


| Basic Information | |
|---|---|
| Family ID | F073985 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAVREV |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 2.50 |
| PF13358 | DDE_3 | 2.50 |
| PF00078 | RVT_1 | 1.67 |
| PF05168 | HEPN | 1.67 |
| PF13551 | HTH_29 | 1.67 |
| PF13546 | DDE_5 | 1.67 |
| PF02452 | PemK_toxin | 1.67 |
| PF13267 | DUF4058 | 0.83 |
| PF00891 | Methyltransf_2 | 0.83 |
| PF03458 | Gly_transporter | 0.83 |
| PF10544 | T5orf172 | 0.83 |
| PF04307 | YdjM | 0.83 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF13359 | DDE_Tnp_4 | 0.83 |
| PF12680 | SnoaL_2 | 0.83 |
| PF13610 | DDE_Tnp_IS240 | 0.83 |
| PF13580 | SIS_2 | 0.83 |
| PF01656 | CbiA | 0.83 |
| PF07992 | Pyr_redox_2 | 0.83 |
| PF04434 | SWIM | 0.83 |
| PF13565 | HTH_32 | 0.83 |
| PF00665 | rve | 0.83 |
| PF01494 | FAD_binding_3 | 0.83 |
| PF13518 | HTH_28 | 0.83 |
| PF01717 | Meth_synt_2 | 0.83 |
| PF13401 | AAA_22 | 0.83 |
| PF00890 | FAD_binding_2 | 0.83 |
| PF12706 | Lactamase_B_2 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.83 |
| PF01408 | GFO_IDH_MocA | 0.83 |
| PF07589 | PEP-CTERM | 0.83 |
| PF14534 | DUF4440 | 0.83 |
| PF01526 | DDE_Tnp_Tn3 | 0.83 |
| PF12762 | DDE_Tnp_IS1595 | 0.83 |
| PF12760 | Zn_Tnp_IS1595 | 0.83 |
| PF00753 | Lactamase_B | 0.83 |
| PF03972 | MmgE_PrpD | 0.83 |
| PF01548 | DEDD_Tnp_IS110 | 0.83 |
| PF02416 | TatA_B_E | 0.83 |
| PF00857 | Isochorismatase | 0.83 |
| PF13453 | zf-TFIIB | 0.83 |
| PF05685 | Uma2 | 0.83 |
| PF02515 | CoA_transf_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.50 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.50 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.50 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.67 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.67 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.67 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.67 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.83 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.83 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.83 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.83 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.83 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.83 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.83 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.83 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.83 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.83 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.83 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.83 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.83 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.67 % |
| Unclassified | root | N/A | 23.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01CHY2T | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 543 | Open in IMG/M |
| 2170459014|G1P06HT02HTIAF | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005171|Ga0066677_10241523 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005172|Ga0066683_10893082 | Not Available | 509 | Open in IMG/M |
| 3300005179|Ga0066684_10301059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1065 | Open in IMG/M |
| 3300005294|Ga0065705_10231256 | Not Available | 1270 | Open in IMG/M |
| 3300005294|Ga0065705_10351414 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005294|Ga0065705_10999610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 547 | Open in IMG/M |
| 3300005332|Ga0066388_103678338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 783 | Open in IMG/M |
| 3300005332|Ga0066388_105949784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 616 | Open in IMG/M |
| 3300005332|Ga0066388_107288513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 556 | Open in IMG/M |
| 3300005332|Ga0066388_107366999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 552 | Open in IMG/M |
| 3300005445|Ga0070708_100250281 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300005467|Ga0070706_101592835 | Not Available | 596 | Open in IMG/M |
| 3300005540|Ga0066697_10715779 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005554|Ga0066661_10535687 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005558|Ga0066698_10076081 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300005558|Ga0066698_10519555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 809 | Open in IMG/M |
| 3300005559|Ga0066700_10398423 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005562|Ga0058697_10539765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 601 | Open in IMG/M |
| 3300005713|Ga0066905_101601842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 596 | Open in IMG/M |
| 3300005713|Ga0066905_101733109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 575 | Open in IMG/M |
| 3300005719|Ga0068861_101014734 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005764|Ga0066903_101781065 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300006034|Ga0066656_10117807 | Not Available | 1630 | Open in IMG/M |
| 3300006172|Ga0075018_10019429 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300006194|Ga0075427_10056231 | Not Available | 684 | Open in IMG/M |
| 3300006844|Ga0075428_100208835 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300006845|Ga0075421_101179011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300006845|Ga0075421_101183241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 854 | Open in IMG/M |
| 3300006846|Ga0075430_100844165 | Not Available | 755 | Open in IMG/M |
| 3300006847|Ga0075431_100263016 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1750 | Open in IMG/M |
| 3300006847|Ga0075431_100534502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1161 | Open in IMG/M |
| 3300006847|Ga0075431_100815489 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006847|Ga0075431_101732549 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006871|Ga0075434_100855190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 925 | Open in IMG/M |
| 3300006871|Ga0075434_102413494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 528 | Open in IMG/M |
| 3300006880|Ga0075429_100206816 | Not Available | 1720 | Open in IMG/M |
| 3300006969|Ga0075419_10374526 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300007255|Ga0099791_10316046 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300007258|Ga0099793_10343564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 729 | Open in IMG/M |
| 3300009012|Ga0066710_103988415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 552 | Open in IMG/M |
| 3300009090|Ga0099827_10881451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 775 | Open in IMG/M |
| 3300009090|Ga0099827_11694901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 551 | Open in IMG/M |
| 3300009090|Ga0099827_11953309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 510 | Open in IMG/M |
| 3300009094|Ga0111539_12796350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 565 | Open in IMG/M |
| 3300009100|Ga0075418_12384069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300009162|Ga0075423_10160105 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300009553|Ga0105249_12434007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 596 | Open in IMG/M |
| 3300010029|Ga0105074_1068206 | Not Available | 644 | Open in IMG/M |
| 3300010046|Ga0126384_10288024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1345 | Open in IMG/M |
| 3300010046|Ga0126384_11756620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 588 | Open in IMG/M |
| 3300010047|Ga0126382_10013633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4005 | Open in IMG/M |
| 3300010047|Ga0126382_11973993 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010359|Ga0126376_11786259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 652 | Open in IMG/M |
| 3300010360|Ga0126372_10289491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1432 | Open in IMG/M |
| 3300010360|Ga0126372_10853935 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010361|Ga0126378_10165822 | Not Available | 2263 | Open in IMG/M |
| 3300010361|Ga0126378_12239270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 624 | Open in IMG/M |
| 3300010362|Ga0126377_13005412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 544 | Open in IMG/M |
| 3300010362|Ga0126377_13124845 | Not Available | 535 | Open in IMG/M |
| 3300010366|Ga0126379_10842093 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010366|Ga0126379_13580629 | Not Available | 520 | Open in IMG/M |
| 3300012203|Ga0137399_10916354 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012205|Ga0137362_10494340 | Not Available | 1058 | Open in IMG/M |
| 3300012205|Ga0137362_11460672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 570 | Open in IMG/M |
| 3300012210|Ga0137378_11220907 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 668 | Open in IMG/M |
| 3300012349|Ga0137387_10816398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300012354|Ga0137366_10831631 | Not Available | 655 | Open in IMG/M |
| 3300012356|Ga0137371_11015867 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012357|Ga0137384_10899571 | Not Available | 713 | Open in IMG/M |
| 3300012357|Ga0137384_11422991 | Not Available | 542 | Open in IMG/M |
| 3300012362|Ga0137361_10207107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1775 | Open in IMG/M |
| 3300012380|Ga0134047_1113911 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012390|Ga0134054_1272577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300012391|Ga0134035_1039878 | Not Available | 630 | Open in IMG/M |
| 3300012917|Ga0137395_11102176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 562 | Open in IMG/M |
| 3300012925|Ga0137419_10295979 | Not Available | 1236 | Open in IMG/M |
| 3300012930|Ga0137407_11808802 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012948|Ga0126375_10517048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
| 3300012971|Ga0126369_13024702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 550 | Open in IMG/M |
| 3300013306|Ga0163162_13474977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 501 | Open in IMG/M |
| 3300014150|Ga0134081_10340289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 548 | Open in IMG/M |
| 3300014267|Ga0075313_1090377 | Not Available | 748 | Open in IMG/M |
| 3300014311|Ga0075322_1136080 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300015371|Ga0132258_11069890 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300016319|Ga0182033_10946126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 764 | Open in IMG/M |
| 3300016319|Ga0182033_11976205 | Not Available | 531 | Open in IMG/M |
| 3300016341|Ga0182035_12163803 | Not Available | 504 | Open in IMG/M |
| 3300016357|Ga0182032_10100513 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300016371|Ga0182034_10583655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
| 3300016422|Ga0182039_10306656 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300017659|Ga0134083_10290560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 692 | Open in IMG/M |
| 3300017965|Ga0190266_10569783 | Not Available | 678 | Open in IMG/M |
| 3300018054|Ga0184621_10108771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 985 | Open in IMG/M |
| 3300020067|Ga0180109_1356486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 718 | Open in IMG/M |
| 3300025908|Ga0207643_10431404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 836 | Open in IMG/M |
| 3300025961|Ga0207712_10139253 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300026310|Ga0209239_1104709 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027424|Ga0209984_1061820 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027876|Ga0209974_10105589 | Not Available | 988 | Open in IMG/M |
| 3300027880|Ga0209481_10463592 | Not Available | 653 | Open in IMG/M |
| 3300027909|Ga0209382_10263555 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300028608|Ga0247819_10731820 | Not Available | 607 | Open in IMG/M |
| 3300030903|Ga0308206_1114205 | Not Available | 618 | Open in IMG/M |
| 3300030905|Ga0308200_1133049 | Not Available | 560 | Open in IMG/M |
| 3300031093|Ga0308197_10346875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 564 | Open in IMG/M |
| 3300031421|Ga0308194_10120538 | Not Available | 778 | Open in IMG/M |
| 3300031546|Ga0318538_10378787 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300031720|Ga0307469_11780797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 595 | Open in IMG/M |
| 3300031740|Ga0307468_101806570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 579 | Open in IMG/M |
| 3300031793|Ga0318548_10398843 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7 | 674 | Open in IMG/M |
| 3300031910|Ga0306923_10378204 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium RIFOXYB12_FULL_50_7 | 1613 | Open in IMG/M |
| 3300031912|Ga0306921_11505940 | All Organisms → cellular organisms → Bacteria → FCB group | 735 | Open in IMG/M |
| 3300031941|Ga0310912_10309918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1223 | Open in IMG/M |
| 3300032059|Ga0318533_10019916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4222 | Open in IMG/M |
| 3300032180|Ga0307471_101747809 | Not Available | 775 | Open in IMG/M |
| 3300032205|Ga0307472_101066282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 762 | Open in IMG/M |
| 3300033550|Ga0247829_10310481 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300034661|Ga0314782_187353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 529 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.83% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_2285120 | 2035918004 | Soil | MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAVREV |
| 2PV_01390850 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MRPLKSHFSDHALLTLDTLLKQTKEARVFRRAQAVRAVVAGQH |
| Ga0066677_102415231 | 3300005171 | Soil | MRTRKLHFPEQALPTLDTFLKQTKEARIFRRAQAVREVVQGHRLQT |
| Ga0066683_108930821 | 3300005172 | Soil | MRTLQLQFPDTALPTLETVLKETKEVRVFRRAQAVREVVK |
| Ga0066684_103010592 | 3300005179 | Soil | MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQRLQ |
| Ga0065705_102312562 | 3300005294 | Switchgrass Rhizosphere | MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQ |
| Ga0065705_103514141 | 3300005294 | Switchgrass Rhizosphere | VESPRMRTLKLHFPEDALPTLDTFLKQTKEARVFRRAQAVRDVV |
| Ga0065705_109996102 | 3300005294 | Switchgrass Rhizosphere | MRPLKSHFPAHALPTLEAVLKQPQEARGFRRAQAVREVVAGHHVNA |
| Ga0066388_1036783382 | 3300005332 | Tropical Forest Soil | MRPLKSHFPDQALTTLDTLLKQTKEARVFRRAQAVREVVAGHHINA |
| Ga0066388_1059497841 | 3300005332 | Tropical Forest Soil | MRTLKLRFPDDALPTLATFLKQTKEARVFRRAQAVREVVKGQRL |
| Ga0066388_1072885133 | 3300005332 | Tropical Forest Soil | FIAGASHMRTLKAHFPDDALSTLDIFLKKTKETRVFRRAQAVRDVVQS* |
| Ga0066388_1073669992 | 3300005332 | Tropical Forest Soil | MRTLKLRFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVQ |
| Ga0070708_1002502811 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VETPCMRTLKLHFPDDALPTLDTFVKQTKEARVFRRAQAVR |
| Ga0070706_1015928351 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPLKSHFPEHALPTLETVLKQTQEARVFRRAQAVREVVAG |
| Ga0066697_107157791 | 3300005540 | Soil | MRTLQLHFSDNAFPTLNTFLQQTKEARVFRRAQAVRD |
| Ga0066661_105356871 | 3300005554 | Soil | MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVRDVV |
| Ga0066698_100760811 | 3300005558 | Soil | MRTLKLHFPDEALPTLDTFLKQTKEARVFRRAQAVREVVKGHRLQTV |
| Ga0066698_105195551 | 3300005558 | Soil | MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVREVVKGQRL |
| Ga0066700_103984233 | 3300005559 | Soil | MRPLKSHFPDHALTTLETMLKQTKEARVFRRAQAVHAVV |
| Ga0058697_105397652 | 3300005562 | Agave | MRTLKLHFPDQALPTLDTCLKQTKEARIFRRAQAVR |
| Ga0066905_1016018422 | 3300005713 | Tropical Forest Soil | MRTLKRHLPAQALPTWDTFLKQTKEARLFRRAQAVR |
| Ga0066905_1017331091 | 3300005713 | Tropical Forest Soil | MRTLKLHFPDNALPTLDTFLKQTKEARVFRRAQAV |
| Ga0068861_1010147341 | 3300005719 | Switchgrass Rhizosphere | MRPLKNHFRDDVLTTLEAVLKQTKEARVFRRAQAVREVVAGHHV |
| Ga0066903_1017810652 | 3300005764 | Tropical Forest Soil | MRPLKSHFRDDALTTLDTVLKQTKEARVFRRAQAVREVV |
| Ga0066656_101178072 | 3300006034 | Soil | MRTLKLHFPDDALPTLDTVLKPTKEARVFRRAQAVRE |
| Ga0075018_100194291 | 3300006172 | Watersheds | MRPLKSHFPAHALTTLATVLKQTKEARVFRRAQAVHAVVAGQHVS |
| Ga0075427_100562311 | 3300006194 | Populus Rhizosphere | MRPLKSHFRAHALTTLDTMLKQTKEARVFRRAQAVHAVVAG |
| Ga0075428_1002088353 | 3300006844 | Populus Rhizosphere | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVKGQRL |
| Ga0075421_1011790111 | 3300006845 | Populus Rhizosphere | MRTLKRHFPDNALPTLDTFLKQTKEARVFRRAQAVREVVKGHRLQ |
| Ga0075421_1011832412 | 3300006845 | Populus Rhizosphere | MRTLKLHFPDDALSTLDTFLKQTKEARVFRRAQAV |
| Ga0075430_1008441651 | 3300006846 | Populus Rhizosphere | MRPLKSHFPVHALTTLDTMLKQAKEARVFRRAQAVRAVVA |
| Ga0075431_1002630161 | 3300006847 | Populus Rhizosphere | MRPLSSHFAHDALPTLDAFIKQTKKARVFRRAQAV |
| Ga0075431_1005345023 | 3300006847 | Populus Rhizosphere | MRTLTVHLPDDALPTLDTFLKQTTEARICRRAQAVRDVVTG |
| Ga0075431_1008154891 | 3300006847 | Populus Rhizosphere | MRTLKLHFPNDALPTLDTFVKQTREARVFRRAQAVREVVKGQRLQ |
| Ga0075431_1017325491 | 3300006847 | Populus Rhizosphere | MRPLNSHFAPDALPTLDSFMKHSKEARVFRRAQAVRGVVAGQ |
| Ga0075434_1008551903 | 3300006871 | Populus Rhizosphere | MRTLKLPFPDDVLPTLDTFLKQTKEARVFRRAQAVRHVV |
| Ga0075434_1024134941 | 3300006871 | Populus Rhizosphere | MRTLKLHFPDDALTALDTLLKQTKEARVFRRAQAVREV |
| Ga0075429_1002068164 | 3300006880 | Populus Rhizosphere | MRPLNSHFSHHALPTLDTLMKHSKEARVFRRAQAVREVVDGQTVKAV |
| Ga0075419_103745262 | 3300006969 | Populus Rhizosphere | MRTLKLHFPDNALPTLDTFIKQTKEARVFRRAQAVRHVVKG |
| Ga0099791_103160461 | 3300007255 | Vadose Zone Soil | MRTLTLHFPNDALPTLETFLKQTKAARVFRRAQAV |
| Ga0099793_103435641 | 3300007258 | Vadose Zone Soil | MRTLKLHFSDNALPTLDTFLKQTKEARVFRRAQAVREVVKGQRL |
| Ga0066710_1039884152 | 3300009012 | Grasslands Soil | MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVREVVKGT |
| Ga0099827_108814511 | 3300009090 | Vadose Zone Soil | MIKAGKSPLMRTLKLHFPDDALPTIDTVLKQTKEARVFRRAQAVREVVK |
| Ga0099827_116949011 | 3300009090 | Vadose Zone Soil | MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVKGQRLQT |
| Ga0099827_119533092 | 3300009090 | Vadose Zone Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRD |
| Ga0111539_127963502 | 3300009094 | Populus Rhizosphere | MRTLKLHFPDEALPTLETCLKQTKEARVFRRAQAVREVVTGHRL |
| Ga0075418_123840691 | 3300009100 | Populus Rhizosphere | MRTLKLHFPDQALPTLDTFLKQTKEARIFRRAQAVREV |
| Ga0075423_101601054 | 3300009162 | Populus Rhizosphere | MRTLKLHFPAQALPTLDTFLKQTKEARIFRRAQAVRAVVQGHRLH |
| Ga0105249_124340071 | 3300009553 | Switchgrass Rhizosphere | MRTLKLHFPEAALPTLDTFLKQTKEARVFRRAQAVRDV |
| Ga0105074_10682061 | 3300010029 | Groundwater Sand | MRPLKSHFPVHALTTLDTMLKQAKEARVFRRAQAVRAVV |
| Ga0126384_102880243 | 3300010046 | Tropical Forest Soil | MRTLHLHFPHDALSTLDTVLKQTKEARVFRRAQAVRE |
| Ga0126384_117566203 | 3300010046 | Tropical Forest Soil | MRTLKLHFPDDALPTLENFLKQTKEARIFRRAQAVRDVVRGQRL |
| Ga0126382_100136335 | 3300010047 | Tropical Forest Soil | MRTLKLHFPDDALPTLENFLKQTKEARIFRRAQAVREVVQGHRLQTV |
| Ga0126382_119739931 | 3300010047 | Tropical Forest Soil | MHPLKSHFRDDALTTLETVLKQTKEARVFLRAQAGRAVVAGHHV |
| Ga0126376_117862591 | 3300010359 | Tropical Forest Soil | MRTLKLHFPEDALPTLDTFLKQTKEARVFRRAQAVRDVV |
| Ga0126372_102894911 | 3300010360 | Tropical Forest Soil | MRTLKLHFSDQALPTLETFLKQTKEARIFRRAQAVRAVVQGHRLPT |
| Ga0126372_108539351 | 3300010360 | Tropical Forest Soil | MRTLKLHFPDNAPPTLDTFLKQTKEARVFRRAQAVRNVVKG |
| Ga0126378_101658221 | 3300010361 | Tropical Forest Soil | MRPLKSHFDADALTTLETVLKQTKEARVFRRAQAV |
| Ga0126378_122392701 | 3300010361 | Tropical Forest Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVQGQRLQTVS |
| Ga0126377_130054121 | 3300010362 | Tropical Forest Soil | MRTLKLHFAADALPTLETFLKRTKEARVFRRAQAVR |
| Ga0126377_131248451 | 3300010362 | Tropical Forest Soil | MRPLKLPFPDDALPPLENFLQQTKEARIFRRAQAVREVVQG |
| Ga0126379_108420931 | 3300010366 | Tropical Forest Soil | MRPLKSHFPEHALATLETVLKQTQEARGFRRAQAIREVVAG |
| Ga0126379_135806291 | 3300010366 | Tropical Forest Soil | MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVRAVVQGQRLPTV |
| Ga0137399_109163542 | 3300012203 | Vadose Zone Soil | MRTLKLHFPNDALPTLDTFLKQTKEARVFRRAQAVRE |
| Ga0137362_104943402 | 3300012205 | Vadose Zone Soil | MRTLQLHFSDNALPTLNTFLQQTKEARVFRRAQAARDVVTG |
| Ga0137362_114606722 | 3300012205 | Vadose Zone Soil | MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVRE |
| Ga0137378_112209071 | 3300012210 | Vadose Zone Soil | MRTLKLHFPDDALSTLDTFVKQTREARVFRRAQAVREVVKGQR |
| Ga0137387_108163982 | 3300012349 | Vadose Zone Soil | MRTLKLHFPDDALPTLETFLKQTREARVFRRAQAVR |
| Ga0137366_108316312 | 3300012354 | Vadose Zone Soil | MRPLKSHFPAHALTTLETLLKQTKEARVFRRAQAVHAVVAGQHVS |
| Ga0137371_110158671 | 3300012356 | Vadose Zone Soil | MRTLKLHFPDDALSTLDTFVKQTKEARVFRRAQAVRDVVKGRRMQNV |
| Ga0137384_108995711 | 3300012357 | Vadose Zone Soil | MRPLKSHFPEHALPTLETVLKQTQEARVFRRAQAVRE |
| Ga0137384_114229911 | 3300012357 | Vadose Zone Soil | MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAV |
| Ga0137361_102071073 | 3300012362 | Vadose Zone Soil | MRPLKSHFPDHALTTLDTMLKQTKEARVFRRAQAVHAVVAGQHVS |
| Ga0134047_11139112 | 3300012380 | Grasslands Soil | MRTLKLHFPDEALPTLDTYLKQTTEARVFRRAQAV |
| Ga0134054_12725771 | 3300012390 | Grasslands Soil | MRPLKSHFPEHALTTLDTLLKQTKEARVFRRAQAV |
| Ga0134035_10398781 | 3300012391 | Grasslands Soil | MRPLKSHFPDHALTTLDTLLKQTKEARVFRRAQAVREVM |
| Ga0137395_111021761 | 3300012917 | Vadose Zone Soil | MRTLKLHFPDDALPTLDTFVKQTREARVFRRAQAVRE |
| Ga0137419_102959791 | 3300012925 | Vadose Zone Soil | MRPLKSHFPAHALPTVETVLKQPQEARGLRRAQAGRAVGAGPQVNTVSTTF |
| Ga0137407_118088022 | 3300012930 | Vadose Zone Soil | MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVREVV |
| Ga0126375_105170482 | 3300012948 | Tropical Forest Soil | MRPLTLPLPDEALPTLDTFLKKTKAARVFRRAQAGRDVVT |
| Ga0126369_130247022 | 3300012971 | Tropical Forest Soil | METTRMRTLKLHFPDDALSTLDTCLKQTKEARVFRRAQA |
| Ga0163162_134749771 | 3300013306 | Switchgrass Rhizosphere | MRTLKLHFADDALPTLDAFLKRTKEARIFRRAQAVREVIKGQR |
| Ga0134081_103402891 | 3300014150 | Grasslands Soil | MRTLQLHFSANALPTLNTFLQQTKEARVFRRAQAVRDVVTGQ |
| Ga0075313_10903773 | 3300014267 | Natural And Restored Wetlands | MRPLNSHFSHDALPTLDTFMKHSKDARVFRRAQAVREVV |
| Ga0075322_11360801 | 3300014311 | Natural And Restored Wetlands | MRPLSSHFVHDALPTLDAFIKQTKKARVFRRAQAVREVVAGHTVK |
| Ga0132258_110698904 | 3300015371 | Arabidopsis Rhizosphere | MRTLKLPFPDTALSTLDTFLKQTREVRVFRRAQAVR |
| Ga0182033_109461262 | 3300016319 | Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQ |
| Ga0182033_119762051 | 3300016319 | Soil | MRTLQLHFADDALPTLDMALKQTKDARIFRRAQAVREVVKGQRLQTV |
| Ga0182035_121638032 | 3300016341 | Soil | MRTLKLQFPDDALPTLDTFLKQTKEARVFRRAQAVRAVV |
| Ga0182032_101005134 | 3300016357 | Soil | MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVR |
| Ga0182034_105836552 | 3300016371 | Soil | MRPLKSHFPDHALTTLDTLLKQTKEARVFRRAQAVREVVA |
| Ga0182039_103066561 | 3300016422 | Soil | MRTLKLYFPDDALSTLDTFVKQTTEARVFRRAQAVRQV |
| Ga0134083_102905602 | 3300017659 | Grasslands Soil | MRTLTLHFPDDALPTLETFLHQTTKARIFRRAQAVRAVVKGQRLQT |
| Ga0190266_105697832 | 3300017965 | Soil | MRTLKLHFPDEALPTLDTCLKQTKEARVFRRAQAV |
| Ga0184621_101087711 | 3300018054 | Groundwater Sediment | MRTLQLHFPDDALPTLDTVLKQTKEARVFRRAQAVREVVK |
| Ga0180109_13564862 | 3300020067 | Groundwater Sediment | MWTLKLHFCEDALPTLDTFVKQTTEARVFRRAQAVRA |
| Ga0207643_104314041 | 3300025908 | Miscanthus Rhizosphere | MRTLKLHFPDDALPTLDTFVKQTREARVFRRAQAVREVVKGQRLQTVS |
| Ga0207712_101392533 | 3300025961 | Switchgrass Rhizosphere | MRTLQLQCPETALPTLETVLKETKEVRVFRRAQAV |
| Ga0209239_11047091 | 3300026310 | Grasslands Soil | MRTLKLHFPDEALPTLDTYLKQTKEARVFRRAQAVREVVK |
| Ga0209984_10618201 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MRTLTLHFPDQALPTLDTFLKQTKEARIFRRAQAVRAVVQGHRLQ |
| Ga0209974_101055892 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MRPLNSHFPHHALPTLDTFMKHSKEARVFRRAQAVRE |
| Ga0209481_104635922 | 3300027880 | Populus Rhizosphere | MRTLKLHFPDDALPTLDTFLKQAKEARVFRRAQAVRAVVKGHRLQT |
| Ga0209382_102635555 | 3300027909 | Populus Rhizosphere | MRTLKLHFPDDALSTLDTFLKQTKEARVFRRAQAVHHVVKG |
| Ga0247819_107318202 | 3300028608 | Soil | MRTLKLHFPDDALPTLENFLKQTKEARIFCRAQAVREVVQGHPY |
| Ga0308206_11142052 | 3300030903 | Soil | MRPLKSHFPANALPTLETVLKQTQEARVFRRAQAVREVVAGHHVH |
| Ga0308200_11330492 | 3300030905 | Soil | MRPLKSHFSDQALPTLETILKQTKEARVFRRAQAVREVVAG |
| Ga0308197_103468751 | 3300031093 | Soil | MRTLKLHFPDDTLPALDIFLKQTKEARVFRRAQAVRDVVKGQYLQTVS |
| Ga0308194_101205381 | 3300031421 | Soil | MRTLQLHFPEDALPTLDTVLKQTKEARVFRRAQAVR |
| Ga0318538_103787871 | 3300031546 | Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQT |
| Ga0307469_117807972 | 3300031720 | Hardwood Forest Soil | MRPLKSHFPDHALSTLDTVLKQTKEARVFRRAQAVQAVVAGQHV |
| Ga0307468_1018065701 | 3300031740 | Hardwood Forest Soil | MRPLKLHCPHDALTTLDPFVKQTKEARVFRRAQAVREVVKG |
| Ga0318548_103988432 | 3300031793 | Soil | MTLKLHFPDQALPTLETFLKQTKEARIFRRAQAVREVVHGHRRQ |
| Ga0306923_103782041 | 3300031910 | Soil | MTLKLHFPDQALPTLETFLKQTKEARIFRRAQAVREVVQ |
| Ga0306921_115059402 | 3300031912 | Soil | MRTLKLHVPDAALPPWDPFVQQTKEARVFRRAQAVRAVERRG |
| Ga0310912_103099182 | 3300031941 | Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRHVVNGQRLQTV |
| Ga0318533_100199167 | 3300032059 | Soil | MRPLKSHFHADALTTLDTVLKQTKEARVFRRAQAVREVVAG |
| Ga0307471_1017478091 | 3300032180 | Hardwood Forest Soil | MRTLKLHFPDEALPTLDIYLKQTKEARVFRRAQAVREVVKGQRLQ |
| Ga0307472_1010662821 | 3300032205 | Hardwood Forest Soil | MRTLKLHFPDDALPTLDTFFKQTKAARVFRRAQAVRNVVQGQRLHTV |
| Ga0247829_103104812 | 3300033550 | Soil | MRPLKSHFRADALTTLEAVLPQTKEARVFRRAQAVRE |
| Ga0314782_187353_393_527 | 3300034661 | Soil | MRTLKLHFPDDALPTLDTFLKQTKEARVFRRAQAVRDVVKGQRLQ |
| ⦗Top⦘ |