


| Basic Information | |
|---|---|
| Family ID | F074499 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | QVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDSIGAVLGS |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.68 % |
| % of genes from short scaffolds (< 2000 bps) | 3.36 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.319 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (24.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.017 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (59.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF03819 | MazG | 2.52 |
| PF03477 | ATP-cone | 1.68 |
| PF01467 | CTP_transf_like | 1.68 |
| PF11450 | DUF3008 | 0.84 |
| PF00440 | TetR_N | 0.84 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.32 % |
| All Organisms | root | All Organisms | 1.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300007541|Ga0099848_1333286 | Not Available | 515 | Open in IMG/M |
| 3300009059|Ga0102830_1131762 | Not Available | 736 | Open in IMG/M |
| 3300010389|Ga0136549_10067992 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300028178|Ga0265593_1117906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Bellamyvirus sp. | 698 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 24.37% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 16.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.40% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.40% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.20% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.68% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.68% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.68% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.84% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.84% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.84% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.84% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027220 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1100555342 | 3300001213 | Wetland | QVLFDAQKGYTYDEVSVPPRVIDIREVIQQLDDNIGAVLGI* |
| WOR8_1003153014 | 3300001687 | Marine Sediment | QVLFESQKGYTYDPTSVPARVADIRDVIRDIDDNLGAVLGVNE* |
| GOS2236_10627241 | 3300001968 | Marine | PRVAAAVRQVLFEAQKGYTYDEVSVPPRIADIRSVVQSIDDNLGTVLGV* |
| B570J29579_1005616 | 3300002272 | Freshwater | RAAAAIRQVLFEAQQGYTYDELSVPPRISDIRAVIQDIDDNIGAVIGV* |
| Ga0065166_103165432 | 3300004112 | Freshwater Lake | VRQILFENQKGYTYDEVSVPPRISDIRSVIKDLDEKIGAIVG* |
| Ga0068876_102252581 | 3300005527 | Freshwater Lake | QKGYTYNEMSVPPRVSDIRGVIQDLDNNIGAVLGV* |
| Ga0068872_101300291 | 3300005528 | Freshwater Lake | ARTAAAVRQVLFDAQKGYTYDEMSVPPRVSDIRGVIRDLDDNIGAVLGV* |
| Ga0066377_102588601 | 3300005934 | Marine | SAAAVRQVLFDSQKGYTYDEVSVPPRVTDIRGVIQQLDDSIGAVVEV* |
| Ga0075479_104059822 | 3300006870 | Aqueous | ESQKGYTYDPTSVPARVADIRDVIRDIDDNLGAVLGVNE* |
| Ga0075472_100923131 | 3300006917 | Aqueous | AAAVRQVLFDSQKGYTYDEVSIPPRIADIRGVIQQLDDSIGAALGI* |
| Ga0099851_11534862 | 3300007538 | Aqueous | RQVLFDAQKGYTYDEVSIPPRIVDIRSTIQKLDDSIGAVIDA* |
| Ga0099851_11541731 | 3300007538 | Aqueous | IDARTAAAVRQVLFDAQKGYTYDEVSVPPRVTDIRGVIQQLDDNIGAVLSA* |
| Ga0099851_12428682 | 3300007538 | Aqueous | VRQVLFDSQKGYTYDEVSVPLRISDIRTVIQSIDDNIGTILGA* |
| Ga0099851_12596571 | 3300007538 | Aqueous | KGYTYDEVSVPPRIVDIRSAIQQLDDSIGAVLGA* |
| Ga0099849_10504181 | 3300007539 | Aqueous | AAAAVRQVLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSIGAVIGA* |
| Ga0099849_10987824 | 3300007539 | Aqueous | AAAAVRQVLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSISAVIGA* |
| Ga0099849_11793982 | 3300007539 | Aqueous | MPVRAAAAVRQVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDNIGAVLGA* |
| Ga0099849_12646552 | 3300007539 | Aqueous | QKGYTYDEVSIPLRIVDIRSAIQQLDDNIGAVIGV* |
| Ga0099849_13121451 | 3300007539 | Aqueous | QKGYTYDPTCVPERVVDIRTVIRDIDDNIGAVLGVNE* |
| Ga0099848_10223521 | 3300007541 | Aqueous | QVLFDAQKGYTYDEVSVPPRVVDIRNVIQQLDDNISDVLGV* |
| Ga0099848_10352564 | 3300007541 | Aqueous | AVRQVLFDAQKGYTYDEVSVPPRIIDIRSTIQQLDDSIGAVIGV* |
| Ga0099848_10642474 | 3300007541 | Aqueous | QVLFDAQKGYTYDEVSVPPRVVDIRNVIQQLDDNISDVLGA* |
| Ga0099848_11413181 | 3300007541 | Aqueous | KMDARCAAAVRQILFESQKGYTYDEVSVPPRITDIRTVIQNLDDNIGAVLNAN* |
| Ga0099848_13028252 | 3300007541 | Aqueous | AAAVRQVLFDAQKGYTYDEVSVPPRVTDIRGVIQQLDDSISAVLGA* |
| Ga0099848_13166651 | 3300007541 | Aqueous | KMDARCAAAVRQILFESQKGYTYDEVSVPPRITDIRNVIQDIDDNIGAVLNAN* |
| Ga0099848_13332863 | 3300007541 | Aqueous | QKGYTYDEVSVPPRVIDIRGVIQQLDDSIGAVLGA* |
| Ga0099846_10534041 | 3300007542 | Aqueous | RTAAAVRQVLFESQVGYTYDEGSVPPRVSDIRGVIQQLDDSIGAVLGA* |
| Ga0102920_12352121 | 3300007600 | Estuarine | KGYTYDEVSVPPRISDIRRVIQQLDDNIGAVLGA* |
| Ga0102896_11993313 | 3300007618 | Estuarine | VTIKMDARTAAAVRQVLFDAQKGYTYNEVSVPPRVSDIRGVIQQLDEGIGAVLGV* |
| Ga0102871_100227611 | 3300007620 | Estuarine | QILFENQKGYTYDELSVPPRISDIRAVILDLDEKIGAVVGE* |
| Ga0102895_10934793 | 3300007629 | Estuarine | QKGYTYNEVSVPPRVSDIRGVIQQLDEGIGAVLGV* |
| Ga0102902_11642353 | 3300007644 | Estuarine | FDSQKGYTYDALSVPPRVVDIRNVIQQLDENLESLLGD* |
| Ga0099850_10707541 | 3300007960 | Aqueous | AQKGYTYDEVSVPPRVVDIREVIQQLDDNIGAVFSA* |
| Ga0099850_12131881 | 3300007960 | Aqueous | QVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDSIGAVLGS* |
| Ga0114350_10221054 | 3300008116 | Freshwater, Plankton | QKGYTYDEFSVPPRVSDIRKVIQQLDDNIDKVLGEE* |
| Ga0102831_12937973 | 3300008996 | Estuarine | VLFESQKGYTYDEVSVPPRVTDIRLVIQDLDDSISAVLGV* |
| Ga0102864_11519061 | 3300009051 | Estuarine | MTKTVSVKMDVRTAAAVRQILSENQNGYTYDELSVPPRISDIRAVILDLDEKIGAVVGE* |
| Ga0102830_11317621 | 3300009059 | Estuarine | SQKGYTYDEVSVPPRVTDIREVIQQLDDNIGAVVGS* |
| Ga0102830_11525991 | 3300009059 | Estuarine | QVLFDAQRGYTYDEVSVPPRVTDIRNVIQDLDDNIGAVLGV* |
| Ga0129348_10495701 | 3300010296 | Freshwater To Marine Saline Gradient | KGYTYDEVSVPPRITDIRTVIQDLDDNIGAVLNVN* |
| Ga0129348_13199272 | 3300010296 | Freshwater To Marine Saline Gradient | KGYTYDPTCVPERVVDIRTVIRDIDDNIGAVLGVNE* |
| Ga0129345_12586171 | 3300010297 | Freshwater To Marine Saline Gradient | SQKGYTYDPTCVPERVVDIRTVIRDIDDNIGAVLGVNE* |
| Ga0129342_11074212 | 3300010299 | Freshwater To Marine Saline Gradient | RQVLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSIGAVIGD* |
| Ga0129342_12856541 | 3300010299 | Freshwater To Marine Saline Gradient | VLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSIGAVIGV* |
| Ga0129351_10497151 | 3300010300 | Freshwater To Marine Saline Gradient | VLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSIGAVIGA* |
| Ga0129351_11929873 | 3300010300 | Freshwater To Marine Saline Gradient | FDAQKGYTYDEASVPPRILDIRSVIQDLDADLGAVLGV* |
| Ga0136656_13051172 | 3300010318 | Freshwater To Marine Saline Gradient | QVLFDAQKGYTYDEVSVPPRVTDIRGVIQQLDDSIGDVLGV* |
| Ga0129333_100083431 | 3300010354 | Freshwater To Marine Saline Gradient | VTIKMDARSAAAVRQVLFDSQKGYTYNEVSVPPRIADIRGVIQQLDDSIGAVLGV* |
| Ga0129333_100654581 | 3300010354 | Freshwater To Marine Saline Gradient | VRQVLFDAQKGYTYNEASVPPRVTNIRGVIQDLDDNIGAVLGV* |
| Ga0129333_102406031 | 3300010354 | Freshwater To Marine Saline Gradient | MDARQAAAVRQVLFDAQKGYTYNEVSVPPRITDIRSVVQQLDDSIGSVVGEQ* |
| Ga0129333_103511042 | 3300010354 | Freshwater To Marine Saline Gradient | VTEEKLVTIKMNARTAAAVRQVLFDAQKGYTYNEASVPPRVTNIRGVIRDLDNNIGAVLGV* |
| Ga0129333_103920251 | 3300010354 | Freshwater To Marine Saline Gradient | AAVRQVLFESQVGYTYDEASVPPRITDIRSVIQDLDDSIGAVIGV* |
| Ga0129333_105495541 | 3300010354 | Freshwater To Marine Saline Gradient | RAAAAVRQVLFDAQKGYTYDEVSVPPRIADIRSVVQSIDDSIGAVLGV* |
| Ga0129333_116665573 | 3300010354 | Freshwater To Marine Saline Gradient | AAAVRQVLFEAQRGYTYDEVSVPPRIADIRKVIQDIDDSITAVVE* |
| Ga0129333_116848662 | 3300010354 | Freshwater To Marine Saline Gradient | VLFDAQKGYTYDEVSVPPRVTDIRSVVQQLDAGIEEVIVG* |
| Ga0129333_116959472 | 3300010354 | Freshwater To Marine Saline Gradient | AAAVRQVLFDAQKGYTYDEVSVPPRVTDIREVIGQLDDNIGAVLGA* |
| Ga0129336_103532183 | 3300010370 | Freshwater To Marine Saline Gradient | QILFDAQKGYTYDEMSVPPRITDIRNIIQDIDNSISEALGV* |
| Ga0129336_105912812 | 3300010370 | Freshwater To Marine Saline Gradient | IKMNARTAAAVRQVLFDAQKGYTYNEASVPPRVTNIRGVIQDLDDNIGAVLGV* |
| Ga0136549_100679924 | 3300010389 | Marine Methane Seep Sediment | VIKEKQVTLKLDARTAAVVRQVLFESQLEYTYNEGSVPPRVSDIRDVIQQLDDSIGAVLGA* |
| Ga0136549_103828962 | 3300010389 | Marine Methane Seep Sediment | AAAVRQVLFDAQRGYTYDEVSIPPRIVDIRSVIQQLDDSIGAVIGD* |
| Ga0151620_11864201 | 3300011268 | Freshwater | KGYTYDEVSVPPRISDIRNVIRDIDDNLGAVLGV* |
| Ga0151620_12238222 | 3300011268 | Freshwater | KGYTYDEVSVPPRISDIRNVIRDIDDSIGAVLGV* |
| Ga0129353_15165512 | 3300012525 | Aqueous | GYTYDPTCVPERVVDIRTVIRDIDDNIGAVLGVNE* |
| Ga0180120_103671173 | 3300017697 | Freshwater To Marine Saline Gradient | AAAAVRQVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDNIGAVLGV |
| Ga0181581_102372232 | 3300017962 | Salt Marsh | QKGYTYDPTCVPERVVDIRTVIRDIDDNIGAVLGVNE |
| Ga0180437_101765003 | 3300017963 | Hypersaline Lake Sediment | FESQRGYTYDEVSVPPRIADIRSVIQSIDDNIGAVLGA |
| Ga0181591_103880521 | 3300018424 | Salt Marsh | ATKGFTYDPICVPPRVVDIREVIRDLDDNIGAVLGVNE |
| Ga0181591_111420261 | 3300018424 | Salt Marsh | KQVIISIDARAAAAVRQVLFESQLGYTYNEGSVPPRIIDIREVIQQIDDSIGAVLGV |
| Ga0181359_11470464 | 3300019784 | Freshwater Lake | HQKGYTYNEDSVPPRVVDIRSVIMDLDEKIGAIVGRE |
| Ga0194112_108794082 | 3300020109 | Freshwater Lake | VRQVLFDAQKGYTYDEVSVPPRISDIRSIIQSIDENLDAILGD |
| Ga0211736_107229772 | 3300020151 | Freshwater | QKGYTYDEVSVPPRVADIRRVIQQLDDSIDSILSV |
| Ga0211736_110016383 | 3300020151 | Freshwater | AAAVRQILFENQKGYTYDEVSVPPRISDIRAVIADLDEKIGTIVGE |
| Ga0211733_105573934 | 3300020160 | Freshwater | DVRAAAAVRQVLFEAQRGYTYDEVSVPPRISDIRSVIQGIDDNIGAVLGA |
| Ga0211733_108362493 | 3300020160 | Freshwater | RQVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDENIESALGAE |
| Ga0211726_102602681 | 3300020161 | Freshwater | VLFDAQKGYTYDEVSIPPRVADIRGVIQQLDDNISFILDAE |
| Ga0211726_106049601 | 3300020161 | Freshwater | AVRQVLFDSQKGYTYDEASVPPRVVDIRSVIQDLDDNIVAVLGA |
| Ga0211726_108525481 | 3300020161 | Freshwater | VLFDAQKGYTYDEVSIPPRVADIRGVIQQLDDSIGAALGA |
| Ga0211729_107387071 | 3300020172 | Freshwater | ARTAAAVRQVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDNIGTVLGV |
| Ga0211729_109577083 | 3300020172 | Freshwater | RAAAAVRQVLFDAQKGYTYDEVSIPPRVADIRGVIQQLDDNISFILDAE |
| Ga0211729_109592559 | 3300020172 | Freshwater | RAAAAVRQVLFDAQKGYTYDEVSIPPRVADIRGVIQQLDDSIGAALGA |
| Ga0194131_100857221 | 3300020193 | Freshwater Lake | TAAAVRQVLFDAQKGYTYDEVSVPPRVSDIRDVIRQLDDNISDIVVM |
| Ga0194120_101933201 | 3300020198 | Freshwater Lake | KMDARTAAAVRQVLFDSQKGYTYNEISVPPRISDIRAVIQQLDDNIGAVLGV |
| Ga0208234_10386822 | 3300020515 | Freshwater | KLDARAAAAVRQVLFEAQRGYTYDKVSVPPRIVDIRSVIQSIDDNLGAALGV |
| Ga0208224_10309752 | 3300020528 | Freshwater | TAAAVRQVLFDAQKGYTYDEVSVPPRVTDIREVIGQLDDNIGAVFGA |
| Ga0194129_105191351 | 3300020578 | Freshwater Lake | VLFDAQKGYTYDEVSVPPRISDIRSIIQSIDENLDAILGD |
| Ga0194123_100479866 | 3300021093 | Freshwater Lake | QKGYTYDEVSVPPRISDIRSIIQSIDENLDAILGD |
| Ga0222716_107459771 | 3300021959 | Estuarine Water | GYTYDPASVPARVADIREVIRDIDDNLGAVLGVNE |
| Ga0222714_101279081 | 3300021961 | Estuarine Water | AQKGYTYDEGSVPPRITDIRSVIVDLDEKIGAIVGNE |
| Ga0222713_104312192 | 3300021962 | Estuarine Water | VRQVLFDSQKGYTYDELSVPPRVTDIRNVIQQLDDNIGAVLGV |
| Ga0222719_104362842 | 3300021964 | Estuarine Water | VIKEKQVTLKLDARTAAVVRQVLFESQLEYTYNEGSVPPRVSDIRDVIQQLDDSIGAVLG |
| Ga0222719_104692992 | 3300021964 | Estuarine Water | AAVRQVLFESQKGYTYDEVSVPPRVTDIRVVIQDLDDSISAILGV |
| Ga0196901_10861121 | 3300022200 | Aqueous | VLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSIGAVIGA |
| Ga0181351_10565071 | 3300022407 | Freshwater Lake | FDAQKGYTYDEFSVPPRVSDIRKVIQQLDDNIDKVLGEE |
| Ga0244775_103401953 | 3300024346 | Estuarine | AQRGYTYDEVSVPPRVTDIRNVIQDLDDNIGAVLGV |
| Ga0255183_11148131 | 3300024515 | Freshwater | VRQVLFDAQKGYTYNQTSVPPRVIDIRNVIQQLDDNIGAVIGV |
| Ga0208546_10232801 | 3300025585 | Aqueous | QVLFDSQKGYTYDEVSVPPRIADIRTVIQDLDDNIGAVLGV |
| Ga0208161_11070821 | 3300025646 | Aqueous | AAAVRQVLFDAQKGYTYDEVSVPPRVTDIRGVIQQLDDSISAVLGA |
| Ga0208795_11794592 | 3300025655 | Aqueous | VLFESQKGYTYDPISVPARVADIRDVIRDIDDNLGAVLGVNE |
| Ga0208898_10302861 | 3300025671 | Aqueous | SAAAVRQVLFDAQKGYTYDEVSVPPRVTDIREVIQQLDDNIGAVLGV |
| Ga0208162_10202771 | 3300025674 | Aqueous | RAAAAVRQVLFDAQKGYTYDEVSIPPRIVDIRSTIQQLDDSISAVIGA |
| Ga0208019_10409571 | 3300025687 | Aqueous | DAQKGYTYDEVSVPPRVVDIREVIQQLDDNIGAVFSA |
| Ga0208927_10505801 | 3300027220 | Estuarine | RQILFENQKGYTYDELSVPPRISDIRAVILDLDEKIGAVVGE |
| Ga0208975_10236414 | 3300027659 | Freshwater Lentic | DARTAAAVRQVLFEAQKGYTYDEVSVPPRVADIRSVIQSIDDNLGAVLGA |
| Ga0209990_103539471 | 3300027816 | Freshwater Lake | LFEAQKGYTYNEMSVPPRVSDIRGVIQDLDNNIGAVLGV |
| Ga0209536_1008253903 | 3300027917 | Marine Sediment | AQKGYTYDEVSIPPRVTDIREVIQQLDDSIGDVLGA |
| Ga0247723_10578012 | 3300028025 | Deep Subsurface Sediment | QRGYTYDEVSVPPRIADIRSVIQSIDDNIGAVLGV |
| Ga0265593_11179063 | 3300028178 | Saline Water | VTKSVSIEMEVRAAAAVRQILFESQKGYTYTEGSVPPRIVEIRSVILSIDEKIGEALE |
| Ga0119945_10120301 | 3300029933 | Aquatic | QKGYTYDEVSVPPRIADIRSVVQQLDDSIGAVLGV |
| Ga0119945_10215341 | 3300029933 | Aquatic | RQVLFDSQKGYTYDEVSVPPRISDIRGVIQQLDDNIGAVLGI |
| Ga0315901_102667595 | 3300031963 | Freshwater | HFEAQQGYTYDELSVPPRISDIRAVIQNLDDNIGAVLGVS |
| Ga0315901_105569853 | 3300031963 | Freshwater | QKGYTYDEFSVPPRVSDIRKVIQQLDENIESALGVE |
| Ga0315901_105668461 | 3300031963 | Freshwater | RQVLFEAQKGYTYDEVSVPPRISDIRGVVQQLDDNIGAVLGA |
| Ga0315906_103226235 | 3300032050 | Freshwater | QQGYTYDELSVPPRISDIRAVIQDIDDNIGAVIGV |
| Ga0315276_114284253 | 3300032177 | Sediment | KGYTYDEGSVPPRITDIRTVISDLDEKIGVIVGNE |
| Ga0334980_0266808_3_113 | 3300033816 | Freshwater | QKGYTYDEVSVPPRVSDIRKVIQQLDDNIDKVLGEE |
| Ga0334995_0339721_809_964 | 3300034062 | Freshwater | MDARCAAAVRQVLFEAQKGYTYNEVSVPPRVADIRSVIQSIDDNLGAVLGV |
| Ga0335014_0388067_499_609 | 3300034094 | Freshwater | AQKGYTYDEVSVPPRVTDIREVIGQLDDNIGAVFGA |
| Ga0335031_0312400_1_144 | 3300034104 | Freshwater | TAAAVRQVLFDAQKGYTYDEVSVPPRVSDIRGVIQQLDDNIGAVLGV |
| Ga0335053_0436483_665_784 | 3300034118 | Freshwater | VLFDAQKGYTYNELSVPPRVVDIRNVIADLDEKIGSVVE |
| ⦗Top⦘ |