


| Basic Information | |
|---|---|
| Family ID | F074052 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.33 % |
| % of genes near scaffold ends (potentially truncated) | 21.67 % |
| % of genes from short scaffolds (< 2000 bps) | 84.17 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 8.33 |
| PF02705 | K_trans | 2.50 |
| PF07883 | Cupin_2 | 2.50 |
| PF00005 | ABC_tran | 1.67 |
| PF13557 | Phenol_MetA_deg | 1.67 |
| PF06983 | 3-dmu-9_3-mt | 1.67 |
| PF13565 | HTH_32 | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF11854 | MtrB_PioB | 0.83 |
| PF13458 | Peripla_BP_6 | 0.83 |
| PF06186 | DUF992 | 0.83 |
| PF05239 | PRC | 0.83 |
| PF07369 | DUF1488 | 0.83 |
| PF01242 | PTPS | 0.83 |
| PF00571 | CBS | 0.83 |
| PF01042 | Ribonuc_L-PSP | 0.83 |
| PF13602 | ADH_zinc_N_2 | 0.83 |
| PF13545 | HTH_Crp_2 | 0.83 |
| PF16868 | NMT1_3 | 0.83 |
| PF07045 | DUF1330 | 0.83 |
| PF04328 | Sel_put | 0.83 |
| PF10503 | Esterase_PHB | 0.83 |
| PF00313 | CSD | 0.83 |
| PF08448 | PAS_4 | 0.83 |
| PF13460 | NAD_binding_10 | 0.83 |
| PF13546 | DDE_5 | 0.83 |
| PF00296 | Bac_luciferase | 0.83 |
| PF14499 | DUF4437 | 0.83 |
| PF01266 | DAO | 0.83 |
| PF00857 | Isochorismatase | 0.83 |
| PF09351 | DUF1993 | 0.83 |
| PF01902 | Diphthami_syn_2 | 0.83 |
| PF00723 | Glyco_hydro_15 | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| PF10417 | 1-cysPrx_C | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 8.33 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 2.50 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.67 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.67 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.83 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.83 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.83 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG2879 | Uncharacterized short protein YbdD, DUF466 family | Function unknown [S] | 0.83 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.83 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.17 % |
| All Organisms | root | All Organisms | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02IN348 | Not Available | 507 | Open in IMG/M |
| 2170459012|GOYVCMS02JFIVM | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 2170459023|GZGNO2B02IQUTG | Not Available | 513 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0319456 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1005092 | Not Available | 1362 | Open in IMG/M |
| 3300003321|soilH1_10376235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Kangiellales → Kangiellaceae → Kangiella → Kangiella spongicola | 1243 | Open in IMG/M |
| 3300004463|Ga0063356_100579527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1510 | Open in IMG/M |
| 3300004479|Ga0062595_100648759 | Not Available | 835 | Open in IMG/M |
| 3300004479|Ga0062595_100807565 | Not Available | 774 | Open in IMG/M |
| 3300004479|Ga0062595_101919071 | Not Available | 568 | Open in IMG/M |
| 3300004633|Ga0066395_10755531 | Not Available | 581 | Open in IMG/M |
| 3300005330|Ga0070690_100149629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1592 | Open in IMG/M |
| 3300005332|Ga0066388_100895306 | Not Available | 1466 | Open in IMG/M |
| 3300005332|Ga0066388_105910601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300005366|Ga0070659_100915370 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005434|Ga0070709_10307173 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005439|Ga0070711_100451146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1053 | Open in IMG/M |
| 3300005439|Ga0070711_100658953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 878 | Open in IMG/M |
| 3300005440|Ga0070705_101680521 | Not Available | 536 | Open in IMG/M |
| 3300005526|Ga0073909_10561670 | Not Available | 559 | Open in IMG/M |
| 3300005713|Ga0066905_100039195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2788 | Open in IMG/M |
| 3300005764|Ga0066903_100473861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2106 | Open in IMG/M |
| 3300005764|Ga0066903_102308523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300005764|Ga0066903_102659119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300005764|Ga0066903_107184661 | Not Available | 576 | Open in IMG/M |
| 3300006028|Ga0070717_10367442 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300006047|Ga0075024_100207758 | Not Available | 920 | Open in IMG/M |
| 3300006049|Ga0075417_10203215 | Not Available | 938 | Open in IMG/M |
| 3300006049|Ga0075417_10352218 | Not Available | 721 | Open in IMG/M |
| 3300006052|Ga0075029_101019964 | Not Available | 572 | Open in IMG/M |
| 3300006163|Ga0070715_10991207 | Not Available | 523 | Open in IMG/M |
| 3300006173|Ga0070716_100053491 | Not Available | 2302 | Open in IMG/M |
| 3300006175|Ga0070712_100073364 | Not Available | 2454 | Open in IMG/M |
| 3300006797|Ga0066659_11631763 | Not Available | 542 | Open in IMG/M |
| 3300006854|Ga0075425_100375875 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300006871|Ga0075434_100026353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5694 | Open in IMG/M |
| 3300006903|Ga0075426_10240562 | Not Available | 1317 | Open in IMG/M |
| 3300006914|Ga0075436_100667713 | Not Available | 769 | Open in IMG/M |
| 3300007076|Ga0075435_100902576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300009036|Ga0105244_10289746 | Not Available | 759 | Open in IMG/M |
| 3300009100|Ga0075418_10943879 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009553|Ga0105249_10686384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1083 | Open in IMG/M |
| 3300010360|Ga0126372_12440057 | Not Available | 574 | Open in IMG/M |
| 3300010366|Ga0126379_11664992 | Not Available | 743 | Open in IMG/M |
| 3300012180|Ga0153974_1097341 | Not Available | 666 | Open in IMG/M |
| 3300012198|Ga0137364_11049936 | Not Available | 614 | Open in IMG/M |
| 3300012208|Ga0137376_10189923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00 | 1775 | Open in IMG/M |
| 3300012210|Ga0137378_10933089 | Not Available | 781 | Open in IMG/M |
| 3300012285|Ga0137370_10833239 | Not Available | 572 | Open in IMG/M |
| 3300012508|Ga0157315_1032331 | Not Available | 621 | Open in IMG/M |
| 3300012937|Ga0162653_100087392 | Not Available | 515 | Open in IMG/M |
| 3300012948|Ga0126375_11937253 | Not Available | 519 | Open in IMG/M |
| 3300012957|Ga0164303_10276740 | Not Available | 976 | Open in IMG/M |
| 3300012958|Ga0164299_10908055 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012961|Ga0164302_11399809 | Not Available | 571 | Open in IMG/M |
| 3300012984|Ga0164309_11205354 | Not Available | 635 | Open in IMG/M |
| 3300013100|Ga0157373_11432672 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300013296|Ga0157374_10011048 | All Organisms → cellular organisms → Bacteria | 7800 | Open in IMG/M |
| 3300013307|Ga0157372_11218056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 870 | Open in IMG/M |
| 3300013772|Ga0120158_10470922 | Not Available | 561 | Open in IMG/M |
| 3300014325|Ga0163163_11015293 | Not Available | 893 | Open in IMG/M |
| 3300015373|Ga0132257_100481445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
| 3300015373|Ga0132257_101690089 | Not Available | 811 | Open in IMG/M |
| 3300015374|Ga0132255_105269884 | Not Available | 547 | Open in IMG/M |
| 3300016422|Ga0182039_10003216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8963 | Open in IMG/M |
| 3300017937|Ga0187809_10027908 | Not Available | 1801 | Open in IMG/M |
| 3300017947|Ga0187785_10000286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19140 | Open in IMG/M |
| 3300018028|Ga0184608_10522735 | Not Available | 506 | Open in IMG/M |
| 3300018053|Ga0184626_10110621 | Not Available | 1165 | Open in IMG/M |
| 3300018054|Ga0184621_10329364 | Not Available | 537 | Open in IMG/M |
| 3300018058|Ga0187766_10250378 | Not Available | 1133 | Open in IMG/M |
| 3300018072|Ga0184635_10030791 | Not Available | 2013 | Open in IMG/M |
| 3300018072|Ga0184635_10203570 | Not Available | 789 | Open in IMG/M |
| 3300019867|Ga0193704_1064922 | Not Available | 694 | Open in IMG/M |
| 3300019878|Ga0193715_1033961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300019879|Ga0193723_1102697 | Not Available | 806 | Open in IMG/M |
| 3300019888|Ga0193751_1058574 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1621 | Open in IMG/M |
| 3300020069|Ga0197907_10056841 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300021344|Ga0193719_10061729 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300021478|Ga0210402_10234010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1694 | Open in IMG/M |
| 3300021560|Ga0126371_13133613 | Not Available | 559 | Open in IMG/M |
| 3300022756|Ga0222622_10144656 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300025915|Ga0207693_10030311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4271 | Open in IMG/M |
| 3300025915|Ga0207693_10174318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1693 | Open in IMG/M |
| 3300025928|Ga0207700_10101155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2299 | Open in IMG/M |
| 3300025933|Ga0207706_11328745 | Not Available | 593 | Open in IMG/M |
| 3300026538|Ga0209056_10212665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00 | 1404 | Open in IMG/M |
| 3300027873|Ga0209814_10083004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1352 | Open in IMG/M |
| 3300027874|Ga0209465_10484627 | Not Available | 618 | Open in IMG/M |
| 3300027894|Ga0209068_10223018 | Not Available | 1042 | Open in IMG/M |
| 3300028381|Ga0268264_10622468 | Not Available | 1066 | Open in IMG/M |
| 3300028717|Ga0307298_10169161 | Not Available | 638 | Open in IMG/M |
| 3300028720|Ga0307317_10117650 | Not Available | 886 | Open in IMG/M |
| 3300028799|Ga0307284_10076241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1223 | Open in IMG/M |
| 3300028799|Ga0307284_10174214 | Not Available | 838 | Open in IMG/M |
| 3300028807|Ga0307305_10065259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1679 | Open in IMG/M |
| 3300028811|Ga0307292_10140789 | Not Available | 970 | Open in IMG/M |
| 3300028819|Ga0307296_10151662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1252 | Open in IMG/M |
| 3300028885|Ga0307304_10217268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300029636|Ga0222749_10242689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300030844|Ga0075377_11659737 | Not Available | 1156 | Open in IMG/M |
| 3300031128|Ga0170823_10659907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300031170|Ga0307498_10000026 | All Organisms → cellular organisms → Bacteria | 14498 | Open in IMG/M |
| 3300031170|Ga0307498_10000343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5902 | Open in IMG/M |
| 3300031226|Ga0307497_10423047 | Not Available | 641 | Open in IMG/M |
| 3300031249|Ga0265339_10011089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5565 | Open in IMG/M |
| 3300031249|Ga0265339_10042492 | Not Available | 2517 | Open in IMG/M |
| 3300031474|Ga0170818_109755737 | Not Available | 1002 | Open in IMG/M |
| 3300031474|Ga0170818_112142520 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031546|Ga0318538_10607726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300031652|Ga0315553_10043267 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300031720|Ga0307469_10203876 | Not Available | 1548 | Open in IMG/M |
| 3300031821|Ga0318567_10633109 | Not Available | 607 | Open in IMG/M |
| 3300031858|Ga0310892_11211559 | Not Available | 538 | Open in IMG/M |
| 3300032000|Ga0310903_10543906 | Not Available | 612 | Open in IMG/M |
| 3300032076|Ga0306924_10466044 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300033433|Ga0326726_10013268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7220 | Open in IMG/M |
| 3300033433|Ga0326726_10122896 | Not Available | 2345 | Open in IMG/M |
| 3300033758|Ga0314868_004369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1290 | Open in IMG/M |
| 3300034090|Ga0326723_0021388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2642 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.50% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_08175150 | 2170459010 | Grass Soil | MRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS |
| N56_07876840 | 2170459012 | Grass Soil | KVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS |
| FA3_00058910 | 2170459023 | Grass Soil | MRKVVGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| ICChiseqgaiiDRAFT_03194562 | 3300000033 | Soil | MRMRKVLGFILIAFSLVAGTGAFVTVNPHQAFACEDGDKRGS* |
| AF_2010_repII_A10DRAFT_10050924 | 3300000816 | Forest Soil | MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDHKGS* |
| soilH1_103762351 | 3300003321 | Sugarcane Root And Bulk Soil | MRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS* |
| Ga0063356_1005795271 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRMRKVLGFIVIAFALVAGAAASVTVSQHQAFACEDGDHKGS* |
| Ga0062595_1006487591 | 3300004479 | Soil | MRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS* |
| Ga0062595_1008075652 | 3300004479 | Soil | MRKVLGFILIAFALVAGTGTFVTVNPHQAFACDDGDKRGS* |
| Ga0062595_1019190711 | 3300004479 | Soil | MRMKKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDKRGS* |
| Ga0066395_107555311 | 3300004633 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0070690_1001496291 | 3300005330 | Switchgrass Rhizosphere | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS* |
| Ga0066388_1008953062 | 3300005332 | Tropical Forest Soil | MRKVLGYFLIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0066388_1059106012 | 3300005332 | Tropical Forest Soil | MRKVLGFILIAFALVAGTAAFVTVNPHHAFACEDGDKRGS* |
| Ga0070659_1009153702 | 3300005366 | Corn Rhizosphere | MRKVLGFIVIALALVAGSAAAVTVSPQQAFACDGDHRGS* |
| Ga0070709_103071731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSS* |
| Ga0070711_1004511461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RMRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS* |
| Ga0070711_1006589531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMRKALRFALIAFALAAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0070705_1016805211 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSA* |
| Ga0073909_105616701 | 3300005526 | Surface Soil | DMRMRKVLGFILIALALVAGTGAFVTVNLHQAFACDGDKRGS* |
| Ga0066905_1000391952 | 3300005713 | Tropical Forest Soil | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0066903_1004738611 | 3300005764 | Tropical Forest Soil | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGHKRGS* |
| Ga0066903_1023085231 | 3300005764 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS* |
| Ga0066903_1026591191 | 3300005764 | Tropical Forest Soil | GFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS* |
| Ga0066903_1071846612 | 3300005764 | Tropical Forest Soil | LGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0070717_103674422 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFILIAFALVAGTAAFVTVNPHQAFSCEDGDKRSS* |
| Ga0075024_1002077583 | 3300006047 | Watersheds | MRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS* |
| Ga0075417_102032151 | 3300006049 | Populus Rhizosphere | MRKVLGFILIAFSLVAGTGAFVTVNPHQAFACEDGDKRGS* |
| Ga0075417_103522181 | 3300006049 | Populus Rhizosphere | MRKVLGFILIAFALVAGMGAFVTVNPHQAFACDDGDKRGS* |
| Ga0075029_1010199643 | 3300006052 | Watersheds | MQMRKVLGFIVIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0070715_109912071 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDNRGS* |
| Ga0070716_1000534911 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRSS* |
| Ga0070712_1000733641 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS* |
| Ga0066659_116317631 | 3300006797 | Soil | MRKVLGFILIAFALVDGSAAFVTVNPHQAFACEDGDNRGS* |
| Ga0075425_1003758752 | 3300006854 | Populus Rhizosphere | MRMRKVLGFILIAFALVAGTGAFITVNPHQAFACDDGDKRGS* |
| Ga0075434_1000263531 | 3300006871 | Populus Rhizosphere | MRKVLGFILIAFALVAGMGTFVTVNPHQAFACDDGDKRGS* |
| Ga0075426_102405623 | 3300006903 | Populus Rhizosphere | MRMRKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDKRGS* |
| Ga0075436_1006677131 | 3300006914 | Populus Rhizosphere | MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS* |
| Ga0075435_1009025761 | 3300007076 | Populus Rhizosphere | MRKVLGFILIAFAVVAGTGAFVTVNPQQAFACEDGDK |
| Ga0105244_102897462 | 3300009036 | Miscanthus Rhizosphere | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFSCEDGDKRGS* |
| Ga0075418_109438793 | 3300009100 | Populus Rhizosphere | MRMRKVLGFILIAFALVAGMGTFVTVNPHQAFACDDGDKRGS* |
| Ga0105249_106863843 | 3300009553 | Switchgrass Rhizosphere | MRMRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS* |
| Ga0126372_124400572 | 3300010360 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACED |
| Ga0126379_116649922 | 3300010366 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACE |
| Ga0153974_10973411 | 3300012180 | Attine Ant Fungus Gardens | MRMRKVLGFILIAFALVVGTAAFVTVNPHQAFACEDGDNRGS* |
| Ga0137364_110499361 | 3300012198 | Vadose Zone Soil | MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS* |
| Ga0137376_101899232 | 3300012208 | Vadose Zone Soil | MRMRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDNHGS* |
| Ga0137378_109330892 | 3300012210 | Vadose Zone Soil | MRMRKVLGFILIAFALVAGTVAFVTVNPHQAFACEDGDNRGS* |
| Ga0137370_108332392 | 3300012285 | Vadose Zone Soil | MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS* |
| Ga0157315_10323311 | 3300012508 | Arabidopsis Rhizosphere | MRKVLGFILIAFALVAATGAFLTVNSHQAFACEDGDKRGS* |
| Ga0162653_1000873921 | 3300012937 | Soil | MRMRKVLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS* |
| Ga0126375_119372532 | 3300012948 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHHALACEDGDKRGS* |
| Ga0164303_102767402 | 3300012957 | Soil | MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGA* |
| Ga0164299_109080552 | 3300012958 | Soil | MRKVLGFIVIALALVAGTAAAVTVNPQQAFACDGDHRGS* |
| Ga0164302_113998092 | 3300012961 | Soil | MRMRKVLGFILIAFTLVAGPAAFLTVNPHQAFSCEDGDKRGS* |
| Ga0164309_112053542 | 3300012984 | Soil | MRMRKVFGFILIAFTLVAGTAAFVTANPHQAFGCEDGDKRGS* |
| Ga0157373_114326721 | 3300013100 | Corn Rhizosphere | GFIVIALALVAGTAAAVTVNPQQAFACDGDHRGS* |
| Ga0157374_100110482 | 3300013296 | Miscanthus Rhizosphere | MRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGDKRGS* |
| Ga0157372_112180561 | 3300013307 | Corn Rhizosphere | GRRMRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS* |
| Ga0120158_104709222 | 3300013772 | Permafrost | MQMRKVLGFIVIAFALVAGTAAFVTVNPHQAFACDGDHRGS* |
| Ga0163163_110152931 | 3300014325 | Switchgrass Rhizosphere | KVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS* |
| Ga0132257_1004814452 | 3300015373 | Arabidopsis Rhizosphere | MRKVLGFILIASALVAGTATFVTVNPHQAAACEDGDKRGS* |
| Ga0132257_1016900892 | 3300015373 | Arabidopsis Rhizosphere | MRMRKVLGFILIAFAVVAGTGAFLAANPQQAFACEDGDKRGS* |
| Ga0132255_1052698842 | 3300015374 | Arabidopsis Rhizosphere | MRMRKVLGFILIAFALVAATGAFVTVNSHQAFACEDGDKRGS* |
| Ga0182039_1000321611 | 3300016422 | Soil | MRKALRFIVIAFALVAGTAAFVTDHPDLGFAYEDGDHKGA |
| Ga0187809_100279083 | 3300017937 | Freshwater Sediment | VGKVIGLIMITFALVVGAAAFVSVAPQQAFACDGNHQGS |
| Ga0187785_1000028614 | 3300017947 | Tropical Peatland | MRKALGFIVIAFALVAGTATFMSVSPHQAFACEDGDKRGS |
| Ga0184608_105227352 | 3300018028 | Groundwater Sediment | MRMRKVLGFILIAFAIVAGTTAFVTVNPHQAFACEDGDKRGS |
| Ga0184626_101106211 | 3300018053 | Groundwater Sediment | MRKVLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS |
| Ga0184621_103293641 | 3300018054 | Groundwater Sediment | MRMRKILGFILIAFAIVAGTTAFVTVNPHQAFACEDGDKRGS |
| Ga0187766_102503783 | 3300018058 | Tropical Peatland | MRMRKALGFIVIAFALVAGTATFMSVSPHQAFACEDGDKRGS |
| Ga0184635_100307913 | 3300018072 | Groundwater Sediment | MRKVLGFFLIAFALVAGTGAFVTVNPHQAFACEDGDKRGS |
| Ga0184635_102035701 | 3300018072 | Groundwater Sediment | MRMRKIIGFILIAFAIVAGTAACVTVNPHQAFACEDGDKRGS |
| Ga0193704_10649221 | 3300019867 | Soil | MRMRKVLGFILIAFALVAGTAVFVTVNPHQAFACEDGDKRGS |
| Ga0193715_10339612 | 3300019878 | Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS |
| Ga0193723_11026972 | 3300019879 | Soil | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0193751_10585742 | 3300019888 | Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS |
| Ga0197907_100568411 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFIVIALALVAGTAAAVTVSPQQAFACDGDHRGS |
| Ga0193719_100617292 | 3300021344 | Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0210402_102340103 | 3300021478 | Soil | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDNRGS |
| Ga0126371_131336132 | 3300021560 | Tropical Forest Soil | MRKALRFIVITFALVAAGTAAFVTVNPHQAFACEDGDH |
| Ga0222622_101446561 | 3300022756 | Groundwater Sediment | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0207693_100303113 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS |
| Ga0207693_101743183 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKVLGFILIAFALVAGTSAFVTVNSHQAFACEDGD |
| Ga0207700_101011551 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDNRGS |
| Ga0207706_113287451 | 3300025933 | Corn Rhizosphere | MRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDG |
| Ga0209056_102126651 | 3300026538 | Soil | MRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDNHGS |
| Ga0209814_100830041 | 3300027873 | Populus Rhizosphere | MRKVLGFILIAFALVAGMGAFVTVNPHQAFACDDGDKRGS |
| Ga0209465_104846272 | 3300027874 | Tropical Forest Soil | MRMRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS |
| Ga0209068_102230183 | 3300027894 | Watersheds | MRMRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS |
| Ga0268264_106224684 | 3300028381 | Switchgrass Rhizosphere | GFILIAFAVVAGSGAFVTVNPQQAFACEDGDKRGS |
| Ga0307298_101691612 | 3300028717 | Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQAFACEDGDIRGS |
| Ga0307317_101176504 | 3300028720 | Soil | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGD |
| Ga0307284_100762412 | 3300028799 | Soil | MRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0307284_101742141 | 3300028799 | Soil | VLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS |
| Ga0307305_100652593 | 3300028807 | Soil | MRMRKILGFILIAFALVAGTAVFVTVNPHQAFACEDGDKRGS |
| Ga0307292_101407891 | 3300028811 | Soil | MRKVLGFILIAFALVAGTAAFVTVNPHQAFACENGDKRGS |
| Ga0307296_101516621 | 3300028819 | Soil | VLGFILIAFALVAGTGAFVTVNPHQAFACEDGDKRGS |
| Ga0307304_102172683 | 3300028885 | Soil | CSLGDMRMRKILGFILIAFALVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0222749_102426891 | 3300029636 | Soil | MRMRKVLGFILIAFALVVGTAAFVTVNPHQAFACEDGDNRGS |
| Ga0075377_116597372 | 3300030844 | Soil | MRMRKVLGFILIAFALVAGTAAFVTVNPHQVFACEDGDKRGS |
| Ga0170823_106599071 | 3300031128 | Forest Soil | RMRKVLGFILIAFALVAGTVAFVTVNPHQAFACEDGDNHGS |
| Ga0307498_1000002617 | 3300031170 | Soil | MRKVLGFILIAFALVGGTAALVTVNPHQVFACEDGDKRGS |
| Ga0307498_100003436 | 3300031170 | Soil | MRKVLGFILIAFALVAGTTAFVTVNPHQAFACEDGDKRGS |
| Ga0307497_104230472 | 3300031226 | Soil | MRMRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0265339_100110891 | 3300031249 | Rhizosphere | MRKVIGLIVITFALVAGAAAFVSATPQQAFACDGDHRGS |
| Ga0265339_100424923 | 3300031249 | Rhizosphere | MRKVIGLIVITFALVAGAAAFVSVTPQQAFACDGDHRGS |
| Ga0170818_1097557371 | 3300031474 | Forest Soil | MRMRKVLGFILIAFTFVAGTAAFVTVNPHQAFACEDGDNHGS |
| Ga0170818_1121425201 | 3300031474 | Forest Soil | LRFALIAFALASGTAAFVTVNPHQAFACEDGDKRGS |
| Ga0318538_106077261 | 3300031546 | Soil | MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDHK |
| Ga0315553_100432673 | 3300031652 | Salt Marsh Sediment | MRKVLGFIVIAIALVAGTAAVVTVSPHQAFACEDGDYRGS |
| Ga0307469_102038763 | 3300031720 | Hardwood Forest Soil | MRKVLGFILIAFALVAGTGAFVTVNSHQAFACEDGDKRGS |
| Ga0318567_106331092 | 3300031821 | Soil | MRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGDRAP |
| Ga0310892_112115591 | 3300031858 | Soil | MRMRKVLGFILIAFALVAGMGAFVTVNSHQAFACEDGDKRGS |
| Ga0310903_105439061 | 3300032000 | Soil | MRMRKVLGFILIAFTLVAGTAAFVTVNPHQAFGCEDGDKRGS |
| Ga0306924_104660441 | 3300032076 | Soil | MRMRKALRFIVIAFALVAGTAAFVTVNPHQAFACEDGD |
| Ga0326726_100132688 | 3300033433 | Peat Soil | MRKVLGFILVAFALFAGTAAFVTVNPHQVFACEDGDKRGS |
| Ga0326726_101228964 | 3300033433 | Peat Soil | MRKVLGFILIAFALVAGTATFVTVNPHQAFACEDGDKRGS |
| Ga0314868_004369_413_535 | 3300033758 | Peatland | MRKVVGFIVIACTLVAGAAAFVTVNPHQAFACEDGDKRGS |
| Ga0326723_0021388_188_316 | 3300034090 | Peat Soil | MRMRKVLGFILVAFALFAGTAAFVTVNPHQVFACEDGDKRGS |
| ⦗Top⦘ |