


| Basic Information | |
|---|---|
| Family ID | F073883 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DSEMGEKFRQTLRQDAPLRAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.83 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 20.00 |
| PF13673 | Acetyltransf_10 | 13.33 |
| PF00437 | T2SSE | 11.67 |
| PF01734 | Patatin | 6.67 |
| PF03544 | TonB_C | 2.50 |
| PF01381 | HTH_3 | 1.67 |
| PF01063 | Aminotran_4 | 1.67 |
| PF12706 | Lactamase_B_2 | 1.67 |
| PF01479 | S4 | 1.67 |
| PF13508 | Acetyltransf_7 | 1.67 |
| PF12161 | HsdM_N | 1.67 |
| PF00697 | PRAI | 0.83 |
| PF01336 | tRNA_anti-codon | 0.83 |
| PF02627 | CMD | 0.83 |
| PF12848 | ABC_tran_Xtn | 0.83 |
| PF00375 | SDF | 0.83 |
| PF13649 | Methyltransf_25 | 0.83 |
| PF00749 | tRNA-synt_1c | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 6.67 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 6.67 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 6.67 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 3.33 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.50 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.83 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.83 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.83 % |
| Unclassified | root | N/A | 24.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002906|JGI25614J43888_10158259 | Not Available | 606 | Open in IMG/M |
| 3300004082|Ga0062384_100125823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1415 | Open in IMG/M |
| 3300004092|Ga0062389_101281948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300004635|Ga0062388_100393226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1201 | Open in IMG/M |
| 3300005178|Ga0066688_10975950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005471|Ga0070698_100691005 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005575|Ga0066702_10896065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005591|Ga0070761_11110393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005938|Ga0066795_10046190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300005938|Ga0066795_10181076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300006050|Ga0075028_100637143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300006059|Ga0075017_100407264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300006102|Ga0075015_100003273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6420 | Open in IMG/M |
| 3300006174|Ga0075014_100363909 | Not Available | 779 | Open in IMG/M |
| 3300006175|Ga0070712_101647772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300006893|Ga0073928_10226084 | Not Available | 1447 | Open in IMG/M |
| 3300007265|Ga0099794_10335353 | Not Available | 785 | Open in IMG/M |
| 3300009089|Ga0099828_10568655 | Not Available | 1021 | Open in IMG/M |
| 3300009521|Ga0116222_1113250 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009522|Ga0116218_1117943 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300009524|Ga0116225_1330679 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300009524|Ga0116225_1507205 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009549|Ga0116137_1192736 | Not Available | 547 | Open in IMG/M |
| 3300009628|Ga0116125_1162183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009630|Ga0116114_1064600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300009635|Ga0116117_1008360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2715 | Open in IMG/M |
| 3300009638|Ga0116113_1112507 | Not Available | 663 | Open in IMG/M |
| 3300009639|Ga0116122_1161912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300009644|Ga0116121_1256228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009700|Ga0116217_10014599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6362 | Open in IMG/M |
| 3300010043|Ga0126380_11048520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300010341|Ga0074045_10032375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3932 | Open in IMG/M |
| 3300010379|Ga0136449_101797514 | Not Available | 917 | Open in IMG/M |
| 3300010379|Ga0136449_101868888 | Not Available | 894 | Open in IMG/M |
| 3300011269|Ga0137392_10574314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300011270|Ga0137391_10904392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012200|Ga0137382_10592955 | Not Available | 791 | Open in IMG/M |
| 3300012205|Ga0137362_10328267 | Not Available | 1324 | Open in IMG/M |
| 3300012363|Ga0137390_11079130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012925|Ga0137419_10211092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
| 3300012927|Ga0137416_11279739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300014151|Ga0181539_1035657 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300014199|Ga0181535_10861826 | Not Available | 511 | Open in IMG/M |
| 3300015193|Ga0167668_1081510 | Not Available | 626 | Open in IMG/M |
| 3300017823|Ga0187818_10035070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2155 | Open in IMG/M |
| 3300017925|Ga0187856_1224061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300017933|Ga0187801_10099879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
| 3300017934|Ga0187803_10092506 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300017943|Ga0187819_10556965 | Not Available | 651 | Open in IMG/M |
| 3300017943|Ga0187819_10561196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300017972|Ga0187781_10094174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2075 | Open in IMG/M |
| 3300017972|Ga0187781_10251064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300017975|Ga0187782_10414047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300018003|Ga0187876_1199632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300018026|Ga0187857_10238950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300018034|Ga0187863_10076694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1886 | Open in IMG/M |
| 3300018038|Ga0187855_10853666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300018040|Ga0187862_10285085 | Not Available | 1048 | Open in IMG/M |
| 3300018042|Ga0187871_10789761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300018044|Ga0187890_10322436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300018044|Ga0187890_10541834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300018044|Ga0187890_10805313 | Not Available | 532 | Open in IMG/M |
| 3300018085|Ga0187772_10315196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300018085|Ga0187772_10566536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300018088|Ga0187771_11229878 | Not Available | 635 | Open in IMG/M |
| 3300018090|Ga0187770_10983004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300020579|Ga0210407_10156839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1756 | Open in IMG/M |
| 3300020582|Ga0210395_10146477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1761 | Open in IMG/M |
| 3300021407|Ga0210383_11452002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300021433|Ga0210391_10019564 | All Organisms → cellular organisms → Bacteria | 5457 | Open in IMG/M |
| 3300022557|Ga0212123_10157061 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300024227|Ga0228598_1002142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4320 | Open in IMG/M |
| 3300025496|Ga0208191_1053799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300025581|Ga0208355_1048724 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300025928|Ga0207700_10028457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3930 | Open in IMG/M |
| 3300026273|Ga0209881_1185797 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026489|Ga0257160_1051998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300026507|Ga0257165_1112600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026557|Ga0179587_10483317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300027590|Ga0209116_1078582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300027641|Ga0208827_1112269 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300027853|Ga0209274_10151725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1167 | Open in IMG/M |
| 3300027853|Ga0209274_10744880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300027854|Ga0209517_10506009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300027854|Ga0209517_10559081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027854|Ga0209517_10698669 | Not Available | 522 | Open in IMG/M |
| 3300027855|Ga0209693_10280671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300027855|Ga0209693_10304960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300027875|Ga0209283_10503334 | Not Available | 779 | Open in IMG/M |
| 3300027879|Ga0209169_10189173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300027882|Ga0209590_10812194 | Not Available | 593 | Open in IMG/M |
| 3300027895|Ga0209624_10478055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300027905|Ga0209415_10628616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300028536|Ga0137415_10955262 | Not Available | 668 | Open in IMG/M |
| 3300028651|Ga0302171_10052796 | Not Available | 987 | Open in IMG/M |
| 3300028866|Ga0302278_10193600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300029903|Ga0247271_128980 | Not Available | 577 | Open in IMG/M |
| 3300029910|Ga0311369_10129781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2471 | Open in IMG/M |
| 3300029952|Ga0311346_10671950 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300030011|Ga0302270_10536915 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300030399|Ga0311353_10596883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300030580|Ga0311355_10505821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300030659|Ga0316363_10120154 | Not Available | 1150 | Open in IMG/M |
| 3300030659|Ga0316363_10407972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 527 | Open in IMG/M |
| 3300030707|Ga0310038_10154829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1135 | Open in IMG/M |
| 3300031231|Ga0170824_107345467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300031344|Ga0265316_10807665 | Not Available | 658 | Open in IMG/M |
| 3300031708|Ga0310686_114479638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3295 | Open in IMG/M |
| 3300031754|Ga0307475_10863916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300031962|Ga0307479_10242203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1779 | Open in IMG/M |
| 3300031962|Ga0307479_11063782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300032805|Ga0335078_11883697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300032898|Ga0335072_11690811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300032955|Ga0335076_10186998 | Not Available | 1977 | Open in IMG/M |
| 3300033158|Ga0335077_11107101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300033755|Ga0371489_0004514 | All Organisms → cellular organisms → Bacteria | 15600 | Open in IMG/M |
| 3300033755|Ga0371489_0189723 | Not Available | 1076 | Open in IMG/M |
| 3300033829|Ga0334854_113328 | Not Available | 652 | Open in IMG/M |
| 3300033891|Ga0334811_128099 | Not Available | 636 | Open in IMG/M |
| 3300033982|Ga0371487_0084329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.67% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25614J43888_101582591 | 3300002906 | Grasslands Soil | MAEKFRQTLRQDAPVRAPEMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0062384_1001258233 | 3300004082 | Bog Forest Soil | VTSDSEMGEKFRQTLRQDTPVRNPEVEQQLQSATDSIMLRYLADSKFRKPN* |
| Ga0062389_1012819482 | 3300004092 | Bog Forest Soil | SDSEMGEKFRQTLRTDAPVRSPEMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0062388_1003932261 | 3300004635 | Bog Forest Soil | MGEKFRQTLRQDAPLQAPGAQQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0066688_109759502 | 3300005178 | Soil | QTLRQDAPVRAPEMEQQFQSASDAIMLRYLADSKFRKPN* |
| Ga0070698_1006910052 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KFRQTLRQDTPLQAPEMERQFQSATDAIMLRYLADSKFRKPN* |
| Ga0066702_108960651 | 3300005575 | Soil | LWFYMQVVTSDSEMGEKFRQSLRQDAPAAAVPEMERQFQSATDAIMLRYLADSKFRKPD* |
| Ga0070761_111103931 | 3300005591 | Soil | EKFRQTLRQEAPIQVPEVEQQFQSATDAIMLRYLADSKYRKPN* |
| Ga0066795_100461902 | 3300005938 | Soil | DSEMGEKFRQTLRQDAPLRAPEMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0066795_101810762 | 3300005938 | Soil | NDSEMGEKFRQTLRQDAPLRAPEMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0075028_1006371431 | 3300006050 | Watersheds | MQVVTSDSEMGEKFRQTLRQDVPARVPEMEQQFQSATDSIMLRYLADSKFRKPN* |
| Ga0075017_1004072641 | 3300006059 | Watersheds | SEMGEKFRQSLRQDTSVRAAEVEQQFQSATDSIMLRYLADNKYRKPN* |
| Ga0075015_1000032731 | 3300006102 | Watersheds | SDSEMGEKFRQSLRQDASLRASEMEQQFQNATDSIMLRYLADSKYRKPN* |
| Ga0075014_1003639092 | 3300006174 | Watersheds | FYMQVVTSDSEMGEKFRQSLRQDASFRASEIEQQFQSATDSIMLRYIADSKYRKPN* |
| Ga0070712_1016477721 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DSEMGEKFRQSLRQDAPAAAVPEMERQFQSATDAIMLRYLADSKFRKPD* |
| Ga0073928_102260841 | 3300006893 | Iron-Sulfur Acid Spring | LRQDAPVPAPGMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0099794_103353531 | 3300007265 | Vadose Zone Soil | KFRQTLRQDAPVRAPEMEQQFQSASDAIMLRYLADSKFRKPN* |
| Ga0099828_105686551 | 3300009089 | Vadose Zone Soil | LRQTLRQDNSPRAPETEQQQHMQNASDSIMLRYLADSKFRKPN* |
| Ga0116222_11132503 | 3300009521 | Peatlands Soil | KFRQTLRQDTPTQPAEMEQQFQNATDAIMLRYIADSKFRRPN* |
| Ga0116218_11179434 | 3300009522 | Peatlands Soil | QTLRQDTPQQAPEMEQQFQNATDAIMLRYIADSKFRRPN* |
| Ga0116225_13306792 | 3300009524 | Peatlands Soil | ASDSEIGEKFRQTLRQDTPPQAPEMEQQFQNATDAIMLRYIADSKFRRPN* |
| Ga0116225_15072052 | 3300009524 | Peatlands Soil | EKFRQTLRQDARVRAPEMEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0116137_11927361 | 3300009549 | Peatland | KFRQTLRQDAPVRPPEMEQQFQNATDAIMLRYLADSKFRKPN* |
| Ga0116125_11621831 | 3300009628 | Peatland | RQTLRQEAPLQVPEKEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0116114_10646001 | 3300009630 | Peatland | QTLRQDVPAGAPEVEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0116117_10083601 | 3300009635 | Peatland | KFRQTMRQDSPVPTPEVDQQFQSATDAIMLRYIADSRFRKPN* |
| Ga0116113_11125071 | 3300009638 | Peatland | QEAPLQVPEAEQQFQSATDAIMLRYLADSKYRKPN* |
| Ga0116122_11619121 | 3300009639 | Peatland | EMGEKFRETLRHDAPAPPEMEQQFQNATDAIMLRYLADSKFRKPN* |
| Ga0116121_12562282 | 3300009644 | Peatland | GEKFRQTLRQEAPLQVPEAEQQFQSATDAIMLRYLADSKYRKPN* |
| Ga0116217_100145998 | 3300009700 | Peatlands Soil | EKFRETLRQDAPVQAPELEQQFQNATDAIMLRYLAESKFRKPN* |
| Ga0126380_110485202 | 3300010043 | Tropical Forest Soil | TSGSEMGEKLRQTLRQDASASHENEKLQQLQNASDAIMLRHLAESKFRKPN* |
| Ga0074045_100323753 | 3300010341 | Bog Forest Soil | VTSDSEMGEKFRQTVRQDAREQPPELEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0136449_1017975142 | 3300010379 | Peatlands Soil | GEKFRETLRQDAPVQAPELEQQFQNATDAIMLRYLAESKFRKPN* |
| Ga0136449_1018688882 | 3300010379 | Peatlands Soil | GEKFRETLRQDAPVQAPELEQQFQNATDAIMLRYLAESKFHKPN* |
| Ga0137392_105743142 | 3300011269 | Vadose Zone Soil | DSEMGEKFRQTLRQDAPLRAPEIEQQFQSATDAIMLRYLADSKFRKPN* |
| Ga0137391_109043921 | 3300011270 | Vadose Zone Soil | MGEKFRQTLRQDAPVRAPEMEQQFQSASDAIMLRYLADSKFRKPN* |
| Ga0137382_105929551 | 3300012200 | Vadose Zone Soil | SEMGEKLRQSLRQDNSSRAPETEQQQHMQNASDSIMLRYLADSKFRKPN* |
| Ga0137362_103282672 | 3300012205 | Vadose Zone Soil | RQDAPVRAPEMEQQFQSASDAIMLRYLADSKFRKPN* |
| Ga0137390_110791301 | 3300012363 | Vadose Zone Soil | EMGEKFRQTLRQDTPLQAPEMERQFQSATDAIMLRYLADSKFRKPN* |
| Ga0137419_102110922 | 3300012925 | Vadose Zone Soil | VMTSGSEMGEKLRQTLRQDPSPRVPETEKQQHMQNASDAIMLRYLADSKFRKPN* |
| Ga0137416_112797392 | 3300012927 | Vadose Zone Soil | MTSGSEMGEKLRQTLRQDPSPRIPGTDKQQHLQNASDAIMLRYLADSKFRKPN* |
| Ga0181539_10356574 | 3300014151 | Bog | RQDAPVRPPEMEQQFQNATDAIMLRYLADSKFRKPN* |
| Ga0181535_108618262 | 3300014199 | Bog | DSEMGEKFRETLRRDTPVRVPEMEQQLQSATDAIMLRYLADSKFRKPN* |
| Ga0167668_10815102 | 3300015193 | Glacier Forefield Soil | LRQDASAPAVPDMESQFQNATDAIMLRYLADSKFRKPN* |
| Ga0187818_100350701 | 3300017823 | Freshwater Sediment | VTSDSEMGEKFRQTLRQDARVRPPEMEQQFQNATDAIMLRYLADSKFRKPN |
| Ga0187856_12240612 | 3300017925 | Peatland | RQDAPVRPPEMEQQFQNATDAIMLRYLADSKFRKPN |
| Ga0187801_100998794 | 3300017933 | Freshwater Sediment | VVISDSEMGEKFRQSLRQEAALHTSEVEQQFQSATDSIMLRYLADSKYRKPN |
| Ga0187803_100925063 | 3300017934 | Freshwater Sediment | QSLRQDTGPRGQELQQQIQSTADAMMLRYLADNKYRKPN |
| Ga0187819_105569652 | 3300017943 | Freshwater Sediment | MQVVTSDSEMGEKFRQTVRQDTRVQAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0187819_105611962 | 3300017943 | Freshwater Sediment | QVVTSDSEMGEKFRQTLRQETPIRAPEAEQQFQSATDAIMLRYLADSRFRKPN |
| Ga0187781_100941741 | 3300017972 | Tropical Peatland | RQDVPPQAPEIEQQFQNATDAIMLRYIADSKFRKPN |
| Ga0187781_102510641 | 3300017972 | Tropical Peatland | QTVRQEAMAHAPVIDQQFQSATDAIMLRYLADSRFRKPN |
| Ga0187782_104140473 | 3300017975 | Tropical Peatland | DSEMGEKFRQSVRQENAVHAPEVDQQFQNATDAIMLRYLADSRFRKPN |
| Ga0187876_11996321 | 3300018003 | Peatland | TLRHDAPAPPEMEQQFQNATDAIMLRYIADSKFRRPN |
| Ga0187857_102389502 | 3300018026 | Peatland | WFYIQVVTSDSEMGEKFRQTLRQDAPLQAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0187863_100766943 | 3300018034 | Peatland | FYMQVVTSDSEMGEKFRQTLRQETPAQVPEMEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0187855_108536661 | 3300018038 | Peatland | SEMGEKFRQTLRQEAPVQVPEMEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0187862_102850851 | 3300018040 | Peatland | MGEKFRETLRQDAPVRAPEMEQQFQSATDDIMLRYLADSKFRKPN |
| Ga0187871_107897612 | 3300018042 | Peatland | EKFRQTLRQEAPVQVPEMEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0187890_103224362 | 3300018044 | Peatland | RQEAPVQVPEMEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0187890_105418341 | 3300018044 | Peatland | MQVVTSDSEMGEKFRETLRQDAPVRPPEMEQQLQNATDAIMLRYLADSKFRKPN |
| Ga0187890_108053131 | 3300018044 | Peatland | RQTLRQDAPVRPPEMEQQFQNATDAIMLRYLADSKFRKPN |
| Ga0187772_103151961 | 3300018085 | Tropical Peatland | QVVTSDSEMGEKFRQTVRQEATAKNAEIDQQFQSATDAIMLRYIADSRFRKPN |
| Ga0187772_105665362 | 3300018085 | Tropical Peatland | QTVRQEASVRAAEVDQFQNATDAIMLRYLADSRYRKPN |
| Ga0187771_112298781 | 3300018088 | Tropical Peatland | FYMQVVTSDSEMGEKFRQTLQQETLVPSSDAEQQFQSATDAIMLRYLADSRHRKPN |
| Ga0187770_109830041 | 3300018090 | Tropical Peatland | MGEKFRQTVRQEAKERNPDLDQQFQSATDAIMLRYIADSRFRKPN |
| Ga0210407_101568393 | 3300020579 | Soil | LRQDAPAKVPEMEQQFQNASDAIMLRYLADSKFRKPN |
| Ga0210395_101464771 | 3300020582 | Soil | MQVVTSDSEMGEKFRQTLRQEAPLQIPEKERQFQSATDAIMLRYLADSKFRKPN |
| Ga0210383_114520022 | 3300021407 | Soil | TSDSEMGEKFRQTLRQEAPLQIPEKERQFQSATDAIMLRYLADSKFRKPN |
| Ga0210391_100195641 | 3300021433 | Soil | SEMGEKFRQTLRQEVPVRTPELEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0212123_101570613 | 3300022557 | Iron-Sulfur Acid Spring | RQDAPVPAPGMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0228598_10021421 | 3300024227 | Rhizosphere | VTSDSEMGEKFRQTLRQEVPVRAPELEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0208191_10537991 | 3300025496 | Peatland | SEMGEKFRETLRHDAPAPPEMEQQFQNATDAIMLRYLADSKFRKPN |
| Ga0208355_10487242 | 3300025581 | Arctic Peat Soil | VVTNDSEMGEKFRQTLRQDAPLRAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0207700_100284575 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LRQDAPAAAVPEMERQFQSATDAIMLRYLADSKFRKPD |
| Ga0209881_11857971 | 3300026273 | Soil | TSDSEMGEKFRQTLRQDARVRAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0257160_10519981 | 3300026489 | Soil | QVVTSDSEMGEKFRQSLRQDAPAAAVPEMERQFQSATDAIMLRYLADSKFRKPD |
| Ga0257165_11126002 | 3300026507 | Soil | KFRQTLRQDAPLRAPEIEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0179587_104833171 | 3300026557 | Vadose Zone Soil | RQTLRQDAPVRAPELEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0209116_10785822 | 3300027590 | Forest Soil | RQEAAPHPTEVEQQFQSATDAIMLRYIADSKFRKPN |
| Ga0208827_11122692 | 3300027641 | Peatlands Soil | DSEMGEKFRQTLRQDAPPQAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0209274_101517251 | 3300027853 | Soil | FRQTLRQEAPLQIPEKDRQFQSATDAIMLRYLADSKFRKPN |
| Ga0209274_107448801 | 3300027853 | Soil | EKFRQTLRQEAPIQVPEVEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0209517_105060091 | 3300027854 | Peatlands Soil | FRQTLRQDTPQQAPEMEQQFQNATDAIMLRYIADSKFRRPN |
| Ga0209517_105590811 | 3300027854 | Peatlands Soil | KFRETLRQDAPVQAPELEQQFQNATDAIMLRYLAESKFRKPN |
| Ga0209517_106986692 | 3300027854 | Peatlands Soil | DSEIGEKFRQTLRQDTPPQAPEMEQQFQNATDAIMLRYIADSKFRRPN |
| Ga0209693_102806711 | 3300027855 | Soil | DSEMGEKFRQTLRQEAPLQVPEKEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0209693_103049602 | 3300027855 | Soil | LRQNAQPQVPEVEQQFQSATDSIMLRYLADSKFRKPN |
| Ga0209283_105033342 | 3300027875 | Vadose Zone Soil | IQVMTSGSEMGEKLRQTLRQDNSPRAPETEQQQHMQNASDSIMLRYLADSKFRKPN |
| Ga0209169_101891731 | 3300027879 | Soil | SDSEMGEKFRQTLRQDVPVRTPEAEQCFQSATDSIMLRYLADSKFRKPN |
| Ga0209590_108121941 | 3300027882 | Vadose Zone Soil | QTLRQDAPVRAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0209624_104780551 | 3300027895 | Forest Soil | MGEKFRQNLRVETPVPTPEMDQQFQSATDAIMLRYLADSRGRKPN |
| Ga0209415_106286161 | 3300027905 | Peatlands Soil | WFYMQVVTSDSEMGEKFRQTLRQDATVQAPEIEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0137415_109552622 | 3300028536 | Vadose Zone Soil | SGSEMGEKLRQTLRQDPSPRVPETEKQQHMQNASDAIMLRYLADSKFRKPN |
| Ga0302171_100527962 | 3300028651 | Fen | FYMQVVTSDSEMGEKFRQTVRQDKMPHPTEAEQQFQSATDAIMLRYLADSRYRKPN |
| Ga0302278_101936003 | 3300028866 | Bog | KFRQTLRQDVPAQAAEREQQFQSATDSIMLRYLADSKFRKPN |
| Ga0247271_1289802 | 3300029903 | Soil | MQVVTSDSEMGEKFRQTLRQEAPLQVPEAEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0311369_101297814 | 3300029910 | Palsa | YMQVVTSDSEMGEKFRQTLRQDAPLRAPEMEQQLQSATDAIMLRYLADSKFRKPN |
| Ga0311346_106719502 | 3300029952 | Bog | QVVTSDSEMGEKFRQTLRQDVPARASEREQQFQSATDSIMLRYLADSKFRKPN |
| Ga0302270_105369151 | 3300030011 | Bog | MGEKFRQTLRQDVPARASEREQQFQSATDSIMLRYLADSKFRKPN |
| Ga0311353_105968832 | 3300030399 | Palsa | VVTSDSEMGEKFRQTLRQDAPPQVPEMEHFQSAADAIMLRYLADNKFRKPN |
| Ga0311355_105058211 | 3300030580 | Palsa | RQTLRQEAAPHPTEVEQQFQSATDAIMLRYIADSKFRKPN |
| Ga0316363_101201542 | 3300030659 | Peatlands Soil | DSEMGEKFRQTLRQEAPPQVPEMEQQFQSATDAIMLRYLADSKYRKPN |
| Ga0316363_104079722 | 3300030659 | Peatlands Soil | RQTLRQDAPARAPEMEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0310038_101548291 | 3300030707 | Peatlands Soil | QTLRQDTPQQAPEMEQQFQNATDAIMLRYIADSKFRRPN |
| Ga0170824_1073454672 | 3300031231 | Forest Soil | VVTSDSEMGEKFRQTLRTDAPARSPELEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0265316_108076652 | 3300031344 | Rhizosphere | YMQVVTSDSEMGEKFRETLRQDTPERPPELEQQFQNATDAIMLRYLAESKYRKPN |
| Ga0310686_1144796383 | 3300031708 | Soil | MGEKFRQTLRQDVPARAPELEQQFQSATDAIMLRYLADSKFRKPN |
| Ga0307475_108639161 | 3300031754 | Hardwood Forest Soil | DSEMGEKFRQTLRQDAPVKAPEMEQQFQSASDAIMLRYLADSKFRKPN |
| Ga0307479_102422031 | 3300031962 | Hardwood Forest Soil | VTSDSEMAEKFRQTLRQDAPAQAHEMKQQLQSATDSIMLRYLADSKFRKPN |
| Ga0307479_110637822 | 3300031962 | Hardwood Forest Soil | RQDAPAQAHEMKQQLQSATDSIMLRYLADSKFRKPN |
| Ga0335078_118836971 | 3300032805 | Soil | SDSEMGEKFRQTVRQDAPLRAPEAEKQFQNATDAIMLRYIADSRFRKPN |
| Ga0335072_116908112 | 3300032898 | Soil | LWFYMQVVTSDSEMGEKFRQSLRLEAPPVPRTPEMDQQFQSATDSIMLRYLADSRGRKPN |
| Ga0335076_101869983 | 3300032955 | Soil | EMGEKFRQTLRVEAPVPTPEMDQQFQNATDAIMLRYLADSRGRKPN |
| Ga0335077_111071011 | 3300033158 | Soil | DSEMGEKFRQTVRQEARARTPELEQQLQSASDAIMLRYLADSRFRKPN |
| Ga0371489_0004514_2_109 | 3300033755 | Peat Soil | QEATARNPDLDQQFQSATDAIMLRYIADSRFRKPN |
| Ga0371489_0189723_905_1069 | 3300033755 | Peat Soil | MQVVTSDSEMGEKFRETLRQDAPVRPAEIEQQYQNATDAIMLRYLADSKFRKPN |
| Ga0334854_113328_467_631 | 3300033829 | Soil | VQVVTSDSEMGEKFRQTLRHEAPVQVPEMEQKFQSATDAIMLRYLADSKHRKPN |
| Ga0334811_128099_455_619 | 3300033891 | Soil | MQVVTSDSEMGEKFRETLRQDAPVRPAEIEQQFQNATDAIMLRYLADSKFRKPN |
| Ga0371487_0084329_1_129 | 3300033982 | Peat Soil | MSDSETGEKFRQTLRQEANVQAAEFDQQFQNATDAIMLRYLA |
| ⦗Top⦘ |