


| Basic Information | |
|---|---|
| Family ID | F074595 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 47 residues |
| Representative Sequence | KEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.69 % |
| % of genes near scaffold ends (potentially truncated) | 91.60 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.555 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (26.891 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.58% β-sheet: 27.27% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 6.72 |
| PF02371 | Transposase_20 | 3.36 |
| PF00589 | Phage_integrase | 2.52 |
| PF16901 | DAO_C | 2.52 |
| PF03358 | FMN_red | 2.52 |
| PF08207 | EFP_N | 1.68 |
| PF02073 | Peptidase_M29 | 1.68 |
| PF08308 | PEGA | 1.68 |
| PF14534 | DUF4440 | 1.68 |
| PF00069 | Pkinase | 1.68 |
| PF05960 | DUF885 | 1.68 |
| PF09285 | Elong-fact-P_C | 1.68 |
| PF07884 | VKOR | 0.84 |
| PF01638 | HxlR | 0.84 |
| PF00692 | dUTPase | 0.84 |
| PF01799 | Fer2_2 | 0.84 |
| PF14329 | DUF4386 | 0.84 |
| PF13520 | AA_permease_2 | 0.84 |
| PF00999 | Na_H_Exchanger | 0.84 |
| PF01256 | Carb_kinase | 0.84 |
| PF03979 | Sigma70_r1_1 | 0.84 |
| PF06675 | DUF1177 | 0.84 |
| PF08241 | Methyltransf_11 | 0.84 |
| PF07508 | Recombinase | 0.84 |
| PF02899 | Phage_int_SAM_1 | 0.84 |
| PF08530 | PepX_C | 0.84 |
| PF03009 | GDPD | 0.84 |
| PF00072 | Response_reg | 0.84 |
| PF00106 | adh_short | 0.84 |
| PF02627 | CMD | 0.84 |
| PF00581 | Rhodanese | 0.84 |
| PF01979 | Amidohydro_1 | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| PF13602 | ADH_zinc_N_2 | 0.84 |
| PF03853 | YjeF_N | 0.84 |
| PF07978 | NIPSNAP | 0.84 |
| PF04191 | PEMT | 0.84 |
| PF08388 | GIIM | 0.84 |
| PF00230 | MIP | 0.84 |
| PF01435 | Peptidase_M48 | 0.84 |
| PF02742 | Fe_dep_repr_C | 0.84 |
| PF00266 | Aminotran_5 | 0.84 |
| PF17179 | Fer4_22 | 0.84 |
| PF00005 | ABC_tran | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.72 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.36 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 1.68 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 1.68 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.68 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.84 |
| COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.84 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.84 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.84 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.84 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.84 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.84 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.84 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.84 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.84 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.84 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.84 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.84 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.84 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.84 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.55 % |
| Unclassified | root | N/A | 13.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10029605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3227 | Open in IMG/M |
| 3300000567|JGI12270J11330_10071898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
| 3300000731|JGI12381J11899_1002224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1519 | Open in IMG/M |
| 3300000734|JGI12535J11911_1007944 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300004091|Ga0062387_101044122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis decaplanina | 629 | Open in IMG/M |
| 3300005180|Ga0066685_10455979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300005327|Ga0070658_11366903 | Not Available | 615 | Open in IMG/M |
| 3300005332|Ga0066388_105425341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300005334|Ga0068869_100838672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300005468|Ga0070707_101363454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300005530|Ga0070679_101733714 | Not Available | 573 | Open in IMG/M |
| 3300005577|Ga0068857_102226425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005829|Ga0074479_10287984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300006059|Ga0075017_101491640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300006086|Ga0075019_10538803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300006800|Ga0066660_11364664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300006864|Ga0066797_1027161 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300006930|Ga0079303_10330071 | Not Available | 635 | Open in IMG/M |
| 3300007076|Ga0075435_100054795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3219 | Open in IMG/M |
| 3300009029|Ga0066793_10734734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300009038|Ga0099829_11561315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300009137|Ga0066709_100448095 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300009137|Ga0066709_102420214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300009174|Ga0105241_11143511 | Not Available | 735 | Open in IMG/M |
| 3300009520|Ga0116214_1095648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1091 | Open in IMG/M |
| 3300009522|Ga0116218_1026185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2606 | Open in IMG/M |
| 3300009522|Ga0116218_1040856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2098 | Open in IMG/M |
| 3300009523|Ga0116221_1135652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300009523|Ga0116221_1489637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300009524|Ga0116225_1544472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300009524|Ga0116225_1563596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300009545|Ga0105237_12747187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009683|Ga0116224_10103970 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300009698|Ga0116216_10934315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009700|Ga0116217_10267274 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300009824|Ga0116219_10001174 | All Organisms → cellular organisms → Bacteria | 25011 | Open in IMG/M |
| 3300009824|Ga0116219_10715751 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009839|Ga0116223_10115510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300009839|Ga0116223_10241120 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010360|Ga0126372_10071175 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300010376|Ga0126381_101811673 | Not Available | 881 | Open in IMG/M |
| 3300010376|Ga0126381_102189218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 795 | Open in IMG/M |
| 3300010379|Ga0136449_100316995 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300010379|Ga0136449_100713210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1679 | Open in IMG/M |
| 3300010379|Ga0136449_100906190 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300010379|Ga0136449_100978808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300010379|Ga0136449_101154986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
| 3300010379|Ga0136449_104459796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010398|Ga0126383_11600103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300012202|Ga0137363_10001874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12319 | Open in IMG/M |
| 3300012206|Ga0137380_10961700 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012211|Ga0137377_10548489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 1094 | Open in IMG/M |
| 3300012349|Ga0137387_10676561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300012353|Ga0137367_10506259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300012354|Ga0137366_10744665 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012356|Ga0137371_10987938 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012361|Ga0137360_10283328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1371 | Open in IMG/M |
| 3300012906|Ga0157295_10368516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 526 | Open in IMG/M |
| 3300012917|Ga0137395_10149008 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300013296|Ga0157374_10512870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
| 3300013308|Ga0157375_11950433 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300014164|Ga0181532_10043906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2991 | Open in IMG/M |
| 3300014165|Ga0181523_10103375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Blackallbacteria → bacterium (Candidatus Blackallbacteria) CG17_big_fil_post_rev_8_21_14_2_50_48_46 | 1709 | Open in IMG/M |
| 3300014165|Ga0181523_10688889 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300014167|Ga0181528_10049486 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300014325|Ga0163163_12401700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300016270|Ga0182036_11292652 | Not Available | 608 | Open in IMG/M |
| 3300016357|Ga0182032_11202787 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300016387|Ga0182040_10455421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300016422|Ga0182039_10679559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300017821|Ga0187812_1074751 | Not Available | 1121 | Open in IMG/M |
| 3300017823|Ga0187818_10165759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300017932|Ga0187814_10159685 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300017943|Ga0187819_10045202 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300017943|Ga0187819_10171719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300017943|Ga0187819_10214148 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300018086|Ga0187769_10938891 | Not Available | 655 | Open in IMG/M |
| 3300019789|Ga0137408_1378667 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300020170|Ga0179594_10085662 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300021420|Ga0210394_11339937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 610 | Open in IMG/M |
| 3300021560|Ga0126371_12148701 | Not Available | 673 | Open in IMG/M |
| 3300025903|Ga0207680_11236441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 532 | Open in IMG/M |
| 3300025911|Ga0207654_10487464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 869 | Open in IMG/M |
| 3300025921|Ga0207652_11377403 | Not Available | 609 | Open in IMG/M |
| 3300025922|Ga0207646_11829265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300025944|Ga0207661_10477784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300026034|Ga0208773_1028283 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300026538|Ga0209056_10395772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300026540|Ga0209376_1200357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300026542|Ga0209805_1086821 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300026548|Ga0209161_10049549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 2755 | Open in IMG/M |
| 3300026823|Ga0207759_103239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300026908|Ga0207787_1009077 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300027000|Ga0207803_1009276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
| 3300027570|Ga0208043_1196679 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027641|Ga0208827_1075691 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300027696|Ga0208696_1114157 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300027703|Ga0207862_1244052 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027783|Ga0209448_10231545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300027854|Ga0209517_10084311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2196 | Open in IMG/M |
| 3300027905|Ga0209415_10367629 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300030494|Ga0310037_10058844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300030707|Ga0310038_10364430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031573|Ga0310915_10437241 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300032001|Ga0306922_11655391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300032035|Ga0310911_10118795 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300032160|Ga0311301_10251580 | All Organisms → cellular organisms → Bacteria | 2913 | Open in IMG/M |
| 3300032160|Ga0311301_11066163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300032160|Ga0311301_11140920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300032180|Ga0307471_100789071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300032205|Ga0307472_100453622 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300032261|Ga0306920_101869349 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300033289|Ga0310914_10272529 | Not Available | 1524 | Open in IMG/M |
| 3300033289|Ga0310914_10771612 | Not Available | 859 | Open in IMG/M |
| 3300033408|Ga0316605_10730495 | Not Available | 936 | Open in IMG/M |
| 3300033475|Ga0310811_11299317 | Not Available | 580 | Open in IMG/M |
| 3300033513|Ga0316628_100799586 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 26.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.20% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.84% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100296054 | 3300000567 | Peatlands Soil | VKFKEGNEAREIGTRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| JGI12270J11330_100718981 | 3300000567 | Peatlands Soil | VKFKEGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT* |
| JGI12381J11899_10022242 | 3300000731 | Tropical Forest Soil | LVVIKEQDKWQIVAFQNTKVSEVPAAAQAAARLAS* |
| JGI12535J11911_10079442 | 3300000734 | Tropical Forest Soil | VKFTEGNEPREIETRPTLVVIKEQDKWQIVAFQNTKVSEVPAAAQAAARLAS* |
| Ga0062387_1010441221 | 3300004091 | Bog Forest Soil | ARANVKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0062592_1002531123 | 3300004480 | Soil | FYEGNETRELETRPTLILVKQQGAWQVVTFQNTRISEMPREAAANRLAT* |
| Ga0066685_104559791 | 3300005180 | Soil | REIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0070658_113669031 | 3300005327 | Corn Rhizosphere | EIETRPTLIVARQGAEWKIVAFQNTKISAVPVAAQAAARLAT* |
| Ga0066388_1054253411 | 3300005332 | Tropical Forest Soil | AGAHVKFKENNEPREIETRPTLIAVKEQANWQIVAFQNTKVSEVPMPAQAAARLAT* |
| Ga0068869_1008386721 | 3300005334 | Miscanthus Rhizosphere | QVNFHEGKEAREIKTRPTLIVVKQEATWQIVAFQNTKISEVPTAAQAAARLAT* |
| Ga0070707_1013634542 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EARQLETRPTLIVAKEQDKWQIVAFQNTKISEVPVAAQAAARLAS* |
| Ga0070679_1017337141 | 3300005530 | Corn Rhizosphere | HVKYYEGDETREMDARPTFIVVKEREKWRIVAFQNTKMSEMPSAAQAASRLAS* |
| Ga0070684_1014660831 | 3300005535 | Corn Rhizosphere | EMDARPTFIVVKEQEKWRIVAFQNTKMSEMPSAAQAASRLAS* |
| Ga0068857_1022264251 | 3300005577 | Corn Rhizosphere | AHVKYYEGDETHEMDARPTFIVVKEQEKWRIVAFQNTKMSEMPSAAQAASRLAS* |
| Ga0074479_102879843 | 3300005829 | Sediment (Intertidal) | KFKEGNEAREFETRPTLIVVKEPDKWQIVTFQNTRISEVPAAAEGAARLAT* |
| Ga0075017_1014916402 | 3300006059 | Watersheds | PTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0075019_105388032 | 3300006086 | Watersheds | PTLIVVREQDNWQIVAFQNTKISKVPAAAQAAARLAT* |
| Ga0066660_113646642 | 3300006800 | Soil | VKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPA |
| Ga0066797_10271611 | 3300006864 | Soil | IETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0079303_103300711 | 3300006930 | Deep Subsurface | ETRPTLIVAKEQTKWQIVTFQNTKISEVPPAAQDAARLAT* |
| Ga0075435_1000547958 | 3300007076 | Populus Rhizosphere | TLVVVQEQDKWQIVAFQNTKISEVPAAAEGAARLAT* |
| Ga0066793_107347341 | 3300009029 | Prmafrost Soil | ETREIETRPTLIVVKQQANWQIVAFQNTKISEVPTAAQAAARLAT* |
| Ga0099829_115613151 | 3300009038 | Vadose Zone Soil | CHVKFKEGNEAREIETSPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0066709_1004480951 | 3300009137 | Grasslands Soil | NEAHEIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0066709_1024202142 | 3300009137 | Grasslands Soil | VKFKEGKEIETRPTLIVVKEQSKWHVVAFQNTKISEVPAAAQAAARLAT* |
| Ga0105241_111435111 | 3300009174 | Corn Rhizosphere | AQVNFHEGTEAREIETRPTLIVARQGAEWKIVAFQNTKISAVPVAAQAAARLAT* |
| Ga0116214_10956482 | 3300009520 | Peatlands Soil | EIETRPTLIVVKDQDKWQIVTFQNTKISEVPAAAQAAARLAT* |
| Ga0116218_10261851 | 3300009522 | Peatlands Soil | TRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0116218_10408564 | 3300009522 | Peatlands Soil | VVFARCHVKFKEGNEPREIETRPTLTIVKEQGKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0116221_11356521 | 3300009523 | Peatlands Soil | VKFKEGNEAREIGTRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAAR |
| Ga0116221_14896371 | 3300009523 | Peatlands Soil | TRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAT* |
| Ga0116225_15444721 | 3300009524 | Peatlands Soil | EGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAARLAT* |
| Ga0116225_15635961 | 3300009524 | Peatlands Soil | EGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT* |
| Ga0105237_127471871 | 3300009545 | Corn Rhizosphere | AIVFSQAQLNFHEGKEAREIKTRPTLIVVKQEATWQIVAFQNTKISEVPTAAQAAARLAT |
| Ga0116224_101039701 | 3300009683 | Peatlands Soil | REIETRPTLIVVKEQDKWQIVAFQNTKVSEVPAAAQAAARLAT* |
| Ga0116216_109343151 | 3300009698 | Peatlands Soil | VKFKEGNDAREIETRPTLIVVKDQDKWQIVTFQNTKISEVPAAAQAAARLAT* |
| Ga0116217_102672743 | 3300009700 | Peatlands Soil | IVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0116219_1000117429 | 3300009824 | Peatlands Soil | VKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0116219_107157511 | 3300009824 | Peatlands Soil | FKEGNEAREIETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAS* |
| Ga0116223_101155102 | 3300009839 | Peatlands Soil | DLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT* |
| Ga0116223_102411203 | 3300009839 | Peatlands Soil | DLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAARLAT* |
| Ga0126372_100711753 | 3300010360 | Tropical Forest Soil | VKFKEGNETRELETRPTLIVVKEIVAVQNTKITEVPAAAQGAARLAT* |
| Ga0126381_1018116732 | 3300010376 | Tropical Forest Soil | RAHVKFKEGNEAREIETRPTLVAPKEQEKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0126381_1021892181 | 3300010376 | Tropical Forest Soil | EGNEGREQETRPTLIVVKEQDRWQIVAFQNTRISEVPTAAQAAARLAT* |
| Ga0136449_1003169954 | 3300010379 | Peatlands Soil | RMHVKFKEGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAS* |
| Ga0136449_1007132103 | 3300010379 | Peatlands Soil | TRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT* |
| Ga0136449_1009061901 | 3300010379 | Peatlands Soil | PTLIAVKEQDKWQIVAFQNTRISEVPAAAQAAARLAT* |
| Ga0136449_1009788082 | 3300010379 | Peatlands Soil | VVFARAHVKFKEGNEAREIETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAT* |
| Ga0136449_1011549861 | 3300010379 | Peatlands Soil | FARAHVKFKEGNEAREIETRPTLIVAKEQDKWQVVTFQNTKISEVPAAAQAAARLAT* |
| Ga0136449_1044597962 | 3300010379 | Peatlands Soil | LIAVKEQDKWQIVAFQNTRISEVPAAAQAAARLAT* |
| Ga0126383_116001032 | 3300010398 | Tropical Forest Soil | AREIETRPTLVVVKEQAKWQVVAFQNTKVSEVPTAAQAAGRLAT* |
| Ga0137363_1000187410 | 3300012202 | Vadose Zone Soil | LIVVKEQDKWQIVAFQNTKISEVPVAAQAAARLAT* |
| Ga0137380_109617002 | 3300012206 | Vadose Zone Soil | LIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0137377_105484891 | 3300012211 | Vadose Zone Soil | VKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAVRLAT* |
| Ga0137387_106765611 | 3300012349 | Vadose Zone Soil | TLIVVKEQAKWQIVAFQNTKISEVPSAAQAAARLAT* |
| Ga0137367_105062591 | 3300012353 | Vadose Zone Soil | ARAHVKFKENNETREIETRPTLIVVKEQAKWQIVAFQNTRISEVPTAAQDAARLAT* |
| Ga0137366_107446651 | 3300012354 | Vadose Zone Soil | NNETREIETRPTLIVVKEQAKWQIVAFQNTKISEVPTAAQDAARLAT* |
| Ga0137371_109879381 | 3300012356 | Vadose Zone Soil | TLIVVKEQSKWQVVAFQNTKISEVPAAAQAAAHLVT* |
| Ga0137360_102833283 | 3300012361 | Vadose Zone Soil | LIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLTT* |
| Ga0157295_103685161 | 3300012906 | Soil | RELETRPTLILVKQQGAWQVVTFQNTRISEMPREAAANRLAT* |
| Ga0137395_101490083 | 3300012917 | Vadose Zone Soil | VKFKEGNAAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0157374_105128703 | 3300013296 | Miscanthus Rhizosphere | VKFKEGDEAREIDTRPTLVVLKEQDKWQIVAFQNTKISEVPAAAQDAARLGS* |
| Ga0157375_119504331 | 3300013308 | Miscanthus Rhizosphere | REMDTRPTLILVQEEGSWQIAALQNTRVSDMPSAAQAAARLAT* |
| Ga0181532_100439063 | 3300014164 | Bog | EIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0181523_101033753 | 3300014165 | Bog | RANVKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0181523_106888891 | 3300014165 | Bog | KEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0181528_100494862 | 3300014167 | Bog | ANVKFKESNEVREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT* |
| Ga0163163_124017002 | 3300014325 | Switchgrass Rhizosphere | AQVNFHEGKEAREIKTRPTLIVQKQGEAWKIVAFQNTKISEVPTAAQAAARLAT* |
| Ga0182036_112926521 | 3300016270 | Soil | RAHVKFKEGNEAREIETRPTLVALKEQEKWQIAAFQNTKISEVPAAAQGAARLAT |
| Ga0182032_112027871 | 3300016357 | Soil | IETRPTLVVVKEQAKWQVVAFQNTKVSEVPTAAQAAARLAT |
| Ga0182040_104554211 | 3300016387 | Soil | AARVKEQDNWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0182039_106795591 | 3300016422 | Soil | ASSSTTPAARVKEQDNWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0187812_10747511 | 3300017821 | Freshwater Sediment | VKFKEGNDAREIETRPTLIVAKEQDKWQIVAFQNTRISEVPAAAQAAARLAT |
| Ga0187818_101657591 | 3300017823 | Freshwater Sediment | ETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT |
| Ga0187814_101596851 | 3300017932 | Freshwater Sediment | HVKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKVSEVPAAAQAAARLAT |
| Ga0187819_100452025 | 3300017943 | Freshwater Sediment | VKFKEGNEAREIETRPTLIVVKEQGKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0187819_101717191 | 3300017943 | Freshwater Sediment | TRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0187819_102141482 | 3300017943 | Freshwater Sediment | GNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGTARLAT |
| Ga0187769_109388912 | 3300018086 | Tropical Peatland | DFDEGNETRELETRPTLVMAKQQAQWQIAALQNTKISEVPPAAQDAARLAT |
| Ga0137408_13786673 | 3300019789 | Vadose Zone Soil | VKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0179594_100856621 | 3300020170 | Vadose Zone Soil | KEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0210394_113399371 | 3300021420 | Soil | AVAFARARVKFMEGNEPREIETRPTMVVVKENGSWQIVAFQNTRVSEVPAAAQAAARLAT |
| Ga0126371_121487012 | 3300021560 | Tropical Forest Soil | IETRPTLIVIKEQDKWQIVTFQNTKISEVPAAAQAAARLAS |
| Ga0207680_112364411 | 3300025903 | Switchgrass Rhizosphere | LEMDTRPTFIMAKEPAGWQIVAFQNTRISEMPAAAQAASRLAT |
| Ga0207654_104874643 | 3300025911 | Corn Rhizosphere | ETRPTLIVARQGAEWKIVAFQNTKISAVPVAAQAAARLAT |
| Ga0207652_113774031 | 3300025921 | Corn Rhizosphere | RAQVNFHEGTEAREIETRPTLIVARQGAEWKIVAFQNTKISAVPVAAQAAARLAT |
| Ga0207646_118292651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KEGNEARQLETRPTLIVAKEQDKWQIVAFQNTKISEVPVAAQAAARLAS |
| Ga0207661_104777841 | 3300025944 | Corn Rhizosphere | IVFSRAQVNFQEGKEAREIETRPTLIVAKQEATWQIVAFQNTKISDVPTAAQAAARLAT |
| Ga0208773_10282832 | 3300026034 | Rice Paddy Soil | KFYEVNEAREIDTRPTLIMVKEEGNWHIVALQNTRISEVPAAAQNASRLAS |
| Ga0209056_103957722 | 3300026538 | Soil | SRAHVKFKEGNETREIETRPTLIVAKEQSNWQIVAFQNTRISDVPAAAQAAARLAS |
| Ga0209376_12003571 | 3300026540 | Soil | KEGNEPREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0209805_10868212 | 3300026542 | Soil | TLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0209161_100495494 | 3300026548 | Soil | AHVKFKEGNEAREIETRPTLTVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0207759_1032391 | 3300026823 | Tropical Forest Soil | PTLVVIKEQDKWQIVAFQNTKVSEVPAAAQAAARLAS |
| Ga0207787_10090771 | 3300026908 | Tropical Forest Soil | EPREIETRPTLVVIKEQDKWQIVAFQNTKVSEVPAAAQAAARLAS |
| Ga0207803_10092761 | 3300027000 | Tropical Forest Soil | TEGNEPREIETRPTLVVIKEQDKWQIVAFQNTKVSEVPAAAQAAARLAS |
| Ga0208043_11966792 | 3300027570 | Peatlands Soil | RPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0208827_10756913 | 3300027641 | Peatlands Soil | VAQVKFKEGNEAREMQTRPTLVVVKEQDKWQIVAFQNTKVSEVPAAAQAAARLAT |
| Ga0208696_11141571 | 3300027696 | Peatlands Soil | AREMQTRPTLVVVKEQDKWQIVAFQNTKVSEVPAAAQAAARLAT |
| Ga0207862_12440521 | 3300027703 | Tropical Forest Soil | KVEENNETREMETRPTLIVVKEEAKWEIVAFKNTKISEVPTAAQAAARLAT |
| Ga0209448_102315451 | 3300027783 | Bog Forest Soil | FKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0209517_100843112 | 3300027854 | Peatlands Soil | EARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAARLAT |
| Ga0209415_103676293 | 3300027905 | Peatlands Soil | EGNEAREMQTRPTLVVVKEQDKWQIVAFQNTKVSEVPAAAQAAARLAT |
| Ga0310037_100588442 | 3300030494 | Peatlands Soil | VKFKEGNEAREIGTRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0310038_103644301 | 3300030707 | Peatlands Soil | KEGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQGAARLAT |
| Ga0310915_104372412 | 3300031573 | Soil | MREMETRPTLIVVKEQAKSQIVAFQNTKISEVPTAAQAAARLAT |
| Ga0306922_116553911 | 3300032001 | Soil | VKFKEGNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAEAAARLAN |
| Ga0310911_101187953 | 3300032035 | Soil | ENSEMREIETRPTLIVVKEQAKWQIVAFQNTKISEVPTAAQAAARLAT |
| Ga0311301_102515801 | 3300032160 | Peatlands Soil | FARMHVKFKEGNEARDLETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAS |
| Ga0311301_110661631 | 3300032160 | Peatlands Soil | VVFARAHVKFKEGNEAREIETRPTLIVVKEQDKWQIVTFQNTKISEVPAAAQAAARLAT |
| Ga0311301_111409201 | 3300032160 | Peatlands Soil | FARAHVKFKEGNEAREIETRPTLIVAKEQDKWQVVTFQNTKISEVPAAAQAAARLAT |
| Ga0307471_1007890712 | 3300032180 | Hardwood Forest Soil | GNEAREIETRPTLIVVKEQDKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0307472_1004536221 | 3300032205 | Hardwood Forest Soil | VKFKEGNEGREIETRPTLIVVKENGKWQIVAFQNTKISEVPAAAQAAARLAT |
| Ga0306920_1018693491 | 3300032261 | Soil | KFTENNEARKIDTRPTLVVVKEQAKWQIVAFQNTKISEVPSAAQAAARLAT |
| Ga0310914_102725291 | 3300033289 | Soil | LVAPKEQEKWQIVAFQNTKISEVPAAAQPAARLAT |
| Ga0310914_107716122 | 3300033289 | Soil | AHVKFKENSEMREIETRPTLMVVKEQAKWQIVTFQNTKISEVPTAAQAASRLAT |
| Ga0316605_107304951 | 3300033408 | Soil | EKDPRAIETRPTLIVAKEQTKWQIVTFQNTKISEVPPAAQDAARLAT |
| Ga0310811_112993172 | 3300033475 | Soil | VKYYEGDETREMDARPTFIVVKEREKWRIVAFQNTKMSEMPSAAQAASRLAS |
| Ga0316628_1007995861 | 3300033513 | Soil | RPTLIVVKEQAKWQIVTFQNTRISEVPPAAQEAARLAT |
| ⦗Top⦘ |