


| Basic Information | |
|---|---|
| Family ID | F074180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTSASARTVANVVLVSAGVAAAYVVMTTPPLRRLAVRA |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.89 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 94.17 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF12732 | YtxH | 88.33 |
| PF02954 | HTH_8 | 1.67 |
| PF13450 | NAD_binding_8 | 0.83 |
| PF00743 | FMO-like | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.33 % |
| Unclassified | root | N/A | 11.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02J3LZ9 | Not Available | 514 | Open in IMG/M |
| 3300001380|JGI1356J14229_10061687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
| 3300005177|Ga0066690_10311150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300005440|Ga0070705_101714649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005456|Ga0070678_100647907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300005549|Ga0070704_101627272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005556|Ga0066707_10980966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300005614|Ga0068856_102463866 | Not Available | 527 | Open in IMG/M |
| 3300005616|Ga0068852_101734018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005618|Ga0068864_102411056 | Not Available | 532 | Open in IMG/M |
| 3300005618|Ga0068864_102638064 | Not Available | 508 | Open in IMG/M |
| 3300005764|Ga0066903_101915188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300005844|Ga0068862_101578930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300005844|Ga0068862_102503962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006046|Ga0066652_100510921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300006237|Ga0097621_101615346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300006903|Ga0075426_10108431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1992 | Open in IMG/M |
| 3300009137|Ga0066709_100163590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2868 | Open in IMG/M |
| 3300009143|Ga0099792_10350433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300010126|Ga0127482_1122497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300010145|Ga0126321_1476268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300010146|Ga0126320_1380201 | Not Available | 506 | Open in IMG/M |
| 3300010146|Ga0126320_1503954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300010147|Ga0126319_1110846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300010147|Ga0126319_1265114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300010398|Ga0126383_13693946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300010401|Ga0134121_11565307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010870|Ga0102750_10004643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300010870|Ga0102750_10936516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300010872|Ga0136897_10487514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300010872|Ga0136897_10584701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300010872|Ga0136897_11254034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300010874|Ga0136264_10066987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300010874|Ga0136264_10203543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300010874|Ga0136264_10260575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010878|Ga0136899_10030062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300011332|Ga0126317_10312081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300011332|Ga0126317_10947712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300012212|Ga0150985_105250647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300012212|Ga0150985_107797176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300012212|Ga0150985_108107818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012212|Ga0150985_111427357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
| 3300012212|Ga0150985_111575897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300012212|Ga0150985_116023956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300012393|Ga0134052_1327353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300012396|Ga0134057_1144925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300012407|Ga0134050_1419224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300012469|Ga0150984_100263588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| 3300012469|Ga0150984_104770061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300012469|Ga0150984_107440559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300012469|Ga0150984_108084724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300012469|Ga0150984_112947583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300012469|Ga0150984_118259449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300012469|Ga0150984_120950378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300012923|Ga0137359_10807064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300012944|Ga0137410_10067502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2585 | Open in IMG/M |
| 3300014502|Ga0182021_11694509 | Not Available | 761 | Open in IMG/M |
| 3300014745|Ga0157377_10737875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300014969|Ga0157376_11825165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300015242|Ga0137412_10703771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300017656|Ga0134112_10324200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300018432|Ga0190275_12797460 | Not Available | 564 | Open in IMG/M |
| 3300018468|Ga0066662_10174475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
| 3300019255|Ga0184643_1315154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300019269|Ga0184644_1567560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300019279|Ga0184642_1132100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300019377|Ga0190264_10552510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300020070|Ga0206356_11729050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300021151|Ga0179584_1162215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300021315|Ga0179958_1074922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300021344|Ga0193719_10180971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300021861|Ga0213853_11531874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300021951|Ga0222624_1092864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300025913|Ga0207695_10429251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300025932|Ga0207690_11415008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300025938|Ga0207704_10577835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300025938|Ga0207704_10598398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300025941|Ga0207711_10378735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300025949|Ga0207667_11416762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300026095|Ga0207676_11991867 | Not Available | 579 | Open in IMG/M |
| 3300026305|Ga0209688_1069488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300027821|Ga0209811_10002763 | All Organisms → cellular organisms → Bacteria | 5752 | Open in IMG/M |
| 3300027907|Ga0207428_10649839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300028065|Ga0247685_1039528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300028536|Ga0137415_10116262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2522 | Open in IMG/M |
| 3300028554|Ga0302047_10260206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300028554|Ga0302047_10321405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300028554|Ga0302047_10392495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300028554|Ga0302047_10753631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300028784|Ga0307282_10645934 | Not Available | 513 | Open in IMG/M |
| 3300028807|Ga0307305_10228171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300030784|Ga0102758_10783484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300030785|Ga0102757_10119906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300030839|Ga0073999_10838191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300030866|Ga0102744_1732243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300030867|Ga0102749_1470243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300030905|Ga0308200_1016926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300030960|Ga0102745_1020721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300030993|Ga0308190_1186014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300031023|Ga0073998_10677795 | Not Available | 574 | Open in IMG/M |
| 3300031058|Ga0308189_10027700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300031058|Ga0308189_10039605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300031058|Ga0308189_10056282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300031058|Ga0308189_10157977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300031058|Ga0308189_10342284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031091|Ga0308201_10191975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031092|Ga0308204_10018359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300031092|Ga0308204_10020607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
| 3300031092|Ga0308204_10091932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300031093|Ga0308197_10027321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300031097|Ga0308188_1008593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300031114|Ga0308187_10283718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300031123|Ga0308195_1010501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031573|Ga0310915_10712889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031782|Ga0318552_10547042 | Not Available | 591 | Open in IMG/M |
| 3300031942|Ga0310916_11671746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300032002|Ga0307416_102069326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.50% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 5.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 5.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010872 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5) | Environmental | Open in IMG/M |
| 3300010874 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3) | Environmental | Open in IMG/M |
| 3300010878 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028554 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030784 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030839 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030866 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030867 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030960 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_09514350 | 2170459003 | Grass Soil | MTDASARTAANLILASAGIAAAYVVLTKPPLRRVASLAVRIWLGASVP |
| JGI1356J14229_100616871 | 3300001380 | Groundwater | MTDATARTVANVVLASAAAAATYVVLTRPPLRRLA |
| Ga0066690_103111503 | 3300005177 | Soil | MTAPSARTVANAVLATAGVAAAYVVITTPPLRRFALRGIRW |
| Ga0070705_1017146491 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDANARTAANVILVSAGIAAAYVILTRPPLRRLALRAAEIWLGASV |
| Ga0070678_1006479073 | 3300005456 | Miscanthus Rhizosphere | MTEANARTVANVVLVSAGVAAAYVILTKPPLRRLAFRAVE |
| Ga0070704_1016272721 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSANARTVANVVLATAGVAAAYVIWTTPSLRRLALRGARLWLG |
| Ga0066707_109809661 | 3300005556 | Soil | MTATTARTVANVVLASAGVAAACVVLTTPPLRRLAVR |
| Ga0068856_1024638662 | 3300005614 | Corn Rhizosphere | MTDEQARTAADLVLVSAGIAVAYVVLSRPRLRRFAFRAIRYWLG |
| Ga0068852_1017340182 | 3300005616 | Corn Rhizosphere | MTDARARTAANVVLASAGIAAAFVVLTKPPLRRLAFRAVELWLGASVP |
| Ga0068864_1024110562 | 3300005618 | Switchgrass Rhizosphere | MTDANARTAANLVLASAGIAAAYVVLTKPPLRRLAFRAVEYW |
| Ga0068864_1026380642 | 3300005618 | Switchgrass Rhizosphere | MTDANARTAANVVLVGAGVAAAYVILTKRPLRRLAFKAFEFWLGAS |
| Ga0066903_1019151881 | 3300005764 | Tropical Forest Soil | VTREHARTAANVLIASAGVAAAYVVLTTPPLRRLAFQAMRV |
| Ga0068862_1015789302 | 3300005844 | Switchgrass Rhizosphere | MTDANARTAANLILVSAGIAAAYVILSKPPLRRLALRAAEIWLGASVPV |
| Ga0068862_1025039621 | 3300005844 | Switchgrass Rhizosphere | MTGATARSVANVVLISAGVAAAYVVVTTPPLRRLA |
| Ga0066652_1005109213 | 3300006046 | Soil | MTTGTARTVANVLLASAGLAAAYVILTTPPLRRLAL |
| Ga0097621_1016153461 | 3300006237 | Miscanthus Rhizosphere | MTDASARTAANLILASAGLAAAYAVLTKPPLRRVASLAVRF |
| Ga0075426_101084311 | 3300006903 | Populus Rhizosphere | MTRTTARTVANVVLATAGVAAAYVVITTPPLRRLA |
| Ga0066710_1046131032 | 3300009012 | Grasslands Soil | MTQAEARTAANAILVTAGVAVAYAVLSTPPLRRLAAQCARVWLCRAVP |
| Ga0066709_1001635905 | 3300009137 | Grasslands Soil | MTEPTARTVANAVLATAGVAAAYVVITTPPLRRLA |
| Ga0099792_103504331 | 3300009143 | Vadose Zone Soil | MTQAQARTVANVILATAGVAAAYVVLTTPPLRRLA |
| Ga0127482_11224973 | 3300010126 | Grasslands Soil | MTDSEARSVANVVLVGAGLAAAYVFITTPPLRRLAATGIRW |
| Ga0126321_14762681 | 3300010145 | Soil | MTRSTARAVANVALITSGVAAAYVVVTTPPLRRLAVNSFRWWL |
| Ga0126320_13802011 | 3300010146 | Soil | MTSTNARTVANVVLASAGAAAVYVVMTTPSLRRLAVQ |
| Ga0126320_15039543 | 3300010146 | Soil | MTDADARNAADLILASAAVVAAYVVLTKPPLRRLAFAAVRYWL |
| Ga0126319_11108464 | 3300010147 | Soil | MAGPVARTVANAVLVSAGVAAAYVIVTTPSLRRLAIGA |
| Ga0126319_12651141 | 3300010147 | Soil | MTDRNARTAANVVLVSAGVAAAYLVLTRPPLRRLAFRAVQLYL |
| Ga0126383_136939462 | 3300010398 | Tropical Forest Soil | MTRDAARTTANVVLASAGVAAAYVVFTTPPLRRVVVRGLRLW |
| Ga0134121_115653071 | 3300010401 | Terrestrial Soil | VTRDRARTVANVLIASAGVAAAYVVLTTPPLRRLAFQAVRVWLG |
| Ga0102750_100046434 | 3300010870 | Soil | MTRADARTAANLVLVAAGVAAAYVVITTPPLRRLAVRATRNKNKGKK* |
| Ga0102750_109365162 | 3300010870 | Soil | MTGASARTTANLVLAVAGVAAAYVVVTTPPLRRNEIK* |
| Ga0136897_104875143 | 3300010872 | Soil | MTKATARATANLMLTAAGVAAAYVVITTPPLRRQNNT |
| Ga0136897_105847011 | 3300010872 | Soil | MTTESARTASNAILVTAGVVAAYVVLTTPPLRRLALNEGKN* |
| Ga0136897_112540341 | 3300010872 | Soil | MTSESARTASTMILVSAGVAAAYVVLTTPPLRRLV |
| Ga0136264_100669873 | 3300010874 | Soil | MTTESARTASTAILVTAGVAAAYVVLTTPPLRRLAFMGVKTADT |
| Ga0136264_102035432 | 3300010874 | Soil | MTSESARTASTMILVSAGVAAAYVVLTTPSLRRLVDLR |
| Ga0136264_102605752 | 3300010874 | Soil | MTTDSARTASNAILLAAGVAAAYVVLTTPPLRRLAVTGGKRIRKKK |
| Ga0136899_100300621 | 3300010878 | Soil | MTKATARATANLMLTAAGVAAAYVVITTPPLRRQNNTDD |
| Ga0126317_103120812 | 3300011332 | Soil | MDRATARTVANLVLVSAGAAVAYVVITTPPLRRLAWAG |
| Ga0126317_109477121 | 3300011332 | Soil | MTSDSARTASTVILVSAGLAAAYVVLTTPPLRRLALMGVRW |
| Ga0150985_1052506473 | 3300012212 | Avena Fatua Rhizosphere | MTPQQARTAANIILGTAGLVAAYVVITTPPLRRLKQANNV |
| Ga0150985_1077971761 | 3300012212 | Avena Fatua Rhizosphere | MTAPTARTVANLFLATAGVGAADVVITAPPPRRPAGA |
| Ga0150985_1081078181 | 3300012212 | Avena Fatua Rhizosphere | VTRANARTVANLALVSAGVAAAVVVITTPPLRRLAVRGIRLWLGA |
| Ga0150985_1114273574 | 3300012212 | Avena Fatua Rhizosphere | MTRENARTVANLVIASAGITAAYVVLTTPPLRRLAMQAARV |
| Ga0150985_1115758973 | 3300012212 | Avena Fatua Rhizosphere | MTGASARATANLVLAAAGVAAAYVILTKPPLRRLAGR |
| Ga0150985_1160239561 | 3300012212 | Avena Fatua Rhizosphere | MTQQNARMVANVMIASPGVAAAYVVLTTPPLRRLAM |
| Ga0134052_13273531 | 3300012393 | Grasslands Soil | MTTGTARTVANVLLASAGLAAAYVILTTPPLRRLALGGLKLW |
| Ga0134057_11449251 | 3300012396 | Grasslands Soil | VTKTTAHTVANVVLASAGLAAAFVILTNPPLRRLALQATRWW |
| Ga0134050_14192241 | 3300012407 | Grasslands Soil | MTGPTARTVANAVLATAGVAAAYVVITTPPLRRLAVRAIRVWL |
| Ga0150984_1002635884 | 3300012469 | Avena Fatua Rhizosphere | MMTRAEAQTTADLVLAGVGVAAAVVVITTPPLRRLAARALRIWP |
| Ga0150984_1047700611 | 3300012469 | Avena Fatua Rhizosphere | MGKPAARTVANVVLATAGLAAAYVMVTTPPLRRLALR |
| Ga0150984_1074405594 | 3300012469 | Avena Fatua Rhizosphere | MTTGNARTAANVLLGVAGVAAAYVVLTTPPLRRLAFRAARVWP |
| Ga0150984_1080847242 | 3300012469 | Avena Fatua Rhizosphere | MTTEAARTTSHVILVSAGVAAAYVVLTTPPLRRLASMG |
| Ga0150984_1129475831 | 3300012469 | Avena Fatua Rhizosphere | MTRDRAHTIANVAIASASVAAAYVVLRTPPLRRLAFQA |
| Ga0150984_1182594491 | 3300012469 | Avena Fatua Rhizosphere | MMTRAEAQTTADLVLAGVGVAAAIVVITTPPLRRLAARALRV |
| Ga0150984_1209503781 | 3300012469 | Avena Fatua Rhizosphere | MTDANARTAADLVLLSAGVAAAYVVLTRPPLRRLA |
| Ga0137359_108070641 | 3300012923 | Vadose Zone Soil | MTDSDARSVANVVLVSAGMAAAYVIITTPPLRRLAANGLRWWLG |
| Ga0137410_100675021 | 3300012944 | Vadose Zone Soil | MTRATARTVANVVLASAGVAAAFVVITNPPLRRLALRVTRVW |
| Ga0182021_116945091 | 3300014502 | Fen | MTDENARTVANVVLVSAGAAAAYVVLTKPPLRRFAFKM |
| Ga0157377_107378751 | 3300014745 | Miscanthus Rhizosphere | MTDANARTAANVILVSAGIAAAYVILSKPPLRRLAIRAAEIWLGASVPVF |
| Ga0157376_118251651 | 3300014969 | Miscanthus Rhizosphere | MTSATARTVANVVLISAGVAAAYVVVTTPPLRRLALRGAEWWLG |
| Ga0137412_107037712 | 3300015242 | Vadose Zone Soil | MTDENARTAANVVLVSAGVAVAYLVLTKPPLRRLAVR |
| Ga0134112_103242003 | 3300017656 | Grasslands Soil | MTATTARTVANVVLASAGVAAAYVVLTTPPLRRLAVRAIEVW |
| Ga0190275_127974601 | 3300018432 | Soil | MTSESARTASTMILVSVGVAAAYVVLTTPPLRRLVTTGLRLYLGASV |
| Ga0066662_101744756 | 3300018468 | Grasslands Soil | MTATTARTVANVVLASAGVAAAYVVLTTPPLRRLAVRAIEGWLG |
| Ga0184643_13151542 | 3300019255 | Groundwater Sediment | MTDENARTTANVVLVSAGVAVAYLVLTKPPLRRLAVRAVRGCD |
| Ga0184644_15675603 | 3300019269 | Groundwater Sediment | MTDENARTAANVVLVSAGVAVAYLVLTKPPLRRLAVRAVQMWLGASVP |
| Ga0184642_11321001 | 3300019279 | Groundwater Sediment | MTEANARTVANLILVSAGLAAAYFVMTTPPLRRMALRAARLWLG |
| Ga0190264_105525101 | 3300019377 | Soil | MTSANARTVANLVLISAGVAAAYVVITTPPLRRLALR |
| Ga0206356_117290501 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRSGARTAADVVLVTAGVAAAYVVLTTPPLRRLAFRGLRWR |
| Ga0179584_11622151 | 3300021151 | Vadose Zone Soil | VTREHARTFANVAIASAGVAAAYVVLTTPPLRRLALQ |
| Ga0179958_10749221 | 3300021315 | Vadose Zone Soil | MTDENARTAANVVLVSAGVAVAYLVLTKPPLRRLAVRAVQLWL |
| Ga0193719_101809711 | 3300021344 | Soil | MTSASARTVANVVLVSAGVAAAYVVMTTPPLRRLAVRA |
| Ga0213853_115318741 | 3300021861 | Watersheds | MTEQNARTAANAVLATAGVAAAYLVLTKPPLRRLAVKAVQL |
| Ga0222624_10928642 | 3300021951 | Groundwater Sediment | MTDENARTAANVVLVSAGVAVAYLVLTKPPLRRLAVRAVQLW |
| Ga0207695_104292514 | 3300025913 | Corn Rhizosphere | MTDEQARTVANVVLASAGVAAAYVVITTPSLRRLAFR |
| Ga0207681_102135861 | 3300025923 | Switchgrass Rhizosphere | MAGPVARTVANAVLVSAGVAAAYVIVTTPSLRRLAIGATR |
| Ga0207690_114150082 | 3300025932 | Corn Rhizosphere | MTRSTAHSVANVVLVSAGLAAAYVVITTPPLRRLAANGIRWWLG |
| Ga0207704_105778351 | 3300025938 | Miscanthus Rhizosphere | MTDANARTAANLVLASAGIAAAYVVLTKPPLRRLAFRAVEYWLGATVPVF |
| Ga0207704_105983983 | 3300025938 | Miscanthus Rhizosphere | VTSANARTVANVVLATAGVAAAYVIWTTPSLRRLALRGARLWLGA |
| Ga0207711_103787351 | 3300025941 | Switchgrass Rhizosphere | MTRSTAHSVANVVLVSAGLAAAYVVITTPPLRRLAANGIRW |
| Ga0207667_114167622 | 3300025949 | Corn Rhizosphere | MTDGQARTAANVVLASAGVAAAYVILTKPPLRRLAFRALEFWLG |
| Ga0207676_119918671 | 3300026095 | Switchgrass Rhizosphere | MTDANARTAANLVLASAGIAAAYVVLTKPPLRRLAFRAVEYWLGATVPV |
| Ga0209688_10694881 | 3300026305 | Soil | VTREHARTFANVAIASAGVAAAYVVLTTPPLRRLAFQALR |
| Ga0209811_100027631 | 3300027821 | Surface Soil | MTSATARTVANVVLISAGVAAAYVVVTTPPLRRLALRGTEWWL |
| Ga0207428_106498391 | 3300027907 | Populus Rhizosphere | MTSATARTVANVVLISAGVAAAYVVVTTPPLRRLALRGAEW |
| Ga0247685_10395282 | 3300028065 | Soil | MTKENARLVANLAIASAGVAAAYVVLTTPPLRRFAMR |
| Ga0137415_101162621 | 3300028536 | Vadose Zone Soil | MTASTARTVANVVLATAGVAAAYVVITTPPLRRLAARA |
| Ga0302047_102602062 | 3300028554 | Soil | MTGASARTTANLVLAVAGVAAAYVVVTTPPLRRNEIK |
| Ga0302047_103214051 | 3300028554 | Soil | MTTESARTASNAILVTAGVVAAYVVLTTPPLRRLALTGMR |
| Ga0302047_103924954 | 3300028554 | Soil | MTRADARTAANLVLVAAGVAAAYVVITTPPLRRLAVRATRNKNKGKK |
| Ga0302047_107536312 | 3300028554 | Soil | MTTDSARTASNAILLAAGVAVAYVVLTTPPLRRLAV |
| Ga0307282_106459342 | 3300028784 | Soil | MTRSTAHSVANVMLVSAGLAAAYVVITTPPLRRLAANGIRWWLGA |
| Ga0307305_102281713 | 3300028807 | Soil | MTSANARTVANVILASAGVAAAYVILTTPSLRRLAFRGAQLWL |
| Ga0102758_107834841 | 3300030784 | Soil | MTTESARTASTAILVTAGVAAAYVVLTTPPLRRHED |
| Ga0102757_101199062 | 3300030785 | Soil | MTAESARTASTAILISAGVAAAYVVLTTPPLRRLAFLGVR |
| Ga0073999_108381912 | 3300030839 | Soil | MTRSAARSVANVVLVSAGVAAAYVVITTPPLRRLAA |
| Ga0102744_17322431 | 3300030866 | Soil | MTTESARTASNLILLSAGVVAAYVVLTTPPLRRLA |
| Ga0102749_14702432 | 3300030867 | Soil | MTAESARTASTAILISAGVAAAYVVLTTPPLRRLAFL |
| Ga0308200_10169264 | 3300030905 | Soil | MTRSAAHSVANVVLVSAGLAAAYVVITTPPLRRLAANGIR |
| Ga0102745_10207211 | 3300030960 | Soil | MTTDSARTASNAILLAAGVAVAYVVLTTPPLRRLAVMEKRKRI |
| Ga0308190_10403223 | 3300030993 | Soil | MTDSTARSVANVVLVSAGLAAAYVVITTPPLRRLAANGLRWWLGAGVP |
| Ga0308190_11860142 | 3300030993 | Soil | MTDSEARSVANVVLVAAGLAAAYVVITTPPLRRLA |
| Ga0073998_106777952 | 3300031023 | Soil | MTDATARTVANVIVATVGLATAYVIITTPPLRRAADSRK |
| Ga0308189_100277001 | 3300031058 | Soil | MTSESARTVSNAILVTAGVAAAYVVLTTPPLRRLAGVGIRLWL |
| Ga0308189_100396051 | 3300031058 | Soil | MTDSEARSVANVVLVAAGLAAAYVVITTPPLRRLAA |
| Ga0308189_100562821 | 3300031058 | Soil | MTTESARTVSNAILVTAGVAAAYVVLTTPPLRRLAV |
| Ga0308189_101579771 | 3300031058 | Soil | MTTESARTVSNAVLVTAGVAAAYVVLTTPPLRRLAVVGIRLWL |
| Ga0308189_103422841 | 3300031058 | Soil | MTAESARTASTAILVTAGVAAAYVVLTTPPLRRLA |
| Ga0308201_101919752 | 3300031091 | Soil | MTDENARTAANVVLVSAGIAAAYVILTKPPLRRLAFRAVEIWLGASLPAFVM |
| Ga0308204_100183591 | 3300031092 | Soil | MTSESARTVSNAILVTAGVAAAYVVLTTPPLRRLAGVGIRLWLG |
| Ga0308204_100206074 | 3300031092 | Soil | MTSESARTASTMILVSAGLAAAYVVLTTPPLRRLVA |
| Ga0308204_100919323 | 3300031092 | Soil | MTSANARVTANVVLASAAVAAAYVVLTTPSLRHLAF |
| Ga0308197_100273214 | 3300031093 | Soil | MTDANARTVANVILVSAGVAAAYLVITTPPLRRVALRVV |
| Ga0308188_10085931 | 3300031097 | Soil | VTSTTARTVANVVLVSAGVAAAYVVITTPPLRRLAFRATRLW |
| Ga0308187_102837181 | 3300031114 | Soil | MTDANARTVANVILVSAGVAAAYLVITTPPLRRVA |
| Ga0308195_10105011 | 3300031123 | Soil | MTRSTARSVANVVLVSAGVAAAYVVITTPPLRRKN |
| Ga0310915_107128891 | 3300031573 | Soil | MTDANARTAANLVLASAGIAAAYVVLTKPPLRRLAFLA |
| Ga0318552_105470421 | 3300031782 | Soil | MTDANARTAANLVLASAGIAAAYVVLTKPPLRRLAFLAVRYWLGASVP |
| Ga0310916_116717461 | 3300031942 | Soil | MTRENARLAANAVLVAAGVAAAYVVLTRPPLRRLAARAAR |
| Ga0307416_1020693261 | 3300032002 | Rhizosphere | MTTSAARTVANVVLITAGAAAAYAIVASPPLRRLAGHGLRWW |
| ⦗Top⦘ |