


| Basic Information | |
|---|---|
| Family ID | F074455 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LLIEPDARERVEKAIVEAGGEVLPMTIDRQGVQVVSR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 89.08 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.756 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.134 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF11006 | DUF2845 | 3.36 |
| PF06762 | LMF1 | 2.52 |
| PF14329 | DUF4386 | 2.52 |
| PF00044 | Gp_dh_N | 1.68 |
| PF07238 | PilZ | 1.68 |
| PF03932 | CutC | 1.68 |
| PF02800 | Gp_dh_C | 1.68 |
| PF01512 | Complex1_51K | 0.84 |
| PF11026 | DUF2721 | 0.84 |
| PF01103 | Omp85 | 0.84 |
| PF08818 | DUF1801 | 0.84 |
| PF01931 | NTPase_I-T | 0.84 |
| PF00162 | PGK | 0.84 |
| PF02517 | Rce1-like | 0.84 |
| PF14534 | DUF4440 | 0.84 |
| PF13751 | DDE_Tnp_1_6 | 0.84 |
| PF10129 | OpgC_C | 0.84 |
| PF01625 | PMSR | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 3.36 |
| COG3142 | Copper homeostasis protein CutC | Inorganic ion transport and metabolism [P] | 1.68 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1894 | NADH:ubiquinone oxidoreductase, NADH-binding 51 kD subunit (chain F) | Energy production and conversion [C] | 0.84 |
| COG1986 | Non-canonical (house-cleaning) NTP pyrophosphatase, all-alpha NTP-PPase family | Defense mechanisms [V] | 0.84 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.84 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.84 |
| COG4656 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfC subunit | Energy production and conversion [C] | 0.84 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.76 % |
| Unclassified | root | N/A | 9.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_103733490 | Not Available | 502 | Open in IMG/M |
| 3300000789|JGI1027J11758_12630511 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300001356|JGI12269J14319_10211661 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005538|Ga0070731_11066587 | Not Available | 534 | Open in IMG/M |
| 3300005712|Ga0070764_11057653 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005921|Ga0070766_10426075 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005993|Ga0080027_10114833 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300006041|Ga0075023_100356844 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300007076|Ga0075435_100137189 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300007265|Ga0099794_10531860 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009088|Ga0099830_10276601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1335 | Open in IMG/M |
| 3300009088|Ga0099830_10477613 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009088|Ga0099830_11012362 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009088|Ga0099830_11710105 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009089|Ga0099828_10539735 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300009089|Ga0099828_10757004 | Not Available | 871 | Open in IMG/M |
| 3300009143|Ga0099792_10355490 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300009143|Ga0099792_10718324 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010043|Ga0126380_10901596 | Not Available | 734 | Open in IMG/M |
| 3300010047|Ga0126382_11428361 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010048|Ga0126373_10108891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2575 | Open in IMG/M |
| 3300010048|Ga0126373_10154085 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
| 3300010360|Ga0126372_12317557 | Not Available | 587 | Open in IMG/M |
| 3300010366|Ga0126379_12956528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300010376|Ga0126381_101180808 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300010398|Ga0126383_10584365 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300011269|Ga0137392_10208659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1600 | Open in IMG/M |
| 3300011269|Ga0137392_10425031 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300011270|Ga0137391_10852019 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300011271|Ga0137393_10604836 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012096|Ga0137389_10340154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
| 3300012096|Ga0137389_11613293 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012199|Ga0137383_10752992 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012200|Ga0137382_11268158 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012205|Ga0137362_10956972 | Not Available | 730 | Open in IMG/M |
| 3300012205|Ga0137362_11307006 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012207|Ga0137381_11136080 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012210|Ga0137378_11136820 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012357|Ga0137384_11211575 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012359|Ga0137385_10788738 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012362|Ga0137361_11400688 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012363|Ga0137390_10077177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3269 | Open in IMG/M |
| 3300012363|Ga0137390_10116245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2648 | Open in IMG/M |
| 3300012918|Ga0137396_10394034 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012929|Ga0137404_10316537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1357 | Open in IMG/M |
| 3300012929|Ga0137404_10571224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300012930|Ga0137407_12435480 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012961|Ga0164302_10941059 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300013308|Ga0157375_13500063 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014200|Ga0181526_10429232 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300014657|Ga0181522_10611795 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300014968|Ga0157379_10339592 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300015054|Ga0137420_1160962 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300015264|Ga0137403_10237489 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300016294|Ga0182041_10015072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4559 | Open in IMG/M |
| 3300016294|Ga0182041_10566545 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300017823|Ga0187818_10031404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2279 | Open in IMG/M |
| 3300017995|Ga0187816_10575125 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018034|Ga0187863_10764484 | Not Available | 547 | Open in IMG/M |
| 3300018043|Ga0187887_10048747 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300018058|Ga0187766_10782673 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300018086|Ga0187769_10570828 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300018088|Ga0187771_10674004 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300018090|Ga0187770_10953808 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300020010|Ga0193749_1016316 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300020581|Ga0210399_11203412 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300020582|Ga0210395_10982126 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021168|Ga0210406_10186470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300021405|Ga0210387_10612120 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021406|Ga0210386_10646962 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300021406|Ga0210386_10964158 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021432|Ga0210384_11110229 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300021474|Ga0210390_10020642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5360 | Open in IMG/M |
| 3300021474|Ga0210390_10657243 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300021475|Ga0210392_10189665 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300021478|Ga0210402_10471884 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300021478|Ga0210402_11196159 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300021478|Ga0210402_11809316 | Not Available | 537 | Open in IMG/M |
| 3300024330|Ga0137417_1446702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2112 | Open in IMG/M |
| 3300025914|Ga0207671_10555053 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300025915|Ga0207693_10059920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2982 | Open in IMG/M |
| 3300026809|Ga0207820_112903 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026869|Ga0207821_1022420 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026909|Ga0207858_1012154 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300027502|Ga0209622_1015175 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300027655|Ga0209388_1002080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4811 | Open in IMG/M |
| 3300027855|Ga0209693_10486111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027869|Ga0209579_10734004 | Not Available | 534 | Open in IMG/M |
| 3300027875|Ga0209283_10461144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300027884|Ga0209275_10693517 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027898|Ga0209067_10129725 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300027908|Ga0209006_11013899 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300028047|Ga0209526_10380937 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300028047|Ga0209526_10532782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300028069|Ga0255358_1054862 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028759|Ga0302224_10414204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300031573|Ga0310915_11029431 | Not Available | 574 | Open in IMG/M |
| 3300031668|Ga0318542_10542288 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031682|Ga0318560_10055254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1968 | Open in IMG/M |
| 3300031716|Ga0310813_10984340 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031718|Ga0307474_10903447 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031720|Ga0307469_11505225 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031740|Ga0307468_101079685 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031823|Ga0307478_10499587 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031846|Ga0318512_10210261 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031846|Ga0318512_10410501 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031910|Ga0306923_11162448 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031954|Ga0306926_12033262 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031954|Ga0306926_12120442 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032001|Ga0306922_10897184 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300032059|Ga0318533_10296684 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300032091|Ga0318577_10262772 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300032174|Ga0307470_10062100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1973 | Open in IMG/M |
| 3300032180|Ga0307471_102104226 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300032261|Ga0306920_100144608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3541 | Open in IMG/M |
| 3300032515|Ga0348332_12077021 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032895|Ga0335074_10765795 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300033134|Ga0335073_10499014 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300033158|Ga0335077_11819379 | Not Available | 571 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.04% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.84% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1037334901 | 3300000364 | Soil | IEPETRERVEAAVVAAGGEVLPMKIDRSGVQVTVS* |
| JGI1027J11758_126305112 | 3300000789 | Soil | CVVLLIEPDARERVEKAVLDAGGELLPMKIDRQGVTVVSQ* |
| JGI12269J14319_102116611 | 3300001356 | Peatlands Soil | GCIVLLIEPGARERVEKAIVESGGELLPMQIDRQGVTVITQ* |
| Ga0070731_110665871 | 3300005538 | Surface Soil | IEPEARGRVEKAIRDAGGKILETRIDSQGVQVISR* |
| Ga0070764_110576531 | 3300005712 | Soil | GCVVMLIEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR* |
| Ga0070766_104260752 | 3300005921 | Soil | EPDARTRVESAIVEAGGEVLPVTIDRQGVQVISR* |
| Ga0080027_101148331 | 3300005993 | Prmafrost Soil | LIEPDSRGKVEGAVADAGGQVLPMTIDRSGVQVNVS* |
| Ga0075023_1003568441 | 3300006041 | Watersheds | IDPEARGRVETAVAEAGGELLPVRVDRQGVTVVSP* |
| Ga0075435_1001371891 | 3300007076 | Populus Rhizosphere | GGGCVVMLIEPGARSGVEKAVSQASGQLLPMKIDRSGVQVTVS* |
| Ga0099794_105318602 | 3300007265 | Vadose Zone Soil | VVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS* |
| Ga0099830_102766011 | 3300009088 | Vadose Zone Soil | IEPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS* |
| Ga0099830_104776133 | 3300009088 | Vadose Zone Soil | LIEPEARERIQAAVASAGGQVLPMKIDRSGVQVTVS* |
| Ga0099830_110123621 | 3300009088 | Vadose Zone Soil | VVLLVEPDARERVEMAILEAGAEVLPMTIDRQGVQVVSR* |
| Ga0099830_117101052 | 3300009088 | Vadose Zone Soil | VLLIEPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR* |
| Ga0099828_105397353 | 3300009089 | Vadose Zone Soil | EPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS* |
| Ga0099828_107570042 | 3300009089 | Vadose Zone Soil | VLLIEPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS* |
| Ga0099792_103554901 | 3300009143 | Vadose Zone Soil | CVVLLIEPDTRERVEAAVVEAGGEVLPMKLDRSGVQVNVS* |
| Ga0099792_107183242 | 3300009143 | Vadose Zone Soil | EPDSRDRVQKSFREAGAEVLPMTIDRQGVQVVSR* |
| Ga0126380_109015961 | 3300010043 | Tropical Forest Soil | LLIEPDAREKVEKAIAAAGGELLPMRIDRSGVQVNVTD* |
| Ga0126382_114283612 | 3300010047 | Tropical Forest Soil | LIEPEARDRVERAIVDAGGEVLRTTIDRQGVIVISR* |
| Ga0126373_101088913 | 3300010048 | Tropical Forest Soil | GCVVLLIEPDARDRAEKAVAEAGGEVLHATIDRQGVSVVFR* |
| Ga0126373_101540854 | 3300010048 | Tropical Forest Soil | CVVLLIEPEARHRVENAIAEAGGEVLHTTIDRRGVSVISR* |
| Ga0126372_123175572 | 3300010360 | Tropical Forest Soil | CVVLLIEPDARQRVEKAVFDNGGELLPMVIDRQGVTVVTP* |
| Ga0126379_129565282 | 3300010366 | Tropical Forest Soil | MLIEPDARAGVEKAVADTGGQLLPMKIDRSGVQVIVS* |
| Ga0126381_1011808082 | 3300010376 | Tropical Forest Soil | CVVLLIEPEARERVEKAVLESGGELLPMVIDRQGVTVVTP* |
| Ga0126383_105843652 | 3300010398 | Tropical Forest Soil | LLIEPQARERVERAVVGCGGELLPMQIDRQGVTVVST* |
| Ga0137392_102086591 | 3300011269 | Vadose Zone Soil | GGGCVVLLIEPEARERVEAAVTESAGEVLPMKIDRSGVQVIVS* |
| Ga0137392_104250313 | 3300011269 | Vadose Zone Soil | GGCVVLLIEPEARERVEAAVAAAGGQVLPMKIDRSGVQVTVS* |
| Ga0137391_108520192 | 3300011270 | Vadose Zone Soil | EPDARDRVETAIRESGAEVLPMTIDRQGVQVVSR* |
| Ga0137393_106048361 | 3300011271 | Vadose Zone Soil | CVVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVTVS* |
| Ga0137389_103401542 | 3300012096 | Vadose Zone Soil | LLIEPEARERVEAAVAAAGGQVLPMKIDRSGVQVTVS* |
| Ga0137389_116132931 | 3300012096 | Vadose Zone Soil | GGCVVLLIEPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR* |
| Ga0137383_107529922 | 3300012199 | Vadose Zone Soil | EPGSRGAVEKAIADAGGQILPMRIDRSGVQVTVS* |
| Ga0137382_112681582 | 3300012200 | Vadose Zone Soil | LVEPDARERVAKAIREAGAEVLPMTIDRQGVQVVSR* |
| Ga0137362_109569721 | 3300012205 | Vadose Zone Soil | VVLLIEPDARGNVESAVAQAGGQVLPMRIDRSGVQVNVT* |
| Ga0137362_113070061 | 3300012205 | Vadose Zone Soil | LIEPETRERVEAAVIEAGGEVLPMKIDRSGVQVTVS* |
| Ga0137381_111360801 | 3300012207 | Vadose Zone Soil | VVFLIEPEARERVEKAIVEAGAEILPVSIDRQGVQVISR* |
| Ga0137378_111368201 | 3300012210 | Vadose Zone Soil | VLLIEPGARERVEKAIREAGGEVLPMTIDRHGVQVVSR* |
| Ga0137384_112115751 | 3300012357 | Vadose Zone Soil | EPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR* |
| Ga0137385_107887382 | 3300012359 | Vadose Zone Soil | GGGCVVLLIEPGARERVEKAIREAGGEVLPMTIDRHGVQVVSR* |
| Ga0137361_114006882 | 3300012362 | Vadose Zone Soil | LLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS* |
| Ga0137390_100771771 | 3300012363 | Vadose Zone Soil | VEPDARERVETAIREAGAEALPMTIDRQGVQVVSR* |
| Ga0137390_101162451 | 3300012363 | Vadose Zone Soil | EPEARERIQAAVASAGGQVLPMKIDRSGVQVTVS* |
| Ga0137396_103940342 | 3300012918 | Vadose Zone Soil | LIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS* |
| Ga0137404_103165373 | 3300012929 | Vadose Zone Soil | LLIDPDARESVEKAVAVAGGQLLPMRIDRSGVQVNVTGEW* |
| Ga0137404_105712242 | 3300012929 | Vadose Zone Soil | EPDARESVEKAVAAAAGELLAMRIDRSGVQVNVT* |
| Ga0137407_124354802 | 3300012930 | Vadose Zone Soil | LLIEPDARDRVQNSIREAGAEVLPMTIDRQGVQVVSR* |
| Ga0164302_109410592 | 3300012961 | Soil | VLLIEPDAREKVEAAVAEAGGQLLPMKIDRSGVQVNVS* |
| Ga0157375_135000632 | 3300013308 | Miscanthus Rhizosphere | VVMLIEPDARPSVEKAVANAGGQLLPMKIDRSGVQVTVS* |
| Ga0181526_104292321 | 3300014200 | Bog | VLLIEPDARERVEKAVVEAGGQLLPMHIDRQGVQVVAQ* |
| Ga0181522_106117951 | 3300014657 | Bog | CLVLLIEPDARARVERAVIEAGGQLLPMFLDRQGVTVLTQ* |
| Ga0157379_103395922 | 3300014968 | Switchgrass Rhizosphere | VVLLIEPDAREKVEAAVAEAGGQLLPMKIDRSGVQVNVS* |
| Ga0137420_11609622 | 3300015054 | Vadose Zone Soil | VLLIEPETREKVEAAVVEAGGQVLPMKIDRSGVQVNVS* |
| Ga0137403_102374891 | 3300015264 | Vadose Zone Soil | VMLIEPDARGRVEMAIEEVGGKVLPMKIDRQGVQVVSR* |
| Ga0182041_100150725 | 3300016294 | Soil | CVVMLIEPDARPAVEKAVADAGGGLLPMKIDRSGVQVTVS |
| Ga0182041_105665452 | 3300016294 | Soil | VLIEPDARGSVEKAVSAAGGQLLPMKIDRSGVQVTVS |
| Ga0187818_100314043 | 3300017823 | Freshwater Sediment | IEPAGRERVEAAIVDAGGQLLPMKIDRSGVRVNVS |
| Ga0187816_105751251 | 3300017995 | Freshwater Sediment | GCVVLLIEPDARERVEKTVEESGGELLPMQIDRQGVTVVSQ |
| Ga0187863_107644842 | 3300018034 | Peatland | LLIEPDARARVEKAVIEVGGQLLPMFLDRQGVTVLTQ |
| Ga0187887_100487474 | 3300018043 | Peatland | LLIEPDARARVEAAVAKSGGQLLPMRIDRQGVQVATTP |
| Ga0187766_107826731 | 3300018058 | Tropical Peatland | CVVLLIEPEVRERVEKAIEDAGAKVLPVTVDRQGVQVISR |
| Ga0187769_105708282 | 3300018086 | Tropical Peatland | GCVVLLIEPDARERVEKAVVESGGELLPVQIDRQGVSVATQ |
| Ga0187771_106740041 | 3300018088 | Tropical Peatland | IVLLIEPDARERVEKAVEESGGELLPVQIDRQGVTVVSQ |
| Ga0187770_109538081 | 3300018090 | Tropical Peatland | IEPEARERVEKTVVEAGGQLLPMHIDRQGVQVVAQ |
| Ga0193749_10163161 | 3300020010 | Soil | CVVMLIEPGTRGAVEKAVEDAGGQILPMKIDRSGVQVTVF |
| Ga0210399_112034121 | 3300020581 | Soil | LLIEPDARERVEKAIVEAGGEVLPMTIDRQGVQVVSR |
| Ga0210395_109821261 | 3300020582 | Soil | VLLIEPDARTRVESSIVESGAEVLPVTIDRQGVQVISR |
| Ga0210406_101864701 | 3300021168 | Soil | GCVVLLIEPETRERVEAAVVEAGGEVLPMKLDRSGVQVTVS |
| Ga0210387_106121202 | 3300021405 | Soil | IEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR |
| Ga0210386_106469622 | 3300021406 | Soil | LIDPNARERVESAVTDAGGQLLPMKIDRSGVQVNVS |
| Ga0210386_109641581 | 3300021406 | Soil | IEPDARDRVEAAVTDAGGQLLPMRIDRSGVQVTVS |
| Ga0210384_111102292 | 3300021432 | Soil | VLLVEPDARERVETAIQESGGQVLPMTIDRQGVQVVSR |
| Ga0210390_100206426 | 3300021474 | Soil | MLIEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR |
| Ga0210390_106572432 | 3300021474 | Soil | GCVVLLIEPGARARVERAIGEAGAQVLPVKIDRQGVQVISR |
| Ga0210392_101896652 | 3300021475 | Soil | GCVVMLIEPDARERVEAAVTDAGGHLLPMRIDRSGVQVTVS |
| Ga0210402_104718841 | 3300021478 | Soil | GGGCLVLLIEPDARERVEKAVVQCGGELLPMRIDRQGVTVVSQ |
| Ga0210402_111961592 | 3300021478 | Soil | GGCVVLLIEPDARERVEKAIAEAGGEVLPMTIDRQGVQVVSR |
| Ga0210402_118093162 | 3300021478 | Soil | GGCVTLLIEPDARTRVEDAVANAGGRLLPFRIDRGGVRVKISR |
| Ga0137417_14467023 | 3300024330 | Vadose Zone Soil | VVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS |
| Ga0207671_105550531 | 3300025914 | Corn Rhizosphere | MLIEPDARDRVEAAVTDAGGHLLPMRIDRSGVQVTVS |
| Ga0207693_100599201 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIEPGSRGAVEKAIANAGGQVLPMRIDRSGVQVTVS |
| Ga0207820_1129031 | 3300026809 | Tropical Forest Soil | GGCVVLLIEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ |
| Ga0207821_10224201 | 3300026869 | Tropical Forest Soil | GGGGCVVLLIEPEARGRVEKAVVDEGGQLLPMFVDRRGVQVVAQ |
| Ga0207858_10121542 | 3300026909 | Tropical Forest Soil | IEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ |
| Ga0209622_10151751 | 3300027502 | Forest Soil | VVLLIEPDARERVEKAVVEADGQLLPMHIDRQGVQVVAQ |
| Ga0209388_10020801 | 3300027655 | Vadose Zone Soil | LLIEPDTRERVEAAVVEAGGEVLPMKLDRSGVQVNVS |
| Ga0209693_104861112 | 3300027855 | Soil | GGGCVVLLIEPDARTRVEAAIVAAGGEVLPVTIDRQGVQVISR |
| Ga0209579_107340042 | 3300027869 | Surface Soil | IEPEARGRVEKAIRDAGGKILETRIDSQGVQVISR |
| Ga0209283_104611441 | 3300027875 | Vadose Zone Soil | VALVIEPDARDRVEAAVASAGGRLLPMRIDREGVRVRVAK |
| Ga0209275_106935172 | 3300027884 | Soil | LIEPDARDRVEKSVVECGGELLPMRIDRQGVTVVSQ |
| Ga0209067_101297251 | 3300027898 | Watersheds | VVLLIEPDARDRVEKAILEAGGQILPTTIDRQGVQVVSR |
| Ga0209006_110138991 | 3300027908 | Forest Soil | VLLIDPDARDRVESAVTDAGGQVLPMKIDRSGVQVNVS |
| Ga0209526_103809372 | 3300028047 | Forest Soil | LLIEHETREKVEAAVAEAGGEVLPMKIDRSGVQVNVS |
| Ga0209526_105327821 | 3300028047 | Forest Soil | IEPEAREHVEAAVVTAGGQVLPMKIDRSGVQVTVS |
| Ga0255358_10548621 | 3300028069 | Soil | GCVVLLIEPDARERVEKAVAESGGELLPMQIDRQGVTVVTQ |
| Ga0302224_104142041 | 3300028759 | Palsa | EPDARGRVETAIAKAGGQLLPLRIDRQGVQVTSTP |
| Ga0310915_110294312 | 3300031573 | Soil | GCLVLVIEPGVRERVEKAVLDCGGELLPMHIDRQGVTVVSS |
| Ga0318542_105422881 | 3300031668 | Soil | LLIEPDARPRVEKAILDSGGELLPMQIDRQGVTVVSQ |
| Ga0318560_100552543 | 3300031682 | Soil | VLLIEPDARDRAEKAVSEAGGDVLRAAIDRQGVSVVFR |
| Ga0310813_109843401 | 3300031716 | Soil | LIEPDARSSVESAIVAAGGEVLPVRIDRQGVQVISR |
| Ga0307474_109034471 | 3300031718 | Hardwood Forest Soil | LLVEPEARERVEAAVVEAGGDVLPMKIDRSGVQVTVS |
| Ga0307469_115052251 | 3300031720 | Hardwood Forest Soil | CVVLLIEPDARERVEAAVLEAGGEVLPMKIDRSGVQVNVS |
| Ga0307468_1010796851 | 3300031740 | Hardwood Forest Soil | LLIEPDARPRVEKAVVDCGGELLPMRIDRQGVTVVSQ |
| Ga0307478_104995871 | 3300031823 | Hardwood Forest Soil | VLLIEPDARSRVETAIAEAGGEVLPVTIDRQGVQVISR |
| Ga0318512_102102612 | 3300031846 | Soil | LIEPDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ |
| Ga0318512_104105012 | 3300031846 | Soil | VLLIEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ |
| Ga0306923_111624481 | 3300031910 | Soil | VVLLIEPDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ |
| Ga0306926_120332621 | 3300031954 | Soil | VVLLIEPDARERVEKAVLDAGGELLPMRIDRQGVTVVSQ |
| Ga0306926_121204422 | 3300031954 | Soil | GGGCVVLLIEQDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ |
| Ga0306922_108971842 | 3300032001 | Soil | LLIEPDARERVEKAVLDAGGELLPMRIDRQGVTVVSQ |
| Ga0318533_102966841 | 3300032059 | Soil | IEPDARGSVEQAVANAGGQLLPMKIDRSGVQVTVS |
| Ga0318577_102627721 | 3300032091 | Soil | CVVLLIEPDARDRAEKAVTDAGGEVLRAAIDRQGVSVVFR |
| Ga0307470_100621004 | 3300032174 | Hardwood Forest Soil | CLVLLIEPDARERVENSVAECGGELLPMRIDRQGVTVVSQ |
| Ga0307471_1021042262 | 3300032180 | Hardwood Forest Soil | CVVLLIEPDARERVEKAVVESGGELLPMRIDRQGVTVVSQ |
| Ga0306920_1001446082 | 3300032261 | Soil | VVLLIDPETRGRVEKAIVEAGGQLLPMYIDRQGVKVVAQ |
| Ga0348332_120770212 | 3300032515 | Plant Litter | GCVVLLIEPDARTRVEASIVEAGAEVLPVTIDRQGVQVISR |
| Ga0335074_107657952 | 3300032895 | Soil | GGCVVLLIEPDARTSVEAAIVETGAEVLPVTVDRQGVQVISR |
| Ga0335073_104990141 | 3300033134 | Soil | VLLIEPDARERVEKAVVEAGGQLLPMHIDRQGVHVVAQ |
| Ga0335077_118193791 | 3300033158 | Soil | LLIEPDARAAVERAVVAGGGRVLPVRLDRRGVTVRVSR |
| ⦗Top⦘ |