


| Basic Information | |
|---|---|
| Family ID | F073986 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.24 % |
| % of genes near scaffold ends (potentially truncated) | 12.50 % |
| % of genes from short scaffolds (< 2000 bps) | 77.50 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.167 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 5.88% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 1.67 |
| PF00486 | Trans_reg_C | 1.67 |
| PF13531 | SBP_bac_11 | 1.67 |
| PF10098 | DUF2336 | 0.83 |
| PF01124 | MAPEG | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| PF13847 | Methyltransf_31 | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF01522 | Polysacc_deac_1 | 0.83 |
| PF02397 | Bac_transf | 0.83 |
| PF09084 | NMT1 | 0.83 |
| PF01402 | RHH_1 | 0.83 |
| PF00535 | Glycos_transf_2 | 0.83 |
| PF13174 | TPR_6 | 0.83 |
| PF11295 | DUF3096 | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF13467 | RHH_4 | 0.83 |
| PF01381 | HTH_3 | 0.83 |
| PF13641 | Glyco_tranf_2_3 | 0.83 |
| PF00037 | Fer4 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF09994 | DUF2235 | 0.83 |
| PF02738 | MoCoBD_1 | 0.83 |
| PF13417 | GST_N_3 | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF01266 | DAO | 0.83 |
| PF03928 | HbpS-like | 0.83 |
| PF00543 | P-II | 0.83 |
| PF01458 | SUFBD | 0.83 |
| PF13817 | DDE_Tnp_IS66_C | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.83 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.17 % |
| All Organisms | root | All Organisms | 45.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z02GDTHW | Not Available | 566 | Open in IMG/M |
| 3300001593|JGI12635J15846_10209089 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300001661|JGI12053J15887_10063320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2052 | Open in IMG/M |
| 3300005363|Ga0008090_13766953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 800 | Open in IMG/M |
| 3300005529|Ga0070741_10128031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2603 | Open in IMG/M |
| 3300005531|Ga0070738_10000093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 260088 | Open in IMG/M |
| 3300005538|Ga0070731_10136377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1626 | Open in IMG/M |
| 3300005538|Ga0070731_10991379 | Not Available | 556 | Open in IMG/M |
| 3300005587|Ga0066654_10153975 | Not Available | 1169 | Open in IMG/M |
| 3300005602|Ga0070762_10778326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300005764|Ga0066903_103646250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300005921|Ga0070766_10536540 | Not Available | 780 | Open in IMG/M |
| 3300005921|Ga0070766_10597385 | Not Available | 741 | Open in IMG/M |
| 3300005993|Ga0080027_10103265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300005993|Ga0080027_10424355 | Not Available | 537 | Open in IMG/M |
| 3300006028|Ga0070717_10704876 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006028|Ga0070717_11099958 | Not Available | 724 | Open in IMG/M |
| 3300006028|Ga0070717_11661511 | Not Available | 578 | Open in IMG/M |
| 3300006041|Ga0075023_100038755 | Not Available | 1442 | Open in IMG/M |
| 3300006041|Ga0075023_100102830 | Not Available | 991 | Open in IMG/M |
| 3300006047|Ga0075024_100119618 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300006047|Ga0075024_100702311 | Not Available | 555 | Open in IMG/M |
| 3300006050|Ga0075028_100084090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1596 | Open in IMG/M |
| 3300006050|Ga0075028_100506221 | Not Available | 706 | Open in IMG/M |
| 3300006050|Ga0075028_100730259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300006052|Ga0075029_101307911 | Not Available | 509 | Open in IMG/M |
| 3300006172|Ga0075018_10000956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 9343 | Open in IMG/M |
| 3300006176|Ga0070765_100424401 | Not Available | 1244 | Open in IMG/M |
| 3300009650|Ga0105857_1174942 | Not Available | 612 | Open in IMG/M |
| 3300010048|Ga0126373_10008862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8025 | Open in IMG/M |
| 3300010048|Ga0126373_10026874 | Not Available | 4932 | Open in IMG/M |
| 3300010048|Ga0126373_10595402 | Not Available | 1158 | Open in IMG/M |
| 3300010048|Ga0126373_12201598 | Not Available | 612 | Open in IMG/M |
| 3300010159|Ga0099796_10503222 | Not Available | 543 | Open in IMG/M |
| 3300010361|Ga0126378_10498604 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010361|Ga0126378_12224732 | Not Available | 626 | Open in IMG/M |
| 3300010376|Ga0126381_100415607 | Not Available | 1878 | Open in IMG/M |
| 3300010376|Ga0126381_103180789 | Not Available | 649 | Open in IMG/M |
| 3300011270|Ga0137391_10410572 | Not Available | 1156 | Open in IMG/M |
| 3300011270|Ga0137391_10442525 | Not Available | 1106 | Open in IMG/M |
| 3300011271|Ga0137393_10921245 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012199|Ga0137383_10143915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1744 | Open in IMG/M |
| 3300012210|Ga0137378_10474404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1157 | Open in IMG/M |
| 3300012361|Ga0137360_11000997 | Not Available | 721 | Open in IMG/M |
| 3300012683|Ga0137398_10857157 | Not Available | 634 | Open in IMG/M |
| 3300012683|Ga0137398_10904384 | Not Available | 615 | Open in IMG/M |
| 3300012917|Ga0137395_10947736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300012924|Ga0137413_11393314 | Not Available | 566 | Open in IMG/M |
| 3300012944|Ga0137410_11112511 | Not Available | 677 | Open in IMG/M |
| 3300014501|Ga0182024_10027974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9830 | Open in IMG/M |
| 3300014501|Ga0182024_11233784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
| 3300014657|Ga0181522_10174152 | Not Available | 1262 | Open in IMG/M |
| 3300015242|Ga0137412_10032074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 4289 | Open in IMG/M |
| 3300016445|Ga0182038_11553902 | Not Available | 595 | Open in IMG/M |
| 3300017975|Ga0187782_10807735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → unclassified Parvularculaceae → Parvularculaceae bacterium | 725 | Open in IMG/M |
| 3300020199|Ga0179592_10016617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 3234 | Open in IMG/M |
| 3300020199|Ga0179592_10026526 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
| 3300020580|Ga0210403_10012718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6810 | Open in IMG/M |
| 3300020580|Ga0210403_10051513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3292 | Open in IMG/M |
| 3300020580|Ga0210403_10129126 | Not Available | 2061 | Open in IMG/M |
| 3300020580|Ga0210403_10140028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 1975 | Open in IMG/M |
| 3300020580|Ga0210403_10215137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1577 | Open in IMG/M |
| 3300020580|Ga0210403_10660693 | Not Available | 840 | Open in IMG/M |
| 3300020581|Ga0210399_10139255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2002 | Open in IMG/M |
| 3300021168|Ga0210406_10695815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47 | 784 | Open in IMG/M |
| 3300021170|Ga0210400_10333149 | Not Available | 1248 | Open in IMG/M |
| 3300021170|Ga0210400_11039346 | Not Available | 665 | Open in IMG/M |
| 3300021171|Ga0210405_11376243 | Not Available | 515 | Open in IMG/M |
| 3300021377|Ga0213874_10011861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2220 | Open in IMG/M |
| 3300021401|Ga0210393_10187199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1671 | Open in IMG/M |
| 3300021404|Ga0210389_10356036 | Not Available | 1150 | Open in IMG/M |
| 3300021405|Ga0210387_10054021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3240 | Open in IMG/M |
| 3300021420|Ga0210394_11198193 | Not Available | 652 | Open in IMG/M |
| 3300021432|Ga0210384_11644387 | Not Available | 548 | Open in IMG/M |
| 3300021476|Ga0187846_10376994 | Not Available | 584 | Open in IMG/M |
| 3300021478|Ga0210402_10840471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300021478|Ga0210402_11836908 | Not Available | 532 | Open in IMG/M |
| 3300021479|Ga0210410_10006411 | All Organisms → cellular organisms → Bacteria | 10234 | Open in IMG/M |
| 3300021560|Ga0126371_10013821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7341 | Open in IMG/M |
| 3300021560|Ga0126371_10066584 | All Organisms → cellular organisms → Bacteria | 3490 | Open in IMG/M |
| 3300021560|Ga0126371_10831325 | Not Available | 1069 | Open in IMG/M |
| 3300021560|Ga0126371_11596065 | Not Available | 779 | Open in IMG/M |
| 3300021560|Ga0126371_11890377 | Not Available | 716 | Open in IMG/M |
| 3300021560|Ga0126371_12855251 | Not Available | 586 | Open in IMG/M |
| 3300021861|Ga0213853_11195639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1082 | Open in IMG/M |
| 3300026217|Ga0209871_1077363 | Not Available | 642 | Open in IMG/M |
| 3300026496|Ga0257157_1036143 | Not Available | 820 | Open in IMG/M |
| 3300026496|Ga0257157_1069880 | Not Available | 601 | Open in IMG/M |
| 3300026551|Ga0209648_10027950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4927 | Open in IMG/M |
| 3300026555|Ga0179593_1024024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2429 | Open in IMG/M |
| 3300026557|Ga0179587_10647451 | Not Available | 696 | Open in IMG/M |
| 3300027546|Ga0208984_1132961 | Not Available | 535 | Open in IMG/M |
| 3300027591|Ga0209733_1004886 | Not Available | 3372 | Open in IMG/M |
| 3300027727|Ga0209328_10205306 | Not Available | 594 | Open in IMG/M |
| 3300027738|Ga0208989_10305663 | Not Available | 507 | Open in IMG/M |
| 3300027869|Ga0209579_10661112 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027894|Ga0209068_10000768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16686 | Open in IMG/M |
| 3300027894|Ga0209068_10001278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12644 | Open in IMG/M |
| 3300027902|Ga0209048_10149425 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300027902|Ga0209048_10781227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 624 | Open in IMG/M |
| 3300027903|Ga0209488_10935623 | Not Available | 605 | Open in IMG/M |
| 3300027911|Ga0209698_10833058 | Not Available | 695 | Open in IMG/M |
| 3300027915|Ga0209069_10780171 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027965|Ga0209062_1000188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 231976 | Open in IMG/M |
| 3300028047|Ga0209526_10375128 | Not Available | 948 | Open in IMG/M |
| 3300028536|Ga0137415_11301222 | Not Available | 545 | Open in IMG/M |
| 3300028906|Ga0308309_11325214 | Not Available | 619 | Open in IMG/M |
| 3300031057|Ga0170834_100339474 | Not Available | 826 | Open in IMG/M |
| 3300031668|Ga0318542_10596841 | Not Available | 576 | Open in IMG/M |
| 3300031715|Ga0307476_10208632 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1420 | Open in IMG/M |
| 3300031797|Ga0318550_10412624 | Not Available | 654 | Open in IMG/M |
| 3300031879|Ga0306919_10396085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1059 | Open in IMG/M |
| 3300031890|Ga0306925_10029181 | All Organisms → cellular organisms → Bacteria | 5603 | Open in IMG/M |
| 3300031890|Ga0306925_10928540 | Not Available | 893 | Open in IMG/M |
| 3300031941|Ga0310912_10538200 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031954|Ga0306926_12037738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300032076|Ga0306924_11825539 | Not Available | 633 | Open in IMG/M |
| 3300032261|Ga0306920_101136558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1131 | Open in IMG/M |
| 3300032261|Ga0306920_101756209 | Not Available | 877 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 10.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.67% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.67% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.67% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.67% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_01563340 | 2170459004 | Grass Soil | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV |
| JGI12635J15846_102090892 | 3300001593 | Forest Soil | MFMRMTAQRRLLGLDIGDWSMLLGGLTLAGVLALFI* |
| JGI12053J15887_100633202 | 3300001661 | Forest Soil | MLQQLTTLRFTTEGRLLGFDLGDWSMLLGGFGLAGMLSFFL* |
| Ga0008090_137669532 | 3300005363 | Tropical Rainforest Soil | MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLL |
| Ga0070741_101280311 | 3300005529 | Surface Soil | MTRVLADGRLLGFDSGDWSMLLGGFVLAGLLALFV* |
| Ga0070738_10000093101 | 3300005531 | Surface Soil | MLRIATLRLTSDGRLLGFDTGDWSMLLGGFALAGLLALFV* |
| Ga0070731_101363772 | 3300005538 | Surface Soil | MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLCGLVALLV* |
| Ga0070731_109913791 | 3300005538 | Surface Soil | TLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV* |
| Ga0066654_101539751 | 3300005587 | Soil | MLRLTTLRLTSDGRLLGFDPGDWSMLLGGFALAGLLALFV* |
| Ga0070762_107783261 | 3300005602 | Soil | MLRTASLHLTAEGRLLGFDTGDWSVLLGGFFLAGLLALMV* |
| Ga0066903_1036462502 | 3300005764 | Tropical Forest Soil | MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV* |
| Ga0070766_105365401 | 3300005921 | Soil | MLRTASLHLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV* |
| Ga0070766_105973851 | 3300005921 | Soil | MLRLTTFRLTTDGRLLGFDTGDWSMLLGGFMVAGLLALLV* |
| Ga0080027_101032651 | 3300005993 | Prmafrost Soil | MQRLTYFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV* |
| Ga0080027_104243552 | 3300005993 | Prmafrost Soil | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV* |
| Ga0070717_107048762 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRLATLRLTDEGRLLGLDTGDWSILLGGFFLAGLVALLV* |
| Ga0070717_110999582 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NDTKVVPMLRLTTLRLTSDGRLLGFDPGDWSMLLGGFALAGLLALFV* |
| Ga0070717_116615111 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRLMTLCITTDGRLLGFDAGDWSVLFGGFFLAGLLALVV* |
| Ga0075023_1000387553 | 3300006041 | Watersheds | MLRSATLRFSGEGRLLGFDTGDWSMLLGGFFLAGLLALMV* |
| Ga0075023_1001028302 | 3300006041 | Watersheds | MQRLTHFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV* |
| Ga0075024_1001196183 | 3300006047 | Watersheds | MLRLTLFTADGRLMGFDTGDWSLLLGGFVVAGLLTLFV* |
| Ga0075024_1007023112 | 3300006047 | Watersheds | MTRLTTFRLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV* |
| Ga0075028_1000840901 | 3300006050 | Watersheds | MLRSAALRLTPEGRLLGFDTGDWSMLLGGFVLAGLLALMV* |
| Ga0075028_1005062212 | 3300006050 | Watersheds | MLRLTALRLTSDGRLLGFDSGDWSMLLGGFMVAGLLALLV* |
| Ga0075028_1007302592 | 3300006050 | Watersheds | MLRTASLHLTAEGRLLGFDIGDWSVLLGGFVLAGLLALMV* |
| Ga0075029_1013079112 | 3300006052 | Watersheds | MRTGVGIMLPLTHFTTDGRLLGFDLGDWSMLLGGFVLAGLLTLFV* |
| Ga0075018_1000095614 | 3300006172 | Watersheds | MLRFTQLTTDGRLLGFDTGDWSMLLGGFVLAGLLALFV* |
| Ga0070765_1004244012 | 3300006176 | Soil | MSRITALRLTSDGRLLGFDTGDWSMLLGGFVLAGLLTLFV* |
| Ga0070765_1019959691 | 3300006176 | Soil | NGIEASTMLRSTALRYTAQARLLGFDAGDWSMLLGGFFLAGLLALLA* |
| Ga0105857_11749421 | 3300009650 | Permafrost Soil | MLRTATLRLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV* |
| Ga0126373_100088625 | 3300010048 | Tropical Forest Soil | MLRLATNLRLTSDGRLLGFDRGDWSMLLGGFAVAGLLSLLV* |
| Ga0126373_100268745 | 3300010048 | Tropical Forest Soil | MSRLMTLRITTDGRLLGFDTGDWSILLGGFAVAGLLALMV* |
| Ga0126373_105954022 | 3300010048 | Tropical Forest Soil | MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLAGLVALLV* |
| Ga0126373_122015981 | 3300010048 | Tropical Forest Soil | MLRLATNLRFTNDGRLLGFDTGDWSMLLGGFAVAGLLSLLV* |
| Ga0099796_105032221 | 3300010159 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDTGDWSILLGGFVLAGLLAL |
| Ga0126378_104986042 | 3300010361 | Tropical Forest Soil | MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLLV* |
| Ga0126378_122247321 | 3300010361 | Tropical Forest Soil | MSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV* |
| Ga0126381_1004156072 | 3300010376 | Tropical Forest Soil | MSHLMKLPITTDGRLLGFDTGDWSMLLGGAVLAGLLAMMV* |
| Ga0126381_1031807891 | 3300010376 | Tropical Forest Soil | MSRLTARLTIDGRLLGFDTGDWSMLLGGFVLAGLVALLV* |
| Ga0137391_104105722 | 3300011270 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLLV* |
| Ga0137391_104425251 | 3300011270 | Vadose Zone Soil | AHLTAEGRLLGFDTGDWALLLGGFTLVGFLALLV* |
| Ga0137393_109212451 | 3300011271 | Vadose Zone Soil | MLRLSTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV* |
| Ga0137383_101439152 | 3300012199 | Vadose Zone Soil | MLRLATLRFTTDGRLLGFDTGDWSMLVGGFVLAGLVALFI* |
| Ga0137378_104744042 | 3300012210 | Vadose Zone Soil | MLRLTTLRFTNDGRLLGFDTGDWSMLLGGFALAGLVALLV* |
| Ga0137360_110009972 | 3300012361 | Vadose Zone Soil | TRKQRFGTMLRLAHFTTDGRLLGFDTGDWSLLLGGFVLAGLLTLFV* |
| Ga0137398_108571571 | 3300012683 | Vadose Zone Soil | MLRLAHFTTDGRLLGFDTGDWSLLLGGFVLAGLLTLFV* |
| Ga0137398_109043841 | 3300012683 | Vadose Zone Soil | MSRIIALRITTEGRLLGFDTGDWSMLLGGFVLAGMLSIIL* |
| Ga0137395_109477361 | 3300012917 | Vadose Zone Soil | MLRFTAIRLTAEGRLLGFDTGDWSMLLGGFFLAGFLALMV* |
| Ga0137413_113933141 | 3300012924 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV* |
| Ga0137410_111125111 | 3300012944 | Vadose Zone Soil | MQRLTTLRITSDGRLLGFDTGDWSMLLGGFVLAGLLTLLV* |
| Ga0182024_100279747 | 3300014501 | Permafrost | MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALLV* |
| Ga0182024_112337841 | 3300014501 | Permafrost | MLRSAALRCTADGRLLGFDTGDWSMLLGGFVLAGIL |
| Ga0181522_101741522 | 3300014657 | Bog | VAEETTLEETRFAPMQRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALFV* |
| Ga0137412_100320742 | 3300015242 | Vadose Zone Soil | MQRLATMRLTSDGRLLGFDSGDWSMLLGGFFLAGLVTLMV* |
| Ga0182038_115539021 | 3300016445 | Soil | MSRLMTLRITTDGRLLGFDTGDWSMLLGGLVLAGLLALMV |
| Ga0187782_108077351 | 3300017975 | Tropical Peatland | MLRLSTLRLTTDGRLLGFDTGDWSMLLGGFALAGLLALLA |
| Ga0179592_100166171 | 3300020199 | Vadose Zone Soil | MSRIIALRITTEGRLLGFDTGDWSMLLGGFVLAGMLSIIL |
| Ga0179592_100265264 | 3300020199 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLLV |
| Ga0210403_100127184 | 3300020580 | Soil | MLRSAALRFTAEGRLLGFDSGDWSMLLGGFFLAGLLALMV |
| Ga0210403_100515133 | 3300020580 | Soil | MMLWFATDGRLLGFDIGDWSMLLGGFVLAGLLTLLV |
| Ga0210403_101291264 | 3300020580 | Soil | MLRFAHFTTDGRLLGFDIGDWSMLLGGFVLAGLLTLLV |
| Ga0210403_101400282 | 3300020580 | Soil | MLRSAAVRFTAEGRLLGFDTGDWSMLLGGFFLAGFLALMV |
| Ga0210403_102151372 | 3300020580 | Soil | MLRTASLHLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV |
| Ga0210403_106606932 | 3300020580 | Soil | MLRLTTLRLTTDGRLLGFDTGDWSMLLGGFMVAGLLALLV |
| Ga0210399_101392553 | 3300020581 | Soil | MLRSAALRFTTGGRLLGFDTGDWSMLLGGFFLAGFLALMV |
| Ga0210406_106958151 | 3300021168 | Soil | MLRLTTLRLTSDGRLLGFDTGDWSILLGGFMVAGLLALLV |
| Ga0210400_103331493 | 3300021170 | Soil | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLFV |
| Ga0210400_110393461 | 3300021170 | Soil | MTRLTTLRLTTDGRLLGFDSGDWSMLLGGFVVAGLLALLV |
| Ga0210405_113762432 | 3300021171 | Soil | MLRLTALRLTSDGRLLGFDTGDWSMLLGGFMVAGLLALLV |
| Ga0213874_100118612 | 3300021377 | Plant Roots | MSRLTARLTIDGRLLGFDTGDWSMLLGGFVLAGLVALLV |
| Ga0210393_101871992 | 3300021401 | Soil | MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV |
| Ga0210389_103560361 | 3300021404 | Soil | MLRLATLRLTSDGRLLGFDTGDWSMLLGGFVLAGLVALLV |
| Ga0210387_100540214 | 3300021405 | Soil | MLRFSQFTTDGRLLGLDTGDWSMLLGGLALAGLLILFV |
| Ga0210394_111981931 | 3300021420 | Soil | MLRSLALRFTAEGRLLGFDTGDWSVLLGGFFVAGLLTLII |
| Ga0210384_116443872 | 3300021432 | Soil | MLRLTTLRLTNDGRLLGFDTGDWSMLLGGFVLAGLLALLV |
| Ga0187846_103769941 | 3300021476 | Biofilm | MLRLATNLRFTNDGRLLGFDTGDWSMLLGGFAVAGLLSLLV |
| Ga0210402_108404711 | 3300021478 | Soil | MLRSAVLRFTAEGRLLGFDTGDWSMLFGGFFLAGLLTLMV |
| Ga0210402_118369081 | 3300021478 | Soil | MLRSAALRFTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV |
| Ga0210410_1000641114 | 3300021479 | Soil | MLRFTHFTTDGRLLGLDIGDWSMLLGGFVLAGLLILLV |
| Ga0126371_100138217 | 3300021560 | Tropical Forest Soil | MLRLATNLRLTSDGRLLGFDRGDWSMLLGGFAVAGLLSLLV |
| Ga0126371_100665844 | 3300021560 | Tropical Forest Soil | MSRLMTLRITTDGRLLGFDTGDWSILLGGFAVAGLLALMV |
| Ga0126371_108313252 | 3300021560 | Tropical Forest Soil | MLRQAALRLTAEGRLLGFDTGDWSILLGGFVLAGLVALLV |
| Ga0126371_115960652 | 3300021560 | Tropical Forest Soil | MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLTLLV |
| Ga0126371_118903771 | 3300021560 | Tropical Forest Soil | MLLFATTLRLTGDGRLLGFDTGDWSMLLGGFVVAGLLSLLV |
| Ga0126371_128552511 | 3300021560 | Tropical Forest Soil | MSPRMTSRITTDGRLLGFDTGDWSILLGGAVLAGLLAMMV |
| Ga0213853_111956394 | 3300021861 | Watersheds | MLRTASLHLTAEGRLLGFDIGDWSVLLGGFVLAGLLALMV |
| Ga0209871_10773632 | 3300026217 | Permafrost Soil | MLRSATLRFSGEGRLLGFDTGDWSMLLGGFFLAGLLALMV |
| Ga0257157_10361433 | 3300026496 | Soil | MLRFTHFTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV |
| Ga0257157_10698801 | 3300026496 | Soil | MFARMTAQRRLLGFDIGDWSMLLGGLTLAGVLALLI |
| Ga0209648_100279507 | 3300026551 | Grasslands Soil | MLRLTTLRVTSDGRLLGFDTGDWSMLLGGFVLAGLLALLV |
| Ga0179593_10240242 | 3300026555 | Vadose Zone Soil | MLRLATLRFTTDGRLLGFDTGDWSMLLGGFVLAGLVALLV |
| Ga0179587_106474512 | 3300026557 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDTGDWSMLLGGFMLAGLLALFV |
| Ga0208984_11329612 | 3300027546 | Forest Soil | MQRLTTLHLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV |
| Ga0209733_10048864 | 3300027591 | Forest Soil | MFMRMTAQRRLLGLDIGDWSMLLGGLTLAGVLALFI |
| Ga0209328_102053061 | 3300027727 | Forest Soil | MLRLTTTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLTLFV |
| Ga0208989_103056631 | 3300027738 | Forest Soil | MQRLTALHLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLFV |
| Ga0209579_106611121 | 3300027869 | Surface Soil | TLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV |
| Ga0209068_100007687 | 3300027894 | Watersheds | MQRLTYFTADGRLLGFDTGDWSLLLGGFVVAGLLTLFV |
| Ga0209068_100012783 | 3300027894 | Watersheds | MLRFTQLTTDGRLLGFDTGDWSMLLGGFVLAGLLALFV |
| Ga0209048_101494253 | 3300027902 | Freshwater Lake Sediment | MLRLTTLRLTTDGRLLGFDTGDWSMLLGGFVLAGLVALFV |
| Ga0209048_107812271 | 3300027902 | Freshwater Lake Sediment | MLRTATLRLTAEGRLLGFDTGDWSMLLGGFFLAGLLALMV |
| Ga0209488_109356232 | 3300027903 | Vadose Zone Soil | MLRLTTLRLTSDGRLLGFDSGDWSMLLGGFVLAGLLTLFV |
| Ga0209698_108330582 | 3300027911 | Watersheds | MRTGVGIMLPLTHFTTDGRLLGFDLGDWSMLLGGFVLAGLLTLFV |
| Ga0209069_107801711 | 3300027915 | Watersheds | MTRLTTFRLTTDGRLLGFDTGDWSMLLGGFVLAGLLTLF |
| Ga0209062_1000188144 | 3300027965 | Surface Soil | MLRIATLRLTSDGRLLGFDTGDWSMLLGGFALAGLLALFV |
| Ga0209526_103751281 | 3300028047 | Forest Soil | MLRLTTTLRLTSDGRLLGFDTGDWSMLLGGLVLAGLVTLFV |
| Ga0137415_113012221 | 3300028536 | Vadose Zone Soil | MLRLSTLRLTSDGRLLGFDTGDWSMLLGGFVLAGLLALFV |
| Ga0308309_113252141 | 3300028906 | Soil | LTKVAMMSRLTTLRLTTDGRLLGFDTGDWSMLLGGFVLAGLLALLV |
| Ga0170834_1003394742 | 3300031057 | Forest Soil | MMLRFATDGRLLGFDIGDWSMLLGGFVLAGLLTLLV |
| Ga0318542_105968412 | 3300031668 | Soil | MDASKMLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLALMA |
| Ga0307476_102086321 | 3300031715 | Hardwood Forest Soil | MSRLAARLTTDGRLLGFDTGDWSMLLGGFVLAALLALLV |
| Ga0318550_104126241 | 3300031797 | Soil | MLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLA |
| Ga0306919_103960852 | 3300031879 | Soil | MLRFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV |
| Ga0306925_100291814 | 3300031890 | Soil | MLRYAALGLRAEGRLLGLDTGDWSMLIGGFFLAGLLALMA |
| Ga0306925_109285402 | 3300031890 | Soil | MSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV |
| Ga0310912_105382002 | 3300031941 | Soil | RFATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV |
| Ga0306926_120377381 | 3300031954 | Soil | ATTLRLTSDGRLLGFDTGDWSMLLGGFVVAGLLSLLV |
| Ga0306924_118255391 | 3300032076 | Soil | MSRLATLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV |
| Ga0306920_1011365581 | 3300032261 | Soil | MSNNKHQGYPMSRLMTLRITTDGRLLGFDTGDWSMLLGGFVLAGLLAMLV |
| Ga0306920_1017562091 | 3300032261 | Soil | MSRLMTLRIATDGRLLGFDTGDWSMLLGGFFLAGVLALMV |
| ⦗Top⦘ |