


| Basic Information | |
|---|---|
| Family ID | F074438 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.16 % |
| % of genes from short scaffolds (< 2000 bps) | 92.44 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.378 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.101 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00883 | Peptidase_M17 | 33.61 |
| PF00497 | SBP_bac_3 | 7.56 |
| PF11695 | DUF3291 | 6.72 |
| PF02775 | TPP_enzyme_C | 3.36 |
| PF01613 | Flavin_Reduct | 2.52 |
| PF03703 | bPH_2 | 1.68 |
| PF06965 | Na_H_antiport_1 | 1.68 |
| PF02668 | TauD | 1.68 |
| PF00239 | Resolvase | 1.68 |
| PF07690 | MFS_1 | 1.68 |
| PF02627 | CMD | 0.84 |
| PF00196 | GerE | 0.84 |
| PF01177 | Asp_Glu_race | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| PF13545 | HTH_Crp_2 | 0.84 |
| PF14099 | Polysacc_lyase | 0.84 |
| PF02826 | 2-Hacid_dh_C | 0.84 |
| PF00005 | ABC_tran | 0.84 |
| PF00313 | CSD | 0.84 |
| PF02776 | TPP_enzyme_N | 0.84 |
| PF05638 | T6SS_HCP | 0.84 |
| PF08881 | CVNH | 0.84 |
| PF01810 | LysE | 0.84 |
| PF13669 | Glyoxalase_4 | 0.84 |
| PF01370 | Epimerase | 0.84 |
| PF00941 | FAD_binding_5 | 0.84 |
| PF03458 | Gly_transporter | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 33.61 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 2.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.68 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.68 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.68 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.68 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 1.68 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 1.68 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.84 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.14 % |
| Unclassified | root | N/A | 42.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001279|JGI20214J14112_1041551 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100576550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300003432|JGI20214J51088_10003736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. TF | 10027 | Open in IMG/M |
| 3300004633|Ga0066395_10683827 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005172|Ga0066683_10773822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300005177|Ga0066690_10996976 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005445|Ga0070708_101851324 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005536|Ga0070697_100123281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2169 | Open in IMG/M |
| 3300005536|Ga0070697_102028198 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005553|Ga0066695_10615913 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005610|Ga0070763_10601167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 637 | Open in IMG/M |
| 3300006046|Ga0066652_102078339 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300007258|Ga0099793_10640898 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300007788|Ga0099795_10036591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300009053|Ga0105095_10657293 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009092|Ga0105250_10291269 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009137|Ga0066709_103626528 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009792|Ga0126374_10969956 | Not Available | 664 | Open in IMG/M |
| 3300010043|Ga0126380_10073460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1950 | Open in IMG/M |
| 3300010043|Ga0126380_10315093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1121 | Open in IMG/M |
| 3300010045|Ga0126311_11511860 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010049|Ga0123356_12973693 | Not Available | 592 | Open in IMG/M |
| 3300010162|Ga0131853_10759800 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300010366|Ga0126379_10033839 | All Organisms → cellular organisms → Bacteria | 4029 | Open in IMG/M |
| 3300010366|Ga0126379_10611423 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300010376|Ga0126381_101607869 | Not Available | 939 | Open in IMG/M |
| 3300010398|Ga0126383_11424482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300010399|Ga0134127_12199077 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010413|Ga0136851_10558683 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300011120|Ga0150983_10737624 | Not Available | 623 | Open in IMG/M |
| 3300012202|Ga0137363_10350789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1221 | Open in IMG/M |
| 3300012351|Ga0137386_10640130 | Not Available | 765 | Open in IMG/M |
| 3300012362|Ga0137361_11407180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300012925|Ga0137419_10145203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1706 | Open in IMG/M |
| 3300012971|Ga0126369_10133630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2307 | Open in IMG/M |
| 3300016294|Ga0182041_10072897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2423 | Open in IMG/M |
| 3300016294|Ga0182041_10806487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 839 | Open in IMG/M |
| 3300016319|Ga0182033_10239531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1467 | Open in IMG/M |
| 3300016319|Ga0182033_10361938 | Not Available | 1216 | Open in IMG/M |
| 3300016319|Ga0182033_10875731 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300016341|Ga0182035_10257898 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300016341|Ga0182035_10310863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300016371|Ga0182034_10254495 | Not Available | 1387 | Open in IMG/M |
| 3300016422|Ga0182039_12002325 | Not Available | 533 | Open in IMG/M |
| 3300016445|Ga0182038_10113737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1995 | Open in IMG/M |
| 3300016445|Ga0182038_11547202 | Not Available | 596 | Open in IMG/M |
| 3300018468|Ga0066662_11264538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300020581|Ga0210399_10231711 | Not Available | 1539 | Open in IMG/M |
| 3300021168|Ga0210406_11394207 | Not Available | 500 | Open in IMG/M |
| 3300021170|Ga0210400_11614431 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021171|Ga0210405_11327828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300021178|Ga0210408_10876941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 699 | Open in IMG/M |
| 3300021180|Ga0210396_10551609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300021403|Ga0210397_10354810 | Not Available | 1088 | Open in IMG/M |
| 3300021432|Ga0210384_11398324 | Not Available | 605 | Open in IMG/M |
| 3300021444|Ga0213878_10177338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas hortorum → Xanthomonas hortorum pv. carotae → Xanthomonas hortorum pv. carotae str. M081 | 891 | Open in IMG/M |
| 3300021478|Ga0210402_10205075 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300021479|Ga0210410_10098778 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300021560|Ga0126371_13448019 | Not Available | 534 | Open in IMG/M |
| 3300026089|Ga0207648_10227421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1659 | Open in IMG/M |
| 3300026489|Ga0257160_1013945 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300026530|Ga0209807_1331205 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026552|Ga0209577_10304286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1189 | Open in IMG/M |
| 3300029701|Ga0222748_1028411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
| 3300031562|Ga0310886_10755927 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031679|Ga0318561_10280273 | Not Available | 910 | Open in IMG/M |
| 3300031679|Ga0318561_10428360 | Not Available | 727 | Open in IMG/M |
| 3300031680|Ga0318574_10722557 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031682|Ga0318560_10131680 | Not Available | 1315 | Open in IMG/M |
| 3300031723|Ga0318493_10256955 | Not Available | 934 | Open in IMG/M |
| 3300031744|Ga0306918_10351062 | Not Available | 1144 | Open in IMG/M |
| 3300031748|Ga0318492_10517773 | Not Available | 633 | Open in IMG/M |
| 3300031751|Ga0318494_10328183 | Not Available | 884 | Open in IMG/M |
| 3300031753|Ga0307477_11163078 | Not Available | 502 | Open in IMG/M |
| 3300031763|Ga0318537_10270528 | Not Available | 629 | Open in IMG/M |
| 3300031764|Ga0318535_10191358 | Not Available | 915 | Open in IMG/M |
| 3300031765|Ga0318554_10794812 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031768|Ga0318509_10111334 | Not Available | 1484 | Open in IMG/M |
| 3300031771|Ga0318546_11085204 | Not Available | 563 | Open in IMG/M |
| 3300031777|Ga0318543_10389604 | Not Available | 624 | Open in IMG/M |
| 3300031778|Ga0318498_10314757 | Not Available | 701 | Open in IMG/M |
| 3300031782|Ga0318552_10285765 | Not Available | 838 | Open in IMG/M |
| 3300031798|Ga0318523_10554700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300031821|Ga0318567_10479008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300031823|Ga0307478_10532604 | Not Available | 980 | Open in IMG/M |
| 3300031833|Ga0310917_10053322 | Not Available | 2489 | Open in IMG/M |
| 3300031833|Ga0310917_10613988 | Not Available | 738 | Open in IMG/M |
| 3300031860|Ga0318495_10191985 | Not Available | 920 | Open in IMG/M |
| 3300031879|Ga0306919_11192130 | Not Available | 579 | Open in IMG/M |
| 3300031890|Ga0306925_10060721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3962 | Open in IMG/M |
| 3300031896|Ga0318551_10494198 | Not Available | 701 | Open in IMG/M |
| 3300031897|Ga0318520_10376603 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031897|Ga0318520_10662432 | Not Available | 651 | Open in IMG/M |
| 3300031912|Ga0306921_12397485 | Not Available | 550 | Open in IMG/M |
| 3300031941|Ga0310912_10323286 | Not Available | 1196 | Open in IMG/M |
| 3300031941|Ga0310912_10564829 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031941|Ga0310912_11507553 | Not Available | 506 | Open in IMG/M |
| 3300031942|Ga0310916_10587082 | Not Available | 947 | Open in IMG/M |
| 3300031946|Ga0310910_10111020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2050 | Open in IMG/M |
| 3300031946|Ga0310910_10326474 | Not Available | 1210 | Open in IMG/M |
| 3300031946|Ga0310910_10983013 | Not Available | 660 | Open in IMG/M |
| 3300031947|Ga0310909_10246813 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300031947|Ga0310909_10624048 | Not Available | 899 | Open in IMG/M |
| 3300031947|Ga0310909_11446495 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031954|Ga0306926_10684330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1245 | Open in IMG/M |
| 3300031954|Ga0306926_11103097 | Not Available | 938 | Open in IMG/M |
| 3300032001|Ga0306922_11321835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300032001|Ga0306922_11539951 | Not Available | 663 | Open in IMG/M |
| 3300032001|Ga0306922_11541226 | Not Available | 663 | Open in IMG/M |
| 3300032035|Ga0310911_10810436 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032042|Ga0318545_10074497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum | 1170 | Open in IMG/M |
| 3300032052|Ga0318506_10278712 | Not Available | 741 | Open in IMG/M |
| 3300032054|Ga0318570_10185420 | Not Available | 937 | Open in IMG/M |
| 3300032055|Ga0318575_10240127 | Not Available | 913 | Open in IMG/M |
| 3300032060|Ga0318505_10440190 | Not Available | 616 | Open in IMG/M |
| 3300032063|Ga0318504_10207106 | Not Available | 916 | Open in IMG/M |
| 3300032090|Ga0318518_10633691 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300033289|Ga0310914_10783862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas hortorum → Xanthomonas hortorum pv. carotae → Xanthomonas hortorum pv. carotae str. M081 | 851 | Open in IMG/M |
| 3300033418|Ga0316625_101618575 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001279 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20214J14112_10415511 | 3300001279 | Wetland | ARPLPPEQVARAEILARIKPYAQAWYRTWHEGMVAAPYYAVNSRE* |
| JGIcombinedJ26739_1005765501 | 3300002245 | Forest Soil | PEQRARANLLAKIKPYVQAWYGSWPENMLDQPFYRVNSRT* |
| JGI20214J51088_100037361 | 3300003432 | Wetland | PPEQVARAEILARIKPYAQAWYRTWHEGMVAAPYYAVNSRE* |
| Ga0066395_106838271 | 3300004633 | Tropical Forest Soil | EQRARADLLVRIKPYVQAWYRTWHQGMVDQPFYAVNGRV* |
| Ga0066683_107738221 | 3300005172 | Soil | KGLPEEHRKRAQMLARIKPYAQKWYQGWAEPMVHEPFYRVNSRI* |
| Ga0066690_109969762 | 3300005177 | Soil | LSEEHRKRADMLASIKPYAQQWYRGWDEGIVDTPFYRVNSKA* |
| Ga0070708_1018513242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AKGLTPEQRARADLLRKIKPYVQAWYGTWHENMLDQPFYRVNSRT* |
| Ga0070697_1001232813 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EQRARADLLQKIKPYVQAWYGNWHENMLDQPFYRVNSRT* |
| Ga0070697_1020281982 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AKGLTPEQRARADLLRKIKPYVQAWYGTWHQNMLDQPFYRVNSRT* |
| Ga0066695_106159131 | 3300005553 | Soil | FCANGLTPEQRARADLLARIKPYLQRWYGTWHENMLDRPFYRVNSRV* |
| Ga0070763_106011671 | 3300005610 | Soil | PEQRARADLLQKIKPYVQAWYGNWHENMLDQPFYRVNSRT* |
| Ga0066652_1020783391 | 3300006046 | Soil | KRADMLARIKPYAQQWYRGWHEGMVDQPFYRVNSQT* |
| Ga0099793_106408981 | 3300007258 | Vadose Zone Soil | ADLLRKIKPYVQAWYGTWHENMLDQPFYRVNSRT* |
| Ga0099795_100365913 | 3300007788 | Vadose Zone Soil | AKGLTPEQRARADLLQKIEPYMQAWYGNWHENVLDQPFYRVNSRT* |
| Ga0105095_106572932 | 3300009053 | Freshwater Sediment | PLSSEHATRAEMLARIKPYAQAWYRTWHEGMVELPFYAVNSRV* |
| Ga0105250_102912691 | 3300009092 | Switchgrass Rhizosphere | RADMLARIKPYAQKWYSGWHREMVSEPFYRVNSRV* |
| Ga0066709_1036265281 | 3300009137 | Grasslands Soil | KRADMLAKIKPYAQKWYRGWHEGMVNELFYRVNGSV* |
| Ga0126374_109699561 | 3300009792 | Tropical Forest Soil | RADLLARIKPHVQAWYNSWHEDMLERPFYRVNSRV* |
| Ga0126380_100734601 | 3300010043 | Tropical Forest Soil | EVRAFCARGLPPEQRAHADFLQRIKPYVQAWYRTWHQTMVEQPFYRVNSRT* |
| Ga0126380_103150931 | 3300010043 | Tropical Forest Soil | EVRAFCARGLPPEQRAHADFLQRIKPYVQAWYRTWHQTMVDQPFYRVNSRK* |
| Ga0126311_115118602 | 3300010045 | Serpentine Soil | PDEHRKRADMLARIKPYAQKWYSGWHDKMVNEPFYRVNSRI* |
| Ga0123356_129736931 | 3300010049 | Termite Gut | ARADLLAKIKPYVQNWYGSWRENLLDRPFYPVNSKV* |
| Ga0131853_107598001 | 3300010162 | Termite Gut | RADLLRKIKPYVQAWYCTWHENMLDQPFYRVNSRT* |
| Ga0126379_100338391 | 3300010366 | Tropical Forest Soil | VRAFCARGLPPEQRAHADFLQRIKPYVQAWYRTWHQTMVDQPFYRLNSRK* |
| Ga0126379_106114233 | 3300010366 | Tropical Forest Soil | RARADLLARIKPYAQAWYAGWHDGLVDRPFYRVNSRG* |
| Ga0126381_1016078692 | 3300010376 | Tropical Forest Soil | ARADLLARIKPYVQAWYATWDQNMLDRPFYRVNSGR* |
| Ga0126383_114244821 | 3300010398 | Tropical Forest Soil | PEQRAHADFLQRIKPYVQAWYRTWHQTMVDQPFYRVNSRT* |
| Ga0134127_121990772 | 3300010399 | Terrestrial Soil | ARADMLARIKPYAQKWYSGWHDDMVREPFYRVNSRI* |
| Ga0136851_105586831 | 3300010413 | Mangrove Sediment | LPPEQATRAAMLARIKPYAQAWYAGWHERMVGSPYYAVNSRE* |
| Ga0150983_107376242 | 3300011120 | Forest Soil | SEQGARADLLARIKPYVQAWYATWHQNMLDRPFYRVNSRL* |
| Ga0137363_103507891 | 3300012202 | Vadose Zone Soil | QRARADFLRKIKPYVQAWYGTWHENMLDQPFYRVNSRT* |
| Ga0137386_106401301 | 3300012351 | Vadose Zone Soil | AKGLTPEQHARADLLRKIKPYVQAWYGPWQENMLDQPFYRVNSRT* |
| Ga0137361_114071801 | 3300012362 | Vadose Zone Soil | LTPEQRARADLLRKIKPYVQAWYGAWHENMLDQPFYRVNSRT* |
| Ga0137419_101452031 | 3300012925 | Vadose Zone Soil | TPAQRARADLLRKIKPYVQAWYGSWHENMLDQPFYRVNSRT* |
| Ga0126369_101336304 | 3300012971 | Tropical Forest Soil | TSEQRARADLLASIKPHVQAWYGTWHQNMLDRPFYAVNSRL* |
| Ga0182041_100728971 | 3300016294 | Soil | GLTPEQRAHADFLKKIKPYVQAWYATWHETMLHQPYYRVNSRT |
| Ga0182041_108064871 | 3300016294 | Soil | HANFLQKIKPYVQAWYRTWHQTMVDLPFYRVNSRT |
| Ga0182033_102395311 | 3300016319 | Soil | HAEFFRKIKPYVQAWYGTWHEYMLDQPFYRVNSRT |
| Ga0182033_103619382 | 3300016319 | Soil | REVRAFCARGLTQEQRARADLFARIKPYAQAWYATWHQNMLDRPFYPVNGRV |
| Ga0182033_108757313 | 3300016319 | Soil | EQRARADLLARIKPYVQSWYGTWHHGMVDNPFYAVNGQL |
| Ga0182035_102578984 | 3300016341 | Soil | FCMKGITLEQRARADLLARIKPFVQSWYGTWHHGMVDNPFYAVNGQL |
| Ga0182035_103108631 | 3300016341 | Soil | REVVAFCEKGLSPEQRARADLLARIKPFVQSWYGRWHQGMADQPFYAVNGRT |
| Ga0182034_102544951 | 3300016371 | Soil | TPEQRARAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0182039_120023251 | 3300016422 | Soil | RAEFFRKIKPYVQAWYGTWHETMFDRPFYRVNSRV |
| Ga0182038_101137374 | 3300016445 | Soil | EQRAHADFLKKIKPYVQAWYATWHETMLHQPYYRVNSRT |
| Ga0182038_115472021 | 3300016445 | Soil | KGLTPEQRAHADFLKKIKPYVQAWYATWHETMLDQPFYRVNSRT |
| Ga0066662_112645382 | 3300018468 | Grasslands Soil | EEHRQRADMLAKIKPYMQQWYRGWHEGMVDEPFYRVNSRT |
| Ga0210399_102317111 | 3300020581 | Soil | RARADLLARIKPYVQAWYGTWHENMLDRPFYRANSRI |
| Ga0210406_113942071 | 3300021168 | Soil | PDQRARADLLQKIKPYVQAWYGTWHENMLDQPFYRVNSRT |
| Ga0210400_116144311 | 3300021170 | Soil | TPEQRARADLLGKIKPYVQAWYGSWHENMVDRPFYRVNSRT |
| Ga0210405_113278281 | 3300021171 | Soil | PEQRARADLLGKIKPYVQAWYGSWHENMVDRPFYRVNSRT |
| Ga0210408_108769411 | 3300021178 | Soil | ARADLLQKIKPYVQAWYGNWHENMLDQPFYRVNSRT |
| Ga0210396_105516091 | 3300021180 | Soil | ARADLLQKIKPYVQAWYGTWHENMLDQPFYRVNSRT |
| Ga0210397_103548101 | 3300021403 | Soil | MGADFLQKIKPYVQAWYRTWHQTMVDQPFYRVNSRT |
| Ga0210384_113983241 | 3300021432 | Soil | RARADLLARVKPYAQAWYAGWHDGLVDRPFYRVNSRG |
| Ga0213878_101773382 | 3300021444 | Bulk Soil | RGLTAEQRARADLLARIKPHVQAWYGGWHEDVIERPFYRVNSRV |
| Ga0210402_102050752 | 3300021478 | Soil | ARADLLQKIKPYVQAWYGTWHENMLDQPFYRLNSRT |
| Ga0210410_100987781 | 3300021479 | Soil | LGLTPEQRARADLLRKIKPYVQAWYGTWHENMLDQPFYRVNSRT |
| Ga0126371_134480191 | 3300021560 | Tropical Forest Soil | RAFCARGLTAEQRARADLLARIKPHVQGWYGSWHEDMLEQPFYRVNSRV |
| Ga0207648_102274211 | 3300026089 | Miscanthus Rhizosphere | KRADMLARLKPYMHKWYAGWHDKMVNEPFYRPNSRT |
| Ga0257160_10139451 | 3300026489 | Soil | QRARADLLQKIKPYVQAWYGNWHENVLDQPFYRVNSRT |
| Ga0209807_13312051 | 3300026530 | Soil | ARDLSEEQRQRADMLAKIKPYVQKWYGGWHDGMVNEPFYRVNSRT |
| Ga0209577_103042863 | 3300026552 | Soil | EVRAFCANGLTPEQKARADLLRKIKPYVQSWYSTWHETMLDQPFYRVNSRT |
| Ga0222748_10284112 | 3300029701 | Soil | LTREQRARADLLARIKPYAQAWYGSWHQDMVDRPFYRVNSRA |
| Ga0310886_107559271 | 3300031562 | Soil | RADMLARIKPYAQKWYAGWHDEMVNEPFYRVNSRT |
| Ga0318561_102802731 | 3300031679 | Soil | PEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0318561_104283602 | 3300031679 | Soil | AHAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0318574_107225571 | 3300031680 | Soil | PEQRARADLLARIKPFVQSWYGTWHHGMVDNPFYAVNGQL |
| Ga0318560_101316802 | 3300031682 | Soil | HRARADLLARIKPYVQQWYGTWHENMLDRPFYSVNSRV |
| Ga0318493_102569552 | 3300031723 | Soil | RGLPLEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0306918_103510621 | 3300031744 | Soil | ARAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0318492_105177731 | 3300031748 | Soil | AFCARGLTPEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0318494_103281832 | 3300031751 | Soil | TPEQRARADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0307477_111630782 | 3300031753 | Hardwood Forest Soil | RARADLLQKIKPYVQAWYGTWHENMLDQPFYRVNSRT |
| Ga0318537_102705282 | 3300031763 | Soil | QRARADLLARIKPYVQAWYGTWHETMFDRPFYRVNSRV |
| Ga0318535_101913582 | 3300031764 | Soil | ARADLLARIKPYVQAWYGTWHEDMLNQPYYRANSRV |
| Ga0318554_107948121 | 3300031765 | Soil | CEKGLSPEQRARADLLARIKPFVQSWYGRWHQGMADQPFYAVNGRT |
| Ga0318509_101113341 | 3300031768 | Soil | EQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0318546_110852041 | 3300031771 | Soil | LTPEQRARADLLARVKPYAQAWYADWHRGMVEEPFYKVNSRS |
| Ga0318543_103896042 | 3300031777 | Soil | GLTPEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0318498_103147572 | 3300031778 | Soil | VREFCARGLTPEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0318552_102857652 | 3300031782 | Soil | HRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0318523_105547001 | 3300031798 | Soil | AKGLTPEQRARAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0318567_104790081 | 3300031821 | Soil | KGITPEQRAHADFLKKIKPYVQAWYATWHETMLDQPFYRLNSRT |
| Ga0307478_105326041 | 3300031823 | Hardwood Forest Soil | TREQRARADLLARIKPYAQVWYANWHREMVERSFYRVNSRT |
| Ga0310917_100533224 | 3300031833 | Soil | VREFCARGLPLEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0310917_106139882 | 3300031833 | Soil | REVQALCAKGLTPEQRTRADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0318495_101919852 | 3300031860 | Soil | CAKGLTPEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0306919_111921302 | 3300031879 | Soil | RAFCTKGLAAEQRARADLLARIKPHAQAWYGSWHEDMLERPFYRVNSRV |
| Ga0306925_100607216 | 3300031890 | Soil | RAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0318551_104941981 | 3300031896 | Soil | RADLFARIKPYAQAWYATWHQNMLDRPFYPVNGRV |
| Ga0318520_103766033 | 3300031897 | Soil | YREVVAFCEKGLSPEQRARADLLARIKPFVQSWYGRWHQGMADQPFYAVNGRT |
| Ga0318520_106624322 | 3300031897 | Soil | RARADLLARIKPYVQAWYGTWQQDMVDRPFYRVNSRK |
| Ga0306921_123974852 | 3300031912 | Soil | LCAKGLTPEQRTRADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0310912_103232861 | 3300031941 | Soil | GLTAEQRARADLLARIKPHVQAWYGSWHEDMLERPFYRVNSRV |
| Ga0310912_105648293 | 3300031941 | Soil | MDVDGLYREVVAFCEKGLSPEQRARADLLARIKPFVQSWYGRWHQGMADQPFYAVNGRT |
| Ga0310912_115075533 | 3300031941 | Soil | KGLTLEQRAHADFLRKLKPYVQAWYSTWHETMLDQPFYRVNSRT |
| Ga0310916_105870822 | 3300031942 | Soil | PEQRTRADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0310910_101110203 | 3300031946 | Soil | KGLTPEQRARADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0310910_103264741 | 3300031946 | Soil | RARADLLARIKPYVQAWYGSWHENMLDRPFYPINSRV |
| Ga0310910_109830131 | 3300031946 | Soil | CAKGLTPEQRTRADLLARIKPYVQAWYGAWHDTMLDRPFYPVNSRV |
| Ga0310909_102468134 | 3300031947 | Soil | LTPEQRARAEFFRKIKPYVQTWYGTWHESMLDQPFYRVNSRT |
| Ga0310909_106240481 | 3300031947 | Soil | GLTPEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0310909_114464951 | 3300031947 | Soil | EQRARAEFFRKIKPYVQTWYGTWHESMLDQPFYRVNSRT |
| Ga0306926_106843301 | 3300031954 | Soil | CAKGLTPEQRAHAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0306926_111030972 | 3300031954 | Soil | TKGLAAEQRARADLLARIKPHAQAWYGSWHEDMLERPFYRVNSRV |
| Ga0306922_113218351 | 3300032001 | Soil | AKGLTPEQRAHAEFFRKIKPYVQAWYGTWHESMLDQPFYRVNSRT |
| Ga0306922_115399511 | 3300032001 | Soil | EVRRFWARGLTPQQQARADLLARIKPYVQAWYGAWHETMLDRPFYRVNSRV |
| Ga0306922_115412262 | 3300032001 | Soil | RARADLLARIKPYVQAWYGTWHEDMLNQPYYRANSRV |
| Ga0310911_108104362 | 3300032035 | Soil | DGLYREVVAFCEKGLSPEQRARADLLARIKPFVQSWYGRWHQGMADQPFYAVNGRT |
| Ga0318545_100744973 | 3300032042 | Soil | FCAKGITPEQRAHADFLKKIKPYVQAWYATWHETMLDQPFYRLNSRT |
| Ga0318506_102787122 | 3300032052 | Soil | AKGLTPEQRARADLLARIKPYVQAWYGTWHEDMLNQPYYRANSRV |
| Ga0318570_101854201 | 3300032054 | Soil | ARGLTPEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0318575_102401271 | 3300032055 | Soil | AKGLTPEQRARADLLARIKPYVQAWYGTWHETMLDRPFYRVNSRV |
| Ga0318505_104401903 | 3300032060 | Soil | PEQRAHADFLKKIKPYVQAWYATWHETMLHQPYYRVNSRT |
| Ga0318504_102071061 | 3300032063 | Soil | YREVREFCARGLTPEQRARADLLARIKPYVQTWYGTWHETMLDRPFYRVNSRV |
| Ga0318518_106336911 | 3300032090 | Soil | TPEQRARADLLARIKPFVRSWYGTWHHGMVDNPFYAVNGQL |
| Ga0310914_107838621 | 3300033289 | Soil | CAEGLTSEQRARADLLARIKPYVQAWYRTWHETMVDRPFYRVNSRA |
| Ga0316625_1016185751 | 3300033418 | Soil | ATRAAMLARIKPYAQAWYRTWHEGMVESPFYAVNSRV |
| ⦗Top⦘ |