


| Basic Information | |
|---|---|
| Family ID | F074372 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.39 % |
| % of genes near scaffold ends (potentially truncated) | 34.45 % |
| % of genes from short scaffolds (< 2000 bps) | 57.14 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.983 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (57.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.832 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (68.067 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.56% β-sheet: 0.00% Coil/Unstructured: 47.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF03796 | DnaB_C | 26.89 |
| PF11753 | DUF3310 | 15.13 |
| PF13148 | DUF3987 | 7.56 |
| PF05866 | RusA | 3.36 |
| PF07505 | DUF5131 | 2.52 |
| PF01555 | N6_N4_Mtase | 2.52 |
| PF07120 | DUF1376 | 1.68 |
| PF05876 | GpA_ATPase | 0.84 |
| PF05014 | Nuc_deoxyrib_tr | 0.84 |
| PF13385 | Laminin_G_3 | 0.84 |
| PF00271 | Helicase_C | 0.84 |
| PF00589 | Phage_integrase | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 26.89 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 26.89 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 3.36 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.52 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.52 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.52 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 2.52 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 1.68 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.84 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.98 % |
| All Organisms | root | All Organisms | 42.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002354|B570J29626_1014976 | Not Available | 524 | Open in IMG/M |
| 3300002408|B570J29032_109905614 | Not Available | 2294 | Open in IMG/M |
| 3300002408|B570J29032_109944303 | All Organisms → cellular organisms → Bacteria | 4067 | Open in IMG/M |
| 3300002835|B570J40625_100199143 | Not Available | 2175 | Open in IMG/M |
| 3300002835|B570J40625_101536247 | Not Available | 545 | Open in IMG/M |
| 3300005525|Ga0068877_10240067 | Not Available | 1068 | Open in IMG/M |
| 3300005525|Ga0068877_10296042 | Not Available | 937 | Open in IMG/M |
| 3300005527|Ga0068876_10020714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 4162 | Open in IMG/M |
| 3300005527|Ga0068876_10079815 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300008258|Ga0114840_1047557 | Not Available | 681 | Open in IMG/M |
| 3300008266|Ga0114363_1014907 | Not Available | 3547 | Open in IMG/M |
| 3300008266|Ga0114363_1024940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2588 | Open in IMG/M |
| 3300008266|Ga0114363_1210103 | Not Available | 588 | Open in IMG/M |
| 3300008450|Ga0114880_1024372 | Not Available | 2775 | Open in IMG/M |
| 3300009085|Ga0105103_10585433 | Not Available | 633 | Open in IMG/M |
| 3300009155|Ga0114968_10000429 | All Organisms → cellular organisms → Bacteria | 31236 | Open in IMG/M |
| 3300009165|Ga0105102_10542775 | Not Available | 636 | Open in IMG/M |
| 3300009165|Ga0105102_10827261 | Not Available | 529 | Open in IMG/M |
| 3300013005|Ga0164292_10637254 | Not Available | 685 | Open in IMG/M |
| 3300017761|Ga0181356_1010895 | Not Available | 3478 | Open in IMG/M |
| 3300017774|Ga0181358_1189892 | Not Available | 678 | Open in IMG/M |
| 3300017777|Ga0181357_1109227 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300017777|Ga0181357_1204771 | Not Available | 703 | Open in IMG/M |
| 3300017777|Ga0181357_1272914 | Not Available | 582 | Open in IMG/M |
| 3300017784|Ga0181348_1013664 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
| 3300017784|Ga0181348_1218095 | Not Available | 675 | Open in IMG/M |
| 3300017785|Ga0181355_1347017 | Not Available | 546 | Open in IMG/M |
| 3300019784|Ga0181359_1258449 | Not Available | 524 | Open in IMG/M |
| 3300020048|Ga0207193_1043082 | Not Available | 4892 | Open in IMG/M |
| 3300020530|Ga0208235_1002729 | Not Available | 2713 | Open in IMG/M |
| 3300020536|Ga0207939_1014354 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300020539|Ga0207941_1010679 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300020539|Ga0207941_1019995 | Not Available | 996 | Open in IMG/M |
| 3300020571|Ga0208723_1013727 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300021141|Ga0214163_1014987 | Not Available | 2451 | Open in IMG/M |
| 3300027754|Ga0209596_1000434 | All Organisms → cellular organisms → Bacteria | 38862 | Open in IMG/M |
| 3300027805|Ga0209229_10030846 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
| 3300027805|Ga0209229_10316668 | Not Available | 686 | Open in IMG/M |
| 3300027816|Ga0209990_10021494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3627 | Open in IMG/M |
| 3300031758|Ga0315907_10590887 | Not Available | 863 | Open in IMG/M |
| 3300031857|Ga0315909_10197462 | Not Available | 1598 | Open in IMG/M |
| 3300031857|Ga0315909_10235457 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300031857|Ga0315909_10451576 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031951|Ga0315904_10212860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 1885 | Open in IMG/M |
| 3300031963|Ga0315901_10094530 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300031963|Ga0315901_10783836 | Not Available | 694 | Open in IMG/M |
| 3300031963|Ga0315901_10942935 | Not Available | 609 | Open in IMG/M |
| 3300032092|Ga0315905_10056206 | All Organisms → Viruses → Predicted Viral | 3996 | Open in IMG/M |
| 3300032092|Ga0315905_10111811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2748 | Open in IMG/M |
| 3300032093|Ga0315902_10094363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3259 | Open in IMG/M |
| 3300032116|Ga0315903_10098680 | Not Available | 2796 | Open in IMG/M |
| 3300032116|Ga0315903_10564772 | Not Available | 882 | Open in IMG/M |
| 3300033978|Ga0334977_0001474 | All Organisms → cellular organisms → Bacteria | 13777 | Open in IMG/M |
| 3300033980|Ga0334981_0072162 | Not Available | 1750 | Open in IMG/M |
| 3300033981|Ga0334982_0000149 | All Organisms → cellular organisms → Bacteria | 40617 | Open in IMG/M |
| 3300033981|Ga0334982_0286403 | Not Available | 780 | Open in IMG/M |
| 3300033993|Ga0334994_0049138 | Not Available | 2645 | Open in IMG/M |
| 3300033993|Ga0334994_0057119 | All Organisms → Viruses → Predicted Viral | 2411 | Open in IMG/M |
| 3300033996|Ga0334979_0085531 | All Organisms → Viruses → Predicted Viral | 1984 | Open in IMG/M |
| 3300033996|Ga0334979_0086222 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300033996|Ga0334979_0453953 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300034012|Ga0334986_0013656 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 5727 | Open in IMG/M |
| 3300034012|Ga0334986_0076712 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2049 | Open in IMG/M |
| 3300034018|Ga0334985_0027853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 4336 | Open in IMG/M |
| 3300034018|Ga0334985_0047244 | Not Available | 3205 | Open in IMG/M |
| 3300034018|Ga0334985_0062418 | All Organisms → Viruses → Predicted Viral | 2725 | Open in IMG/M |
| 3300034018|Ga0334985_0405449 | Not Available | 815 | Open in IMG/M |
| 3300034018|Ga0334985_0563962 | Not Available | 642 | Open in IMG/M |
| 3300034018|Ga0334985_0610206 | Not Available | 606 | Open in IMG/M |
| 3300034019|Ga0334998_0499596 | Not Available | 679 | Open in IMG/M |
| 3300034023|Ga0335021_0139639 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300034061|Ga0334987_0074309 | All Organisms → Viruses → Predicted Viral | 2705 | Open in IMG/M |
| 3300034061|Ga0334987_0129263 | All Organisms → Viruses → Predicted Viral | 1887 | Open in IMG/M |
| 3300034061|Ga0334987_0180708 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300034062|Ga0334995_0045500 | Not Available | 3628 | Open in IMG/M |
| 3300034062|Ga0334995_0061791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2995 | Open in IMG/M |
| 3300034062|Ga0334995_0089087 | All Organisms → Viruses → Predicted Viral | 2374 | Open in IMG/M |
| 3300034062|Ga0334995_0118379 | Not Available | 1969 | Open in IMG/M |
| 3300034062|Ga0334995_0732853 | Not Available | 551 | Open in IMG/M |
| 3300034066|Ga0335019_0866810 | Not Available | 504 | Open in IMG/M |
| 3300034092|Ga0335010_0392756 | Not Available | 761 | Open in IMG/M |
| 3300034102|Ga0335029_0019498 | Not Available | 5175 | Open in IMG/M |
| 3300034102|Ga0335029_0060494 | Not Available | 2752 | Open in IMG/M |
| 3300034102|Ga0335029_0070880 | Not Available | 2512 | Open in IMG/M |
| 3300034104|Ga0335031_0025958 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 4285 | Open in IMG/M |
| 3300034104|Ga0335031_0032203 | Not Available | 3819 | Open in IMG/M |
| 3300034104|Ga0335031_0103388 | Not Available | 2006 | Open in IMG/M |
| 3300034104|Ga0335031_0140801 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300034104|Ga0335031_0321888 | Not Available | 998 | Open in IMG/M |
| 3300034104|Ga0335031_0702451 | Not Available | 580 | Open in IMG/M |
| 3300034104|Ga0335031_0851398 | Not Available | 504 | Open in IMG/M |
| 3300034106|Ga0335036_0089179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 2282 | Open in IMG/M |
| 3300034106|Ga0335036_0119479 | Not Available | 1911 | Open in IMG/M |
| 3300034106|Ga0335036_0302756 | Not Available | 1061 | Open in IMG/M |
| 3300034106|Ga0335036_0655444 | Not Available | 628 | Open in IMG/M |
| 3300034106|Ga0335036_0871195 | Not Available | 514 | Open in IMG/M |
| 3300034108|Ga0335050_0021020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 4312 | Open in IMG/M |
| 3300034108|Ga0335050_0028147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3656 | Open in IMG/M |
| 3300034108|Ga0335050_0041119 | Not Available | 2934 | Open in IMG/M |
| 3300034108|Ga0335050_0066712 | Not Available | 2186 | Open in IMG/M |
| 3300034108|Ga0335050_0164869 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300034108|Ga0335050_0176715 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300034108|Ga0335050_0206935 | Not Available | 1011 | Open in IMG/M |
| 3300034108|Ga0335050_0229627 | Not Available | 937 | Open in IMG/M |
| 3300034108|Ga0335050_0526236 | Not Available | 500 | Open in IMG/M |
| 3300034112|Ga0335066_0001510 | All Organisms → cellular organisms → Bacteria | 16760 | Open in IMG/M |
| 3300034112|Ga0335066_0521460 | Not Available | 627 | Open in IMG/M |
| 3300034112|Ga0335066_0564062 | Not Available | 594 | Open in IMG/M |
| 3300034118|Ga0335053_0117499 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1823 | Open in IMG/M |
| 3300034119|Ga0335054_0190273 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300034120|Ga0335056_0271149 | Not Available | 951 | Open in IMG/M |
| 3300034122|Ga0335060_0506886 | Not Available | 621 | Open in IMG/M |
| 3300034272|Ga0335049_0012913 | Not Available | 6234 | Open in IMG/M |
| 3300034272|Ga0335049_0044386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 3307 | Open in IMG/M |
| 3300034272|Ga0335049_0263715 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
| 3300034279|Ga0335052_0026840 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 3592 | Open in IMG/M |
| 3300034280|Ga0334997_0083782 | Not Available | 2157 | Open in IMG/M |
| 3300034283|Ga0335007_0024742 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Pirellula → unclassified Pirellula → Pirellula sp. SH-Sr6A | 4736 | Open in IMG/M |
| 3300034284|Ga0335013_0214270 | Not Available | 1269 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 57.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.52% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002354 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29626_10149761 | 3300002354 | Freshwater | MTESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPAR |
| B570J29032_1099056144 | 3300002408 | Freshwater | MTDDHEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKTHPARRAGK* |
| B570J29032_1099443036 | 3300002408 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK* |
| B570J40625_1001991434 | 3300002835 | Freshwater | MKESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKTHEAWRAGK* |
| B570J40625_1015362472 | 3300002835 | Freshwater | MTDDEKTRNLRDKVYLLEMRVKILQERNKELRQWITKLTTKNHPARRAGK* |
| Ga0068877_102400672 | 3300005525 | Freshwater Lake | MTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWINKLTTKDHPARRAGK* |
| Ga0068877_102960422 | 3300005525 | Freshwater Lake | MTDDEKTRKLQDKVYWLELRVKLLQARNKELRQWINKLTTKDHPARRAGK* |
| Ga0068876_100207144 | 3300005527 | Freshwater Lake | MTDDEKTRKLQDKVYWLEMRVKILQERNKELRQWITKLTTKNHPARRAGK* |
| Ga0068876_100798154 | 3300005527 | Freshwater Lake | MKENDDEKTRNLQDKVYWLELRVKLLQARNKELRQWINKLTTKDHPARRAGK* |
| Ga0114840_10475571 | 3300008258 | Freshwater, Plankton | MTDDEKTRNLQDKVYWLEMRVKLLQARNKELRKWINKLTNKTHEARRAGK* |
| Ga0114363_10149072 | 3300008266 | Freshwater, Plankton | MKENDDEKTRKLQDKVYWLEMRVKLLQARNKELRQWINKLTTKDHPARKAGK* |
| Ga0114363_10249403 | 3300008266 | Freshwater, Plankton | MTDDEKTRKLQDKVYWLEMRVKILQERNKELRQWITKLTTK |
| Ga0114363_12101031 | 3300008266 | Freshwater, Plankton | MTDDEKTRKLQDKVYWLEMRVKVLQERNKELRQWINKLTTKDHPARRAGK* |
| Ga0114880_10243725 | 3300008450 | Freshwater Lake | MKENDDEKTRKLQDKVYWLEMRVKLLQARNKELRQWINKLTTKDHPARRAG |
| Ga0105103_105854332 | 3300009085 | Freshwater Sediment | MTDDEKTRNLQDKVYWLEMRVRLLQERNKELRQWFTKLTNKNHPARRAG |
| Ga0114968_1000042927 | 3300009155 | Freshwater Lake | MTTEETRKLQDKVYCLELRVKLSQARNKELRQWIAKLTSKTHPARRAGK* |
| Ga0105102_105427752 | 3300009165 | Freshwater Sediment | MTDDEKTRNLQDKVYWLEMRIKVLQERNKELRQWIAKLTNKNHPARRAG |
| Ga0105102_108272612 | 3300009165 | Freshwater Sediment | MTGKGDTDDNDTRNLLDKVYWLEMRVKILQERNKELRQWITKLTN |
| Ga0164292_106372541 | 3300013005 | Freshwater | GFGSGSGATMTDDEKTRNLQDKVYWLEMRVKILQERNKELRQWITKLTNKTHEARRAGK* |
| Ga0181356_10108953 | 3300017761 | Freshwater Lake | MLFRPLLTMSVLSMKASKTDDEKTRNLRDKVYRLQMRVKLLQARNKELRQWITKLTNKTHPARRGGK |
| Ga0181358_11898922 | 3300017774 | Freshwater Lake | MTDDEKTRNLRDKVYRLKLQVKYLQRRNKEQKQWINKLTNKTHEARRAGK |
| Ga0181357_11092273 | 3300017777 | Freshwater Lake | MKESDDEKTRKLQYKVYWLEMRVKLLQARNKELRQWITKLTNKNHPA |
| Ga0181357_12047712 | 3300017777 | Freshwater Lake | MTDDEKTRNLRDKVYRLQMRVKLLQARNKELRQWITKLTNKTHPARRGGK |
| Ga0181357_12729142 | 3300017777 | Freshwater Lake | MTDDEKTRKLQDKVYWLQMRVKLLQERNKELRQWITKLTNKTHPARRAGK |
| Ga0181348_10136642 | 3300017784 | Freshwater Lake | MTDDEKTRNLRDKVYRLKLQVKYLQRRNKEQKQWINKLTNKNHPARRAGK |
| Ga0181348_12180952 | 3300017784 | Freshwater Lake | GSGSGATMTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKTHEARRAGK |
| Ga0181355_13470173 | 3300017785 | Freshwater Lake | MTDDEKTRKLQYKVYWLEMRVKLLQERNKELRKWITKLTNKTHEARKAGK |
| Ga0181359_12584491 | 3300019784 | Freshwater Lake | GTGATMTNDEKTRNLRDKVYRLQMRVKLLQARNKELRQWITKLTNKTHPARRAGK |
| Ga0207193_10430824 | 3300020048 | Freshwater Lake Sediment | MTDDDEKTRKLRDKVYRLKLRVKLLQARNKELRQWITKLTNKNHPARRAGK |
| Ga0208235_10027294 | 3300020530 | Freshwater | MTDDHEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKTHPARRAGK |
| Ga0207939_10143543 | 3300020536 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0207941_10106793 | 3300020539 | Freshwater | MTDDDEKTRKLQGKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0207941_10199953 | 3300020539 | Freshwater | ESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0208723_10137273 | 3300020571 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0214163_10149875 | 3300021141 | Freshwater | MTDDEKTRNLQDKVYWLEMRVRILQERNKELRQWIAKLTNKNHPARRAGK |
| Ga0209596_100043427 | 3300027754 | Freshwater Lake | MTTEETRKLQDKVYCLELRVKLSQARNKELRQWIAKLTSKTHPARRAGK |
| Ga0209229_100308464 | 3300027805 | Freshwater And Sediment | MTDDEKTRKLQDKVYWLELRVKLLQARNKELRQWINKLTTKDHPARRAGK |
| Ga0209229_103166683 | 3300027805 | Freshwater And Sediment | MTDDEKTRNLQDKVYWLELRVKLLQARNKELRQWINQLTNKNHPARR |
| Ga0209990_100214944 | 3300027816 | Freshwater Lake | MTDDEKTRKLQDKVYWLEMRVKILQERNKELRQWITKLTTKNHPARRAGK |
| Ga0315907_105908872 | 3300031758 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWINKLTTKDHPARRAGK |
| Ga0315909_101974624 | 3300031857 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQARNKELRKWINKLTNKTHEARRAGK |
| Ga0315909_102354572 | 3300031857 | Freshwater | MTDNEKTRKLQDKVYWLEMRVKLLQERNKELRQWINKLTTKDHPARRAGK |
| Ga0315909_104515761 | 3300031857 | Freshwater | TRKLQDKVYWLEMRVKLLQERNKELRQWINKLTTKDHPARKAGK |
| Ga0315904_102128602 | 3300031951 | Freshwater | MTDDEKTRNLQDKVYWLELRVKLLQARNKELRQWINQLTNKNHPARRAGK |
| Ga0315901_100945307 | 3300031963 | Freshwater | TMTDDEKTRKLQDKVYWLELRVKLLQARNKELRQWINKLTTKDHPARRAGK |
| Ga0315901_107838361 | 3300031963 | Freshwater | MTDDEKTRKLQDKVYWLELRVKLLQARNKELRQWINKLTTK |
| Ga0315901_109429351 | 3300031963 | Freshwater | MKENDDEKTRKLQDKVYWLEMRVKLLQARNKELRQWINKLTTKDHPARKAGK |
| Ga0315905_100562066 | 3300032092 | Freshwater | MTDDDEKTRNLRDKVFRLQMRVKLLQTRNKELRQWIAKLTNKNHPARRAGK |
| Ga0315905_101118114 | 3300032092 | Freshwater | MTDDKKTRKLQDKVYWLEMRVKLLQARNKELRQWITKLTNKTHEARRAGK |
| Ga0315902_100943634 | 3300032093 | Freshwater | MTDDEKTRKLQDKVYWLEMRLRISQERNKELRQWINRLTNKNH |
| Ga0315903_100986802 | 3300032116 | Freshwater | MKENDDEKTRKLQDKVYWLEMRVKLLQARNKELRQWINKLTTKDHPARRAGK |
| Ga0315903_105647722 | 3300032116 | Freshwater | GSGATMTDDEKTRNLQDKVYWLELRVKLLQARNKELRQWINKLTTKDHPARRAGK |
| Ga0334977_0001474_7786_7938 | 3300033978 | Freshwater | MTDDEKTRKLRDKVYRLELRVKLLQERNKELRQWITQLTNKNHPARRAGK |
| Ga0334981_0072162_752_907 | 3300033980 | Freshwater | MTDDDEKTRNLRDKVYRLKIRVKLLQARNKELRQWITKLTNKTHPARRAGK |
| Ga0334982_0000149_31193_31345 | 3300033981 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKLLQERNKGLRQWITKLTNKTHPARRAGK |
| Ga0334982_0286403_40_192 | 3300033981 | Freshwater | MTDDEKTRNLRDKVYRLEMRVKLLQARNKELRKWITKLTNKTHEARRAGK |
| Ga0334994_0049138_242_394 | 3300033993 | Freshwater | MTDDEKTRNLRDKVYLLEMRVKILQERNKELRQWITKLTTKNHPARRAGK |
| Ga0334994_0057119_2275_2409 | 3300033993 | Freshwater | MTDDDEKTRKLQGKVYWLEMRVKLLQERNKELRQWITKLTNKNHP |
| Ga0334979_0085531_3_140 | 3300033996 | Freshwater | MTDDEKTRNLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPAR |
| Ga0334979_0086222_3_137 | 3300033996 | Freshwater | MTESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTTKNH |
| Ga0334979_0453953_568_699 | 3300033996 | Freshwater | LQDKVYWLEMRVKILQERNKELRQWITKLTNKNHPARRAGKCN |
| Ga0334986_0013656_5086_5238 | 3300034012 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQARNKELRKWITKLTNKTHEARRAGK |
| Ga0334986_0076712_1882_2049 | 3300034012 | Freshwater | SMTESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0334985_0027853_2902_3054 | 3300034018 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKILQERNKELRQWITKLTNKNHPARRAGK |
| Ga0334985_0047244_2931_3086 | 3300034018 | Freshwater | MTDDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0334985_0062418_83_235 | 3300034018 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWINKLTNKNHPARRAGK |
| Ga0334985_0405449_1_126 | 3300034018 | Freshwater | MTDDDEKTRNLRDKVYRLKMRVKLLQERNKELRQWITKLTNK |
| Ga0334985_0563962_3_140 | 3300034018 | Freshwater | MTDDEKTRNLQDKVYKLKLQVKYLQKRNKELRQWITKLTNKNHPAR |
| Ga0334985_0610206_350_514 | 3300034018 | Freshwater | MKESETDDEKTRSLQDKVYWLEMRVKLLQKRNKELLKCVRQLTNKNHPARRAGK |
| Ga0334998_0499596_1_138 | 3300034019 | Freshwater | MTDDEKTRNLRDKVYRLEMRVKLLQARNKELRQWITKLTKKSHPAR |
| Ga0335021_0139639_512_664 | 3300034023 | Freshwater | MTDDEKTRNLRDKVYRLEMRVKLLQARNKELRKWITKLTNKTHPARRAGK |
| Ga0334987_0074309_37_189 | 3300034061 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKTHPARRAGK |
| Ga0334987_0129263_678_830 | 3300034061 | Freshwater | MTDDEKTRNLQDKVYWLELRVKLLQERNKELRQWINKLTNKNHPARRAGK |
| Ga0334987_0180708_782_940 | 3300034061 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKILQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0334995_0045500_3278_3430 | 3300034062 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKILQERNKELRQWITKLTNKNHPARRAGK |
| Ga0334995_0061791_2852_2995 | 3300034062 | Freshwater | MTDDDEKTRNLLDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARR |
| Ga0334995_0089087_983_1135 | 3300034062 | Freshwater | MTDDEKTRSLQDKVYWLEMRVKLLQARNKELRQWIAKLTNKNHPARRAGK |
| Ga0334995_0118379_816_971 | 3300034062 | Freshwater | MIDDDEKTRNLRDKVYRLKLKVKLLQKRNKEQKQWINKLTNKNHPARRAGK |
| Ga0334995_0732853_417_551 | 3300034062 | Freshwater | MNDDEKTRNLQDKVYWLEMRVKLLQARNKELRQWITKLTTKNHPA |
| Ga0335019_0866810_315_473 | 3300034066 | Freshwater | MKESDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335010_0392756_592_759 | 3300034092 | Freshwater | MSESSMKESDDDEKTRKLQDKVYWLKLQVKYLQKRNKEQKQWINKLTNKNHPARRA |
| Ga0335029_0019498_4310_4468 | 3300034102 | Freshwater | MRESDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWIAKLTNKNHPARRAGK |
| Ga0335029_0060494_2348_2500 | 3300034102 | Freshwater | MTDDEKIRKLQDKVYWLEMRVKLLQKRNKELRQWITKLTNKNHPARKAGK |
| Ga0335029_0070880_3_155 | 3300034102 | Freshwater | MSDDDEKTRNLQDKVYWLEMRVKLLQKRNKELRQWITKLTNKNHPARKAGK |
| Ga0335031_0025958_2905_3063 | 3300034104 | Freshwater | MKENDDEKTRKLQDKVYWLEMRVRLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335031_0032203_3163_3318 | 3300034104 | Freshwater | MTDDDEKTRKLQDKVYWLEMRVKLLQARNKELRQWITKLTTKNHPARRAGK |
| Ga0335031_0103388_1_132 | 3300034104 | Freshwater | MTDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHP |
| Ga0335031_0140801_1464_1616 | 3300034104 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKILQERNKELRQWINKLTNKNHPARRAGK |
| Ga0335031_0321888_695_847 | 3300034104 | Freshwater | MTDDEKTRNLQDKAYWLEMRVKILEARNKELRQWITKLTNKNHPARRAGK |
| Ga0335031_0702451_382_579 | 3300034104 | Freshwater | SKLSLTMSGLSMKESDDEKTRNLQDKVYWLELRVKILQERNKELLKCVRQLTNKNHPARRAGKCK |
| Ga0335031_0851398_1_165 | 3300034104 | Freshwater | SGATMTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWINKLTNKNHPARRAGK |
| Ga0335036_0089179_523_675 | 3300034106 | Freshwater | MTDDEKTRNLQDKVYWLELRVKILQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335036_0119479_1746_1904 | 3300034106 | Freshwater | MKESDDEKTRNLQDKVYWLELRVKYLQKRNKEQKQWINKLTNKNHPARRAGK |
| Ga0335036_0302756_499_657 | 3300034106 | Freshwater | MRESDDEKTRNLQDKVYRLKLQVKYLQKRNKEQKQWINKLTNKNHPARRAGK |
| Ga0335036_0655444_1_156 | 3300034106 | Freshwater | TMTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335036_0871195_2_127 | 3300034106 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRKWISKLTNKN |
| Ga0335050_0021020_445_603 | 3300034108 | Freshwater | MTDDEKTRNLQDKVYWLELRVKILQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0335050_0028147_1_135 | 3300034108 | Freshwater | MTDDDEKTRNLLDKVYWLEMRVKLLQERNKELRQWITKLTNKNHP |
| Ga0335050_0041119_714_872 | 3300034108 | Freshwater | MKESDDEKTRNLQDKVYRLKLQVKYLQKRNKEQKQWINKLTNKNHPARRAGK |
| Ga0335050_0066712_2052_2186 | 3300034108 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPA |
| Ga0335050_0164869_99_251 | 3300034108 | Freshwater | MTDDEKTRNLQDKVYWLQMRVKILQERNKELRQWITKLTTKNHPARRAGK |
| Ga0335050_0176715_314_478 | 3300034108 | Freshwater | MKESDDEKTRNLQDKVYRLKLQVKYLQERNKEQKQWINKLTNKNHPARRAGKCK |
| Ga0335050_0206935_710_862 | 3300034108 | Freshwater | MTDDEKTRNLQDKVYWLEMRVKLLQERNKELRKWINKLTNKNHPARRAEK |
| Ga0335050_0229627_1_144 | 3300034108 | Freshwater | DENTRKLQDKVYWLEMRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335050_0526236_158_316 | 3300034108 | Freshwater | MRESDDEKTRNLQDKVYWLELRVKILQERNKELRQWINKLTNKNHPARRAGK |
| Ga0335066_0001510_5273_5425 | 3300034112 | Freshwater | MNDDEKIRKLQDKVYWLELRVKILQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335066_0521460_487_627 | 3300034112 | Freshwater | EKTRNLRDKVYRLEMRVKLLQARNKELRKWITKLTNKTHEARRAGK |
| Ga0335066_0564062_17_169 | 3300034112 | Freshwater | MTDDEKTRNLRDKVYLLEMRVKILQERNKELRQWVNKLTNKNHPARRAGK |
| Ga0335053_0117499_1_180 | 3300034118 | Freshwater | MSELSMTESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0335054_0190273_96_257 | 3300034119 | Freshwater | MTDDDEKTRNLRDKVYRLKMRVKLLQERNKELRQWITKLTNKTHEARRAGKCK |
| Ga0335056_0271149_419_577 | 3300034120 | Freshwater | MRESDDEKTRNLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335060_0506886_3_143 | 3300034122 | Freshwater | MTDDHEKTRKLQDKVYWLEMRVKLLQERNKELRQWIAKLTNKNHPAR |
| Ga0335049_0012913_4139_4303 | 3300034272 | Freshwater | MKESETDDEKTRSLQDKVYWLEMRVKILQERNKELRQWITKLTTKNHPARRAGK |
| Ga0335049_0044386_237_389 | 3300034272 | Freshwater | MTDDEKTRKLQDKVYWLEMRVKLLQERNKELRQWIAKLTNKNHPARRAGK |
| Ga0335049_0263715_990_1151 | 3300034272 | Freshwater | MTDDDEKTRNLRDKVYWLEMRVKILQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0335052_0026840_2812_2970 | 3300034279 | Freshwater | MTDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKNHPARRAGKCK |
| Ga0334997_0083782_1324_1482 | 3300034280 | Freshwater | MKESDDEKTRKLQDKVYWLELRVKLLQERNKELRQWITKLTNKTHEAWRAGK |
| Ga0335007_0024742_3613_3765 | 3300034283 | Freshwater | MTDDEKTHNLQDKVYWLELRVKILQERNKELRQWITKLTNKNHPARRAGK |
| Ga0335013_0214270_428_580 | 3300034284 | Freshwater | MTDDEKTRNLQDKVYKLKLQVKYLQKRNKELRQWITKLTNKNHPARRAGK |
| ⦗Top⦘ |