


| Basic Information | |
|---|---|
| Family ID | F074564 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 45 residues |
| Representative Sequence | NLGQVAFVNSVIQPIATSWSNWSHDPNALEGARLQLGQQLHQLSPP |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 79.83 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.277 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (57.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.420 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.983 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13738 | Pyr_redox_3 | 11.76 |
| PF07992 | Pyr_redox_2 | 8.40 |
| PF01261 | AP_endonuc_2 | 1.68 |
| PF03575 | Peptidase_S51 | 1.68 |
| PF13313 | DUF4082 | 1.68 |
| PF01522 | Polysacc_deac_1 | 0.84 |
| PF13320 | DUF4091 | 0.84 |
| PF12729 | 4HB_MCP_1 | 0.84 |
| PF00535 | Glycos_transf_2 | 0.84 |
| PF07238 | PilZ | 0.84 |
| PF16657 | Malt_amylase_C | 0.84 |
| PF04542 | Sigma70_r2 | 0.84 |
| PF10944 | DUF2630 | 0.84 |
| PF00990 | GGDEF | 0.84 |
| PF02357 | NusG | 0.84 |
| PF13927 | Ig_3 | 0.84 |
| PF02786 | CPSase_L_D2 | 0.84 |
| PF02481 | DNA_processg_A | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.68 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.84 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.84 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.84 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.84 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.28 % |
| Unclassified | root | N/A | 6.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10220903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300001661|JGI12053J15887_10614008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101763506 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300002907|JGI25613J43889_10071553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300005437|Ga0070710_11301790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005541|Ga0070733_10849633 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005542|Ga0070732_10991983 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005586|Ga0066691_10431828 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005587|Ga0066654_10206629 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300006162|Ga0075030_100203119 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300006804|Ga0079221_10032323 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300006806|Ga0079220_10160028 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300007255|Ga0099791_10030495 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300007255|Ga0099791_10480495 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300007258|Ga0099793_10023214 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300007258|Ga0099793_10236847 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300007265|Ga0099794_10339148 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300007265|Ga0099794_10489411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300007265|Ga0099794_10561468 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300007788|Ga0099795_10659018 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009088|Ga0099830_10577749 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300009090|Ga0099827_11849106 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010159|Ga0099796_10399480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010360|Ga0126372_12773249 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010362|Ga0126377_12623267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300010376|Ga0126381_100402772 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300010398|Ga0126383_12535056 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300011269|Ga0137392_11272376 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012096|Ga0137389_10426210 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300012096|Ga0137389_10855123 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012189|Ga0137388_11285049 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012189|Ga0137388_11302124 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012199|Ga0137383_10583088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300012200|Ga0137382_10960420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012202|Ga0137363_10027047 | All Organisms → cellular organisms → Bacteria | 3921 | Open in IMG/M |
| 3300012202|Ga0137363_10209001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300012202|Ga0137363_10435747 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300012202|Ga0137363_10980112 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012205|Ga0137362_10894627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300012208|Ga0137376_10423685 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300012209|Ga0137379_11147856 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012351|Ga0137386_10159634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
| 3300012357|Ga0137384_11286247 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012359|Ga0137385_10540464 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300012363|Ga0137390_11265734 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012582|Ga0137358_10031840 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
| 3300012683|Ga0137398_10019895 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300012683|Ga0137398_10604119 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012685|Ga0137397_10025441 | All Organisms → cellular organisms → Bacteria | 4191 | Open in IMG/M |
| 3300012685|Ga0137397_10233360 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300012923|Ga0137359_10004781 | All Organisms → cellular organisms → Bacteria | 11131 | Open in IMG/M |
| 3300012923|Ga0137359_10697494 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012923|Ga0137359_11333961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300012924|Ga0137413_10124533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
| 3300012924|Ga0137413_11635198 | Not Available | 527 | Open in IMG/M |
| 3300012925|Ga0137419_10672593 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012925|Ga0137419_10895631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300012925|Ga0137419_11261292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300012929|Ga0137404_10000560 | All Organisms → cellular organisms → Bacteria | 24327 | Open in IMG/M |
| 3300012929|Ga0137404_11550811 | Not Available | 614 | Open in IMG/M |
| 3300012929|Ga0137404_11571372 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012930|Ga0137407_12033764 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012944|Ga0137410_10324601 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300012944|Ga0137410_10700624 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300015052|Ga0137411_1296755 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300015054|Ga0137420_1124881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300015054|Ga0137420_1132952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
| 3300015054|Ga0137420_1178028 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300015241|Ga0137418_10000643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 31434 | Open in IMG/M |
| 3300015241|Ga0137418_10003198 | All Organisms → cellular organisms → Bacteria | 15066 | Open in IMG/M |
| 3300015242|Ga0137412_10039511 | All Organisms → cellular organisms → Bacteria | 3854 | Open in IMG/M |
| 3300015242|Ga0137412_10228949 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300015264|Ga0137403_10992338 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300020170|Ga0179594_10161274 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300020199|Ga0179592_10053717 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300020579|Ga0210407_10411912 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300021046|Ga0215015_10512822 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
| 3300021086|Ga0179596_10096154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300021170|Ga0210400_10028737 | All Organisms → cellular organisms → Bacteria | 4316 | Open in IMG/M |
| 3300021170|Ga0210400_10218550 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300021170|Ga0210400_10302870 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300021180|Ga0210396_10654289 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300021432|Ga0210384_10499910 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300021475|Ga0210392_10396049 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300022528|Ga0242669_1085284 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300024251|Ga0247679_1001879 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300024288|Ga0179589_10415834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300024330|Ga0137417_1001412 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300024330|Ga0137417_1141054 | Not Available | 1156 | Open in IMG/M |
| 3300024330|Ga0137417_1240691 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300024330|Ga0137417_1451919 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300024331|Ga0247668_1031793 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026285|Ga0209438_1006671 | All Organisms → cellular organisms → Bacteria | 3903 | Open in IMG/M |
| 3300026285|Ga0209438_1094776 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300026328|Ga0209802_1321966 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026355|Ga0257149_1063839 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026515|Ga0257158_1033914 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300026515|Ga0257158_1048994 | Not Available | 777 | Open in IMG/M |
| 3300026538|Ga0209056_10090300 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
| 3300026557|Ga0179587_10795483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300027603|Ga0209331_1066147 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300027616|Ga0209106_1030454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300027645|Ga0209117_1190538 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027669|Ga0208981_1005015 | All Organisms → cellular organisms → Bacteria | 3273 | Open in IMG/M |
| 3300027674|Ga0209118_1029430 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300027678|Ga0209011_1011851 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300027857|Ga0209166_10528764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300027911|Ga0209698_10249956 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300028536|Ga0137415_10032492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 5131 | Open in IMG/M |
| 3300030991|Ga0073994_10076246 | Not Available | 736 | Open in IMG/M |
| 3300031715|Ga0307476_10402196 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031720|Ga0307469_11004946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300031740|Ga0307468_102251186 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031754|Ga0307475_11227885 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031823|Ga0307478_11809700 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031962|Ga0307479_12003766 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 57.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102209032 | 3300001593 | Forest Soil | ISVVDTTLLPIATSWSNWNHSPKALENARTQLGQLLHQLAPSGL* |
| JGI12053J15887_106140081 | 3300001661 | Forest Soil | ANSAIQPIAASWSNWSHDPNALESARLQLGQQLNLLSPP* |
| JGIcombinedJ26739_1017635061 | 3300002245 | Forest Soil | FANSTLQPIARNWSNWSHDQNALEGARLQLGRKLNQLCPP* |
| JGI25613J43889_100715532 | 3300002907 | Grasslands Soil | KNLGQAAFANSVIQPIATSWTHWTHDPNALTAARMQLGQKLNQLSLHM* |
| Ga0070710_113017902 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AQILHNLGQDSFVNSTILPLATSWTKWKNDAAALENARLQLGQMLNQLSPP* |
| Ga0070733_108496332 | 3300005541 | Surface Soil | EYAQMLKNLGQLGVVDSTLLPIATSWSNWSHDPNALQNARTALGQLLHQLAP* |
| Ga0070732_109919831 | 3300005542 | Surface Soil | KNLGQVPLVNSILQPIGVSWSNWSHDPNALEGARQQLGQQLHLLAP* |
| Ga0066691_104318281 | 3300005586 | Soil | FVNSTILPIAASWNNWSHDPNALEAARLQLGQKLNQLSPP* |
| Ga0066654_102066291 | 3300005587 | Soil | GQSNFLNAVIQPIATSWTNWSQNPSALENARLQLGQQLNKLSPP* |
| Ga0075030_1002031193 | 3300006162 | Watersheds | VVDSTLLPIATSWSNWNHDPNALQNARTQLGQLLHQLAP* |
| Ga0079221_100323231 | 3300006804 | Agricultural Soil | DFVNSVIQPIATSWINWSHDPAALEDARLQLGQQLNRLSPP* |
| Ga0079220_101600281 | 3300006806 | Agricultural Soil | QDYEYAHKLNSLGQPSLLNSAVAPIATSWTSWTHDPNALENARQQLGQLLHQLAP* |
| Ga0099791_100304951 | 3300007255 | Vadose Zone Soil | IIVPIATSWSNWNHNPNALEAARLQLGQQLHLLAP* |
| Ga0099791_104804952 | 3300007255 | Vadose Zone Soil | IIVPIATSWSNWSHDPNALEAARLHLGQQLHLLAP* |
| Ga0099793_100232144 | 3300007258 | Vadose Zone Soil | GQLSVVDSTVLPIAGSWSNWKRDPNALQNARATLGQLLHQLAP* |
| Ga0099793_102368471 | 3300007258 | Vadose Zone Soil | VNSTVLPIAASWNNWSRDPNALEAVRLQLGQLLHQLAP* |
| Ga0099794_103391481 | 3300007265 | Vadose Zone Soil | YVQILKNLGQVSFVDPIIVPIATSFTNWTHNPSALENARQQLGQQLHLLHP* |
| Ga0099794_104894112 | 3300007265 | Vadose Zone Soil | YAQILKNLGQVPFVNSAILPIATSWSNWSHDPNALEGARLQLGQQLNQLSPP* |
| Ga0099794_105614682 | 3300007265 | Vadose Zone Soil | SIIVPIATSWSNWNHDPNALEAARLQLGQRLHQLSPP* |
| Ga0099795_106590182 | 3300007788 | Vadose Zone Soil | KNVGQVPFVNSTILPIATSWSNWSHDPNALEAARLQLGQKLNQLSPP* |
| Ga0099830_105777492 | 3300009088 | Vadose Zone Soil | DYEYAKILTNLGQVAFTYSIIMPIATSWTNWSNDPNVLERARLQLGQQLHQLSPP* |
| Ga0099827_118491062 | 3300009090 | Vadose Zone Soil | QILKNVGQVPFVNSTILPIATSWSNWSHDPNALEAARQQLGQKLNQLSPP* |
| Ga0099796_103994802 | 3300010159 | Vadose Zone Soil | EYAHMLKNLAQLPVLDAAILPIATSWTNWSHDPTALQNVRAQLGQLLHHLAP* |
| Ga0126372_127732491 | 3300010360 | Tropical Forest Soil | YVNSVIVPIATSWTNWSHDPTSLENGRQQLGQQLHQLSPP* |
| Ga0126377_126232671 | 3300010362 | Tropical Forest Soil | ILENLGQGAFLNSVFSPIATSWTNWTHDTSALENARLQLGQQLNNLSPP* |
| Ga0126381_1004027721 | 3300010376 | Tropical Forest Soil | ILKNQGQLTFLNLIVVPIATSWTNWTHSTTTLENVRQQLGQQLHLLAPPGF* |
| Ga0126381_1022250672 | 3300010376 | Tropical Forest Soil | LPIAGNWTNWTHDPKALEDARMQLGQELNQLSAP* |
| Ga0126381_1027977381 | 3300010376 | Tropical Forest Soil | LPIAGNWTNWTHDPKALEDARMQLGQELNQLSHP* |
| Ga0126383_125350561 | 3300010398 | Tropical Forest Soil | QSNFLNSVIQPIATSWINWSQDPGALENARLQLGQQLHKLSPP* |
| Ga0137392_112723761 | 3300011269 | Vadose Zone Soil | VPIAASWSNWSHNPTALEAARLQLGQQLHQLAPPGL* |
| Ga0137389_104262101 | 3300012096 | Vadose Zone Soil | LGQVPFVNSIIVPIASSWSNWSQDPNALEGARLQLGQQLHQLAPPGL* |
| Ga0137389_108551231 | 3300012096 | Vadose Zone Soil | GQVPFVNSIVQPIATSWSNWSHDPNALEGARLKLGQQLHQLSTP* |
| Ga0137388_112850492 | 3300012189 | Vadose Zone Soil | AQILKNLAQVPFVNSVLQTIAASWSNWSHDPNALEAARLQLGQLLHQLAP* |
| Ga0137388_113021241 | 3300012189 | Vadose Zone Soil | NLGQIPFVNSVLQSIATSWTNWSHDPNALEGARLQLGQLLHQLSPP* |
| Ga0137383_105830881 | 3300012199 | Vadose Zone Soil | DYEYAQILKNLGQIPFLNIAILPIATSWSNWSHDLNALESVRLQLGQLLSQLSPP* |
| Ga0137382_109604201 | 3300012200 | Vadose Zone Soil | LGQVAFANSTIQPIATSWSNWSHDPNALENARLQLGQQLNLLSPP* |
| Ga0137363_100270471 | 3300012202 | Vadose Zone Soil | NLGQVAFVNSVIQPIATSWSNWSHDPNALEGARLQLGQQLHQLSPP* |
| Ga0137363_102090014 | 3300012202 | Vadose Zone Soil | YEYAQILRNLGQDAFVNSTIQPLATSWTNWKNDPNAMESARIQLGQMLNQLSPP* |
| Ga0137363_104357471 | 3300012202 | Vadose Zone Soil | PLVNSIIVPIATSWSNWNHNPNALEAARLQLGQQLHLLAP* |
| Ga0137363_109801121 | 3300012202 | Vadose Zone Soil | ILKNLGQVGLVNSILQPIATSWSNWSHDPSALENARLQLGRQLSQLSPQ* |
| Ga0137362_108946271 | 3300012205 | Vadose Zone Soil | LPVLDAAILPIATSWTNWSHDPNALQNARKQLGQLLHQLAP* |
| Ga0137376_104236851 | 3300012208 | Vadose Zone Soil | VPSLNIAILPIATSWSNWSHDPNALEGARQQLGQLLHQLSPP* |
| Ga0137379_111478562 | 3300012209 | Vadose Zone Soil | VNSVLQPIAASWSNWSHDPNALEGARLQLGQLLHQLAP* |
| Ga0137386_101596341 | 3300012351 | Vadose Zone Soil | YAQILKNLGQISLVNSIVPPIATNWANWSHDPDALESARLQLGQLLNQLSPP* |
| Ga0137384_112862472 | 3300012357 | Vadose Zone Soil | LGQTSFTSSVIQTIATSWNNWTHYPSALQTARDQLGQLLNQLSPP* |
| Ga0137385_105404641 | 3300012359 | Vadose Zone Soil | LKNLGQLTFLDPIILPIATNWTNWSHSPTTLEGARLQLGQQLNLLAPPGF* |
| Ga0137390_112657341 | 3300012363 | Vadose Zone Soil | AFVNPIIQPIAASWSNWNHNPNALEGARLQLGQQLHQLGP* |
| Ga0137358_100318404 | 3300012582 | Vadose Zone Soil | IVPIATSWSNWNHNPNALEAARLQLGQQLHLLAP* |
| Ga0137398_100198954 | 3300012683 | Vadose Zone Soil | LSPVPIVNSILQPVATSWSNWSHDPNALEAARLQLGQRLNVLFNH* |
| Ga0137398_106041191 | 3300012683 | Vadose Zone Soil | NLGQAAFVNSVIQPIATSWSNWTHDPNTLEGARLQLGQQLHQLSPP* |
| Ga0137397_100254415 | 3300012685 | Vadose Zone Soil | KNLGQLNVVNTHLLPIAASWSNWSRDPNTLENARLQLGQLLHQLAP* |
| Ga0137397_102333602 | 3300012685 | Vadose Zone Soil | AQILKNLGRISTVDTALLPIAGSWSNWSHDPNALQNARTQLGQLLHQLAP* |
| Ga0137359_1000478110 | 3300012923 | Vadose Zone Soil | LSILNTAITPVAGSWTSWTKDPNALESARQQLGQLLHQLAP* |
| Ga0137359_106974941 | 3300012923 | Vadose Zone Soil | LNVVNTNLLPIAGSWSNWSHDPNALESARQQLGQLLHQLAP* |
| Ga0137359_113339612 | 3300012923 | Vadose Zone Soil | FVNSAILPIATSWSNWSHDPNALEGARLQLGQQLNQLSPP* |
| Ga0137413_101245331 | 3300012924 | Vadose Zone Soil | AILPIATSWSNWSHDPNALEAARLKLGQLLNQLSPP* |
| Ga0137413_116351981 | 3300012924 | Vadose Zone Soil | YAHMLKNLGQLSVVDSTVLPIAGSWSNWSHDPNLLQNVRTQLGQLLHQLAP* |
| Ga0137419_106725931 | 3300012925 | Vadose Zone Soil | SLNIAILPIATSWSNWSHDPNALEGARQQLGQLLHQLSLP* |
| Ga0137419_108956312 | 3300012925 | Vadose Zone Soil | GIQDYEYAQILRNLGQDAFVNSTIQPLATSWTNWKNDPNAVESARIQLGQMLNQLSPP* |
| Ga0137419_112612922 | 3300012925 | Vadose Zone Soil | DYVQILKNLGQVGFANSAIQPIATSWSNWSHDPNALEAARLQLGQQLNLLSPP* |
| Ga0137404_1000056021 | 3300012929 | Vadose Zone Soil | NQLSILNTAITPVAGSWTSWTKDPNALESARQQLGQLLHQLAP* |
| Ga0137404_115508111 | 3300012929 | Vadose Zone Soil | NLGQIPFLNIAILPIATSWSNWSHDLNALESVRLQLGQLLSQLSPP* |
| Ga0137404_115713721 | 3300012929 | Vadose Zone Soil | ILKNVGQVPFVNSTVLPIAASWNNWSRDPNPLEAVRLQLGQLLHQLAP* |
| Ga0137407_120337642 | 3300012930 | Vadose Zone Soil | LNGLGQTAFVNSVIQPIASGWGNWTHDPNALEAARLQLGQKLSLLGP* |
| Ga0137410_103246011 | 3300012944 | Vadose Zone Soil | LVNSIIVPIATSWSNWNHNPNALEAARLQLGQQLHLLAP* |
| Ga0137410_107006241 | 3300012944 | Vadose Zone Soil | THLLPIAASWSNWSHDPNALESARLQLGQLLHQLAP* |
| Ga0137411_12967554 | 3300015052 | Vadose Zone Soil | QILKNLGQVPFLDPILLPIAASWSNWNHSPITLEGARLQLGQQLNLLAPPGF* |
| Ga0137420_11248811 | 3300015054 | Vadose Zone Soil | PFVNSAIQPIATSWSNWSHDPNALEGARVQLGQQLNQQLGQQLNQLSPP* |
| Ga0137420_11329523 | 3300015054 | Vadose Zone Soil | VNSAILPIATSWSNWSHDPNALEGARVQLGQQLNQLSPP* |
| Ga0137420_11780282 | 3300015054 | Vadose Zone Soil | QDYEYAQMLKKLGQLGVVDSTLLPVATSWSNWSHDPNALENARTQLGQLLHQLAP* |
| Ga0137418_1000064323 | 3300015241 | Vadose Zone Soil | MLKNLGQLSVVDSTVLPIAGSWSNWNRDPNALQNARATLGQLLHQLAP* |
| Ga0137418_1000319813 | 3300015241 | Vadose Zone Soil | MLKNLGQLSVVDSTVLPIAGSWSNWSHDPNLLQNVRTQLGQLLHQLAP* |
| Ga0137412_100395115 | 3300015242 | Vadose Zone Soil | AQILKNVGQVPFVNSTIVPIAASWSNWSHDPNALEAARLQLGQLLHQLAP* |
| Ga0137412_102289492 | 3300015242 | Vadose Zone Soil | AQILKNVGQVPFVNSTIVPIAASWSNWSHDPNALEAARLQLGQKLNQLSPP* |
| Ga0137403_109923381 | 3300015264 | Vadose Zone Soil | NVGQVPFVNSTVLPIAASWNNWSRDPNPLEAVRLQLGQLLHQLAP* |
| Ga0179594_101612742 | 3300020170 | Vadose Zone Soil | QTTFLNSVILPIATSWTDWTHDVNALESARLQLGQQLNQLAPP |
| Ga0179592_100537171 | 3300020199 | Vadose Zone Soil | DYEYAQILKNVGQVPFVNSTILPIATSWNNWSHDPNALEAARLQLGQLLHQLAP |
| Ga0210407_104119122 | 3300020579 | Soil | LKSLGQLGVVDTTLLPIATSWSNWNHDPNALENARTQLGQLLHQLAP |
| Ga0215015_105128221 | 3300021046 | Soil | IQPIAASWSNWNHNPNTLEAARLHMGQQLHQLSPQ |
| Ga0179596_100961544 | 3300021086 | Vadose Zone Soil | GFANSAIQPIATSWSNWSHDPNALENARLQLGQQLNLLSPP |
| Ga0210400_100287375 | 3300021170 | Soil | LKNLGQVSFVNSIIQPIATSWSNWNHDPNALEGARLKLGQQLHQLSTP |
| Ga0210400_102185503 | 3300021170 | Soil | YEYAQILKNLGQVPFLNSIIVPIATSWTNWSHDPTALDNARQQLGQELHLLAP |
| Ga0210400_103028701 | 3300021170 | Soil | KSLGQVAFANSTLQPIAKNWSNWSHDQNALEGARLQLGRKLNQLCPP |
| Ga0210396_106542891 | 3300021180 | Soil | VQMLKNLGQLGTVDTTLLPIATSWSNWSHDPNALLNARTQLGQLLHQLAP |
| Ga0210384_104999101 | 3300021432 | Soil | YEYAQILKNLGQLGLVDTTLLPIATSWSNWNHDPNALENARTQLGQLLHQLAP |
| Ga0210392_103960492 | 3300021475 | Soil | NLGQLGVVDSTLLPIATSWSNWSHDPNALQNARTALGQLLHQLAP |
| Ga0242669_10852841 | 3300022528 | Soil | QLSVVDNALLPIATSWSNWSHDPNALQNARTQLGQLLHQLAP |
| Ga0247679_10018791 | 3300024251 | Soil | AQILKSLGQSAFTNSVVQPIATSWTNWTHDPSAVEAARQQLGQRLDQLSPP |
| Ga0179589_104158343 | 3300024288 | Vadose Zone Soil | QDYEYAQILRNLGQDAFVNSTIQPLATSWTNWKNDPNAMESARIQLGQMLNQLSPP |
| Ga0137417_10014122 | 3300024330 | Vadose Zone Soil | ILKNLGQVPFVNSIIVPIATSWSNWSHDPNALENARLQLGQQLHLLAP |
| Ga0137417_11410541 | 3300024330 | Vadose Zone Soil | LKNLGQVPFVVNSIIVPIATSWSNWSHDPNALENARLQLGQQLHLLAP |
| Ga0137417_12406912 | 3300024330 | Vadose Zone Soil | QILKNLGQVAFANSTIQPIATSWSNWSHDPNALESARLKLGQLLNQLSPP |
| Ga0137417_14519191 | 3300024330 | Vadose Zone Soil | FAFVNSVIQPIATSWSNWSHDPNALEGARLQLGQQLHQLSPP |
| Ga0247668_10317932 | 3300024331 | Soil | LNVVNTNLLPIAASWSNWSHDPNTLENARLQLGQLLHQLAP |
| Ga0209438_10066711 | 3300026285 | Grasslands Soil | NSVIQPIATSWSNWSHDPNALEGARLQLGQQLHQLSPP |
| Ga0209438_10947762 | 3300026285 | Grasslands Soil | VGQVPFVNSTILPIAASWNNWSHDPNALEAARLQLGQLLHQLAP |
| Ga0209802_13219661 | 3300026328 | Soil | LKNLGQAPLVNSIIVPVATSWSNWNHNPNALEAARLQLGQQLHLLAP |
| Ga0257149_10638392 | 3300026355 | Soil | IIVPIATSWSNWSHDPNALEAARLQLGQQLHLLSPPGL |
| Ga0257158_10339141 | 3300026515 | Soil | AQILKNLGQVPFVNSAILPIATSWSNWSHDPNALENARVQLGQLLNQLSPP |
| Ga0257158_10489942 | 3300026515 | Soil | NTLLPIATSWSNWNHDPNALENARTQLGQLLHQLAP |
| Ga0209056_100903003 | 3300026538 | Soil | QILKNLGQEDFTNSIIVPIATSWTNWSHDPNALETARLQLGQQLHQLSTP |
| Ga0179587_100435631 | 3300026557 | Vadose Zone Soil | SSVIQPIAASWTNWTHDPNALEGARLQLGQKLNQLAP |
| Ga0179587_107954831 | 3300026557 | Vadose Zone Soil | VNSAILPIATSWSNWSHDPNALEGARLQLGQQLNQLSPP |
| Ga0209331_10661471 | 3300027603 | Forest Soil | FVNSIIQPIATSWTNWNHDPNALEGARLKLGQQLHQLSTP |
| Ga0209106_10304541 | 3300027616 | Forest Soil | KNLGQVPSLNIAILPIATSWSNWSHDPNALEAARLKLGQLLNQLSPP |
| Ga0209117_11905382 | 3300027645 | Forest Soil | KNLGQVAFVNSVIQPIATSWSNWTHDPNALEGARLQLGQQLHQLSPP |
| Ga0208981_10050154 | 3300027669 | Forest Soil | QILKNLGQVAFANSTIQPIATSWSNWSHDPNALENARLQLGQLLNQLSPP |
| Ga0209118_10294301 | 3300027674 | Forest Soil | LKNLGQVPLANSIVVPIATSWSNWTQNPITLEGARLQLGQQLHLLAPPGF |
| Ga0209011_10118511 | 3300027678 | Forest Soil | GAFASSVIQPIAASWSNWTHDPNALEGARLQLGQKLNQLAP |
| Ga0209166_105287641 | 3300027857 | Surface Soil | SLGQLSFVNSIVLPVATSWTNWTHDPNALVNVRQQLGQQLHLLAP |
| Ga0209698_102499561 | 3300027911 | Watersheds | VVDSTLLPIATSWSNWNHDPNALQNARTQLGQLLHQLAP |
| Ga0137415_100324925 | 3300028536 | Vadose Zone Soil | DYEYAQILKNLGQVPLVNSIIVPIATSWSNWSHDPNALEAARLQLGQQLHLLAP |
| Ga0073994_100762461 | 3300030991 | Soil | GQGAFASSVIQPIAASWSNWTHDPNALEGARLQLGQKLNQLAP |
| Ga0307476_104021961 | 3300031715 | Hardwood Forest Soil | FLNPIILPIAASWTNWTHSAAALEGARLQLGQQLHLLAPPGF |
| Ga0307469_110049462 | 3300031720 | Hardwood Forest Soil | TTFLNSVIVPIATSWTNWTHDVNALESARLQLGQQLHQIAPP |
| Ga0307468_1022511862 | 3300031740 | Hardwood Forest Soil | VDTTLLPIATSWSNWSHDPNALQNARTQLGQLLQQLAP |
| Ga0307475_112278851 | 3300031754 | Hardwood Forest Soil | DSTLLPIATSWSNWSHDPNALQNARTQLGQLLHQLAP |
| Ga0307478_118097001 | 3300031823 | Hardwood Forest Soil | AQILKNFGQVPFVTSVIQPIATSWTNWSHDPSDLDAARLQLGQKIHQVSTP |
| Ga0307479_120037661 | 3300031962 | Hardwood Forest Soil | FVSSVIRPIATSWTNWSYDPNALQAARQQLGQRLNQLAPP |
| ⦗Top⦘ |