → Bacteria | 5908 | Open in IMG/M |
| 3300025908|Ga0207643_10104325 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300025911|Ga0207654_10136806 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300025917|Ga0207660_10237335 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300025934|Ga0207686_11384284 | Not Available | 579 | Open in IMG/M |
| 3300026088|Ga0207641_12531567 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026320|Ga0209131_1404863 | Not Available | 511 | Open in IMG/M |
| 3300026332|Ga0209803_1339453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300026334|Ga0209377_1106514 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300026358|Ga0257166_1062950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300027846|Ga0209180_10247601 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027882|Ga0209590_11066003 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028380|Ga0268265_12620798 | Not Available | 510 | Open in IMG/M |
| 3300028784|Ga0307282_10628191 | Not Available | 521 | Open in IMG/M |
| 3300031184|Ga0307499_10158406 | Not Available | 669 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10179943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 587 | Open in IMG/M |
| 3300031546|Ga0318538_10518721 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031681|Ga0318572_10212187 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300031720|Ga0307469_10214670 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300031720|Ga0307469_11952816 | Not Available | 569 | Open in IMG/M |
| 3300031731|Ga0307405_10483127 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031740|Ga0307468_101011219 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300031740|Ga0307468_101075938 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031740|Ga0307468_101446356 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300031771|Ga0318546_11123612 | Not Available | 552 | Open in IMG/M |
| 3300031846|Ga0318512_10086997 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300031912|Ga0306921_11693890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300031947|Ga0310909_10784577 | Not Available | 788 | Open in IMG/M |
| 3300032066|Ga0318514_10507107 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032066|Ga0318514_10588117 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300032075|Ga0310890_10276384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300032174|Ga0307470_10328928 | Not Available | 1050 | Open in IMG/M |
| 3300032180|Ga0307471_102725987 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032180|Ga0307471_103971450 | Not Available | 523 | Open in IMG/M |
| 3300033550|Ga0247829_10455190 | Not Available | 1057 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4ZMR_05007080 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | TRRQAFDDLVRWVEYGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLAPRR |
| Ga0062593_1008750952 | 3300004114 | Soil | TQQQAFDDLVAWIERGAKPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR* |
| Ga0062590_1002489121 | 3300004157 | Soil | QAFDDLVAWIERGVRPDGEDVLAPDLSRVGLKWTPYLHPEDPLAERR* |
| Ga0066395_107614821 | 3300004633 | Tropical Forest Soil | REQAFDDLVAWIERGVKPDGDDVLTADPSKLELRWTSILHHDDPARRR* |
| Ga0066680_104297651 | 3300005174 | Soil | EQAFDDLVAWVERGVRPVGEDVLAADLSRVGLKWTPNLHPEDPLALRR* |
| Ga0066673_100206101 | 3300005175 | Soil | REQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR* |
| Ga0066684_103122082 | 3300005179 | Soil | LLAWIERGVRPVGEDVLAPDLSRIGLKWTPTLQPEDPLALRR* |
| Ga0066678_105278951 | 3300005181 | Soil | DLVAWIERGVRPQGEDVLATDLSRIGLKWTLILHPQDPLAPRR* |
| Ga0066676_101455473 | 3300005186 | Soil | VREQAFDDLVAWVEGGARPDGDDVLAADISTLGLRWTSILHPEDPARRRTLPAR* |
| Ga0066676_103427261 | 3300005186 | Soil | REQAFDDLVAWMEKGIKPDGDDVLAPDVSTLGLRWTPLHHPEDPMQRR* |
| Ga0065707_102996671 | 3300005295 | Switchgrass Rhizosphere | RRQAFDDLVRWIEHGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLARRP* |
| Ga0070690_1016659592 | 3300005330 | Switchgrass Rhizosphere | FDDLVAWIERGVRPQGEDVLAPDLSRIGLTWTPILHLEDPLAARR* |
| Ga0066388_1000511604 | 3300005332 | Tropical Forest Soil | VRERAFDDLVGWIERAGVPPGDDVLASDVSTLGLRWTPALHPADPLAPRTR* |
| Ga0066388_1009394691 | 3300005332 | Tropical Forest Soil | TREQAFDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRKSSHK* |
| Ga0066388_1029058982 | 3300005332 | Tropical Forest Soil | FYAETRERTFDDLVAWVERGVKPQGEDVLARDLSGIGMKWTPILLADDPLFVKR* |
| Ga0066388_1038018532 | 3300005332 | Tropical Forest Soil | FDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRESSHK* |
| Ga0066388_1069407381 | 3300005332 | Tropical Forest Soil | MREQAFDDLVAWIERGVRPAGEDVLAADLSRIGLPWTPALHPEDPLALRR* |
| Ga0066388_1076229911 | 3300005332 | Tropical Forest Soil | AWIERGVRPKGEDILAPDLSRIGLEWTPALLLDDPLAATRKTP* |
| Ga0070669_1004666361 | 3300005353 | Switchgrass Rhizosphere | AFDDLVAWIERGVRPDGDDVLAPDLSRIGLKWTPHLLLEDPLAPRR* |
| Ga0070700_1000706841 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RQAFDDLVAWIERRIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR* |
| Ga0070694_1011514022 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AFDDLVAWIERGIRPDGEDVLAADLSRVGLKWTPYLHLEDPLAASR* |
| Ga0066682_100974851 | 3300005450 | Soil | REQAFDDLVAWVEGGARPDGDDVLAPDVSTLGLGRTPILHPEDPARRRTLPAR* |
| Ga0066687_103915132 | 3300005454 | Soil | GETREQAFDDLLAWIERGVRPVGEDVLAPDLSLIGLKWTPTLQPEDPLALRR* |
| Ga0066697_103902852 | 3300005540 | Soil | LVAWIERGVRPQGEDVLATDLSRIGLKWTPILHPTDPLAARR* |
| Ga0070672_1003817781 | 3300005543 | Miscanthus Rhizosphere | AFDDLVAWIERGVRPRGEDVLAPDLSRIGLTWTPILHLEDPLAVRR* |
| Ga0070696_1008439762 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEDLVAWIERGVVPAGDDVLAADVSRLGLRWTPALHPADPLAGSAR* |
| Ga0070704_1005558561 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | FDDLVAWIERGVRPQGEDVLARDLSRLGLTWTPILHPEDPLAPRR* |
| Ga0066701_106921872 | 3300005552 | Soil | REQAFDDLVAWVEGGARPDGDDVLAADMSTLGLRRTSILHPEDPARRRTLPAR* |
| Ga0066695_104366361 | 3300005553 | Soil | QAFDDLVAWIEHGVQPAGDDVLADDVSKLGLRWIPILHPDDPARRP* |
| Ga0066692_101062473 | 3300005555 | Soil | ERGVRPVGEDVLAPDLSRIGLRWTPSLHPEDPLALRR* |
| Ga0066692_105485261 | 3300005555 | Soil | QAFDDLVAWIEREKPEGDDVLAADVSTLGLRWTSILHSEDPARRREPPGGDGARAAA* |
| Ga0066905_1003600013 | 3300005713 | Tropical Forest Soil | AWIERGVRPAGEDVLAADLSRIGLKWTTILHPEDPLAARR* |
| Ga0068870_101350333 | 3300005840 | Miscanthus Rhizosphere | RGIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR* |
| Ga0075417_104201471 | 3300006049 | Populus Rhizosphere | MREQAFDDLVAWIERGARPVGEDVLAPDLSRIGLSWTPALHPEDPLALRR* |
| Ga0066665_109344851 | 3300006796 | Soil | REQAFDDLVAWIERGVRPVGEDVLARDLSRIGLRWTMSLHPEDPLALRR* |
| Ga0075428_1023365552 | 3300006844 | Populus Rhizosphere | ERGAKPEGEDVLAPDLSRIGLKWTPYLHTEDPLNPRR* |
| Ga0075421_1006017582 | 3300006845 | Populus Rhizosphere | ERGVRPTGEDVLAADLSRIGMPWTRVLLPDDPLAPRR* |
| Ga0075431_1005174861 | 3300006847 | Populus Rhizosphere | WMERGVRPAGEDVLAADLSRIGLKWTPSLYPEDPLALRR* |
| Ga0075431_1018450901 | 3300006847 | Populus Rhizosphere | RWIEQGARPAGDDVLARDLSRVGLRWTSIMYPDDPLFPRR* |
| Ga0075433_108816473 | 3300006852 | Populus Rhizosphere | REQAFDDLVRWIEGGSQPDGDDVLASDVSQIGLRWTPLLHVEDPLRQ* |
| Ga0075420_1003832811 | 3300006853 | Populus Rhizosphere | VAWIERGVKPEGEDVLAPDLSRIGLKWTPMLHVDDPLAPTR* |
| Ga0075425_1002234443 | 3300006854 | Populus Rhizosphere | DGVTLRQTFDDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLGPRR* |
| Ga0075434_1009249391 | 3300006871 | Populus Rhizosphere | EQAFDDLVAWIEKGTKPDGDDVLAPDVSTLGLRWTHIRHPEDPELRRKPARN* |
| Ga0075434_1024101372 | 3300006871 | Populus Rhizosphere | DDLVAWMERGVRPQGEDVLATDLSRIGLKWTPILHPEDPLAARR* |
| Ga0075426_102357814 | 3300006903 | Populus Rhizosphere | AFEDLVAWIERGVVPAGDDVLAPDVSRLGLRWTPALHPADPLAPATR* |
| Ga0099829_102857943 | 3300009038 | Vadose Zone Soil | EQAFDDLVAWMERGVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR* |
| Ga0099827_106033771 | 3300009090 | Vadose Zone Soil | GETREQAFDDLVAWIERGVRRAGEDVLAPDLSRIGLNWTPALRVEDPLITRW* |
| Ga0099827_115738641 | 3300009090 | Vadose Zone Soil | GVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR* |
| Ga0099827_115960272 | 3300009090 | Vadose Zone Soil | GVRPAGEDMLAPDLSRIGLKWTPTLHLEDPLTTRR* |
| Ga0111539_121702581 | 3300009094 | Populus Rhizosphere | ARPEGEDVLANDLSRIGLKWTPILHVDDPLAGRR* |
| Ga0111539_133364831 | 3300009094 | Populus Rhizosphere | AFDDLVAWIERGVRPPGEDVLAPDLSRIGLPWTPVLHLEDPLALRR* |
| Ga0066709_1000359217 | 3300009137 | Grasslands Soil | ERGVRPEGEDVLARDLSRIGLKWTRTLYPEDPLFRRQ* |
| Ga0114129_108800931 | 3300009147 | Populus Rhizosphere | TREQAFDDLVAWIERGVRPAGEDVLAPDLSRIGLKWTPILHPEDPLAARR* |
| Ga0114129_122178622 | 3300009147 | Populus Rhizosphere | VAWIERGARPDGEDVLARDLSRIGLKWTPVLLLEDPLAAPR* |
| Ga0105249_110391241 | 3300009553 | Switchgrass Rhizosphere | DGDTRRQAFDDLVAWVERGVRPQGEDVLAPDLSRIGMAWTRALHLDDPLFTRPGAGSSSAPR* |
| Ga0126374_111572562 | 3300009792 | Tropical Forest Soil | EQAFDDLVAWMEQGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRESSHK* |
| Ga0134109_104088871 | 3300010320 | Grasslands Soil | EQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR* |
| Ga0126372_108884713 | 3300010360 | Tropical Forest Soil | VEHGVRPDGEDVLAPDLSRIGLKWTPYLDPGDPLAPRR* |
| Ga0126381_1001158455 | 3300010376 | Tropical Forest Soil | ETREQAFDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHAEDPARGRESSPK* |
| Ga0126383_107024212 | 3300010398 | Tropical Forest Soil | FDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLEDPLFQRR* |
| Ga0134127_115413161 | 3300010399 | Terrestrial Soil | QAFDDLVAWIERGIRPDGEDLLAADLSRIGLKWTPYLHPDDPLAARR* |
| Ga0134121_129551502 | 3300010401 | Terrestrial Soil | VVRGPGHCATDGVTLRQTFDDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLAPRR* |
| Ga0137392_109013292 | 3300011269 | Vadose Zone Soil | EVREQAFDDLVRWIEGGAQPDGDDVLASDVSQIGLRWTPLLHVEDPLRQ* |
| Ga0137365_103503421 | 3300012201 | Vadose Zone Soil | ERGVRPAGDDVLAADLSRVGLTWTPILYPGDPLAPRR* |
| Ga0137362_103881431 | 3300012205 | Vadose Zone Soil | IDRGVRPDGEDVLASDLSRVGLKWTPYLHPEDPLAARR* |
| Ga0137384_105816202 | 3300012357 | Vadose Zone Soil | VREQAFDDLVAWVEGGARPDGDDVLAADVSTLGLLRTSILHPEDPARRRTAPAR* |
| Ga0137373_108025511 | 3300012532 | Vadose Zone Soil | VREQAFDDLVAWVEGGARPDGDDVLAADVSTLGLRRTSILHPEDPARRRTAPAR* |
| Ga0137397_100929803 | 3300012685 | Vadose Zone Soil | LVAWIERGVRPQGEDVLARDLSRIGLAWPLALDPDDPLAGKPR* |
| Ga0137396_103404622 | 3300012918 | Vadose Zone Soil | VRPAGEDVLARDLSRIGLAWTLALHPDDPLAGQRR* |
| Ga0137404_102949181 | 3300012929 | Vadose Zone Soil | TTRQQAFDDLVGWIERGIRPQGEDVLAPDLSRIGLKWTPILHLEDPLAVRR* |
| Ga0137404_116065111 | 3300012929 | Vadose Zone Soil | MREQAFDDLVAWMEKGIKPDGDDVLAPDVSTLGLRWTPLRHPEDPVQRREPSRQ* |
| Ga0134110_101733671 | 3300012975 | Grasslands Soil | REQAFDDLLAWIERGVRPVGEDVLAPDLSRIGLKWTPNLQPEDPLALRR* |
| Ga0134087_102403901 | 3300012977 | Grasslands Soil | DLLAWIERGVRPVGEDVLAPDLSRIGLKWTPTLQPEDPLALRR* |
| Ga0163162_107941321 | 3300013306 | Switchgrass Rhizosphere | LVAWIERGVRPVGEDVLAPDLSRIGLAYTPALFLEDPLAPRR* |
| Ga0157372_123652272 | 3300013307 | Corn Rhizosphere | RWVEHGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLAPRR* |
| Ga0075302_11430712 | 3300014269 | Natural And Restored Wetlands | DLVAWIERGVRPQGEDVLAPDQSRIGLQWTPILFPEDPLAARRPR* |
| Ga0134072_103876991 | 3300015357 | Grasslands Soil | TREQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPDDPLAPRR* |
| Ga0132257_1043187291 | 3300015373 | Arabidopsis Rhizosphere | KGEDVLAPDLSRIGLEWTPALMLDDPLAATRKAP* |
| Ga0182035_116408592 | 3300016341 | Soil | GSHCGFDGEMREQAFDDIVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR |
| Ga0134083_100359891 | 3300017659 | Grasslands Soil | VREQAFDDLVAWVEGGARPDGDDVLAPDVSPLGLRRTPIIHPEDPARRRTPPKR |
| Ga0136617_107139212 | 3300017789 | Polar Desert Sand | FDDLVAWMERGIVPEGDDVLASDLTTLGLLWTTPLLPEDPAGQ |
| Ga0184605_100210971 | 3300018027 | Groundwater Sediment | GFDGKTREQAFDDLVGWIEGGVRPVGEDVLAPNLSRIGLKWTPVLHLEDPLAARR |
| Ga0184634_102191772 | 3300018031 | Groundwater Sediment | DGKTREQAFDDLDAWIERGVRPQGEDVLAPDLSRIGLRWTPVLHLEDPLAARR |
| Ga0184623_100130226 | 3300018056 | Groundwater Sediment | GVRSQGEDVLAPDLSRIGLTWTPILHLEDPLAVRR |
| Ga0193725_100199511 | 3300019883 | Soil | DDLVAWIERGVRPQGEDVLAPDLSRIGLKWTPALHPEDPLAPRRSSSRP |
| Ga0207643_101043254 | 3300025908 | Miscanthus Rhizosphere | ERGIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR |
| Ga0207654_101368061 | 3300025911 | Corn Rhizosphere | AFDDLVVWIERGVRPKGEDVLAPDLSRIGLEWTPALMLDDPLAATRKAP |
| Ga0207660_102373352 | 3300025917 | Corn Rhizosphere | ERGVRPRGEDVLAPDLSRIGLTWTPILHLEDPLAARR |
| Ga0207686_113842842 | 3300025934 | Miscanthus Rhizosphere | VRPKGEDVLAPDLSRVGLEWTPTLLLDDPLAATRKKP |
| Ga0207641_125315672 | 3300026088 | Switchgrass Rhizosphere | DDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLAPRR |
| Ga0209131_14048632 | 3300026320 | Grasslands Soil | AFDDLVGWIERGIRPQGEDVLAPDLSRIGLKWTPILHLEDPLAVRR |
| Ga0209803_13394531 | 3300026332 | Soil | GETREQAFDDLLAWIERGVRPVGEDVLAPDLSRIGLKWTPNLQPEDPLALRR |
| Ga0209377_11065142 | 3300026334 | Soil | RGVRPVGEDVLAPDLSRIGLRWTPSLHPEDPLALRR |
| Ga0257166_10629502 | 3300026358 | Soil | ERGVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR |
| Ga0209180_102476012 | 3300027846 | Vadose Zone Soil | QAFDDLVAWIERGVRPAGEDVLAPDLSRIGLKWTPALHLEDPLTTRR |
| Ga0209590_110660031 | 3300027882 | Vadose Zone Soil | GETREQAFDDLVAWIERGVRRAGEDVLAPDLSRIGLNWTPALRVEDPLIMRR |
| Ga0268265_126207982 | 3300028380 | Switchgrass Rhizosphere | LVAWIERGVRPQGDDVLASDLSRIGMKWTPVLDADDPLAPRR |
| Ga0307282_106281912 | 3300028784 | Soil | VDRGTRTQAFDDLVAWIERGVRPDGEDLLATDLSRIGLKWTPYLHPEDPLAARR |
| Ga0307499_101584061 | 3300031184 | Soil | QTQQQAFDDLVAWIERGAKPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR |
| (restricted) Ga0255310_101799431 | 3300031197 | Sandy Soil | REQAFDDLVAWIERGVRPDGEDVLANDLTRIGLRWTPVFHVEDPLAPRR |
| Ga0318538_105187211 | 3300031546 | Soil | AWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR |
| Ga0318572_102121872 | 3300031681 | Soil | EQAFDDLVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR |
| Ga0307469_102146703 | 3300031720 | Hardwood Forest Soil | GETRERAFDDLVAWIERGMRPDGDDVLARDLSRVGLKWTRTLYPEDPLFRRP |
| Ga0307469_119528161 | 3300031720 | Hardwood Forest Soil | GHCAFDGATIAQAFDDLIAWIERGVRPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR |
| Ga0307405_104831272 | 3300031731 | Rhizosphere | VDGVTRRQAFDDLVAWIERGVQPAGEDVLAHDLSRVGLQWTPLLHPEDPLARKP |
| Ga0307468_1010112192 | 3300031740 | Hardwood Forest Soil | GSTRRQAFDDLVAWIERGVRPDGEDVLAPDLSRVGLKWTPYLHLEDPLAARR |
| Ga0307468_1010759381 | 3300031740 | Hardwood Forest Soil | DDLVAWMERGVRPAGEDVLAADLSRVGLKWTLSLHPEDPLALRR |
| Ga0307468_1014463562 | 3300031740 | Hardwood Forest Soil | DLVAWIERGTRPVGEDVLAPDLSRIGLGWTLSLHPEDPLALRR |
| Ga0318546_111236121 | 3300031771 | Soil | AVQAQAFDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR |
| Ga0318512_100869973 | 3300031846 | Soil | DDLVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR |
| Ga0306921_116938902 | 3300031912 | Soil | GVKPAGEDVLATDLSRIGLKWTPVLDLDDPLAPRR |
| Ga0310909_107845772 | 3300031947 | Soil | AQAFDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR |
| Ga0318514_105071072 | 3300032066 | Soil | LVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR |
| Ga0318514_105881171 | 3300032066 | Soil | AWIERGVKPAGEDVLATDLSRIGLKWTPVLDLDDPLAPRR |
| Ga0310890_102763842 | 3300032075 | Soil | RRSFDDLVAWIERGARPDGEDVLARDLSRIGLKWTPVLLLEDPLAAPR |
| Ga0307470_103289282 | 3300032174 | Hardwood Forest Soil | GVRPQGDDVLASDLSRIGMRWTPVLDPDDPLAPRR |
| Ga0307471_1027259872 | 3300032180 | Hardwood Forest Soil | AWMERGEKPEGEDLLASDLSRVGMKWTPILDPEDPLAPKR |
| Ga0307471_1039714501 | 3300032180 | Hardwood Forest Soil | DLVAWIERGVRPQGDDVLASDLSRIGMKWTPVLDVDDPLAPRR |
| Ga0247829_104551901 | 3300033550 | Soil | AFDDLVAWIERGVRPDGEDVLAADLSRVGLKWTPYLHPEDPLAARR |
| ⦗Top⦘ |