


| Basic Information | |
|---|---|
| Family ID | F073872 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 37 residues |
| Representative Sequence | TTIATAIADRLVENSEIFLLGGDSLRKSKNPNPPAE |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.67 % |
| % of genes near scaffold ends (potentially truncated) | 96.67 % |
| % of genes from short scaffolds (< 2000 bps) | 96.67 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (6.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.75% β-sheet: 0.00% Coil/Unstructured: 81.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03976 | PPK2 | 0.83 |
| PF13088 | BNR_2 | 0.83 |
| PF00507 | Oxidored_q4 | 0.83 |
| PF01258 | zf-dskA_traR | 0.83 |
| PF04116 | FA_hydroxylase | 0.83 |
| PF13614 | AAA_31 | 0.83 |
| PF14690 | zf-ISL3 | 0.83 |
| PF00665 | rve | 0.83 |
| PF13189 | Cytidylate_kin2 | 0.83 |
| PF13006 | Nterm_IS4 | 0.83 |
| PF05128 | DUF697 | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.83 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.83 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.83 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.83 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.83 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.83 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.83 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.50 % |
| Unclassified | root | N/A | 2.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000717|JGI12543J11896_103363 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005542|Ga0070732_10517872 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005556|Ga0066707_10647389 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005577|Ga0068857_102148759 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005591|Ga0070761_10659276 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005764|Ga0066903_106123538 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005830|Ga0074473_10632170 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006028|Ga0070717_10566886 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006050|Ga0075028_100635667 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006052|Ga0075029_100715327 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006086|Ga0075019_10628866 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006162|Ga0075030_100779764 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300006162|Ga0075030_100981068 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006162|Ga0075030_101415333 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006174|Ga0075014_100760780 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006176|Ga0070765_100406544 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300006237|Ga0097621_100942376 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300006640|Ga0075527_10125998 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300007004|Ga0079218_12944578 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009089|Ga0099828_12013320 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009111|Ga0115026_10784183 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009137|Ga0066709_101276789 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300009157|Ga0105092_10621674 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009545|Ga0105237_11237604 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300009615|Ga0116103_1179141 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009616|Ga0116111_1049690 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300009616|Ga0116111_1143703 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009633|Ga0116129_1000300 | All Organisms → cellular organisms → Bacteria | 34152 | Open in IMG/M |
| 3300009640|Ga0116126_1089032 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300009787|Ga0116226_10312105 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300010301|Ga0134070_10192309 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010319|Ga0136653_10453207 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010355|Ga0116242_11054423 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300010358|Ga0126370_11574231 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010361|Ga0126378_11759949 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300010376|Ga0126381_103247313 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010400|Ga0134122_12489724 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010880|Ga0126350_12147584 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012202|Ga0137363_10784581 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012209|Ga0137379_11083436 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012350|Ga0137372_11179588 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012357|Ga0137384_10873359 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300013092|Ga0163199_1176891 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300013308|Ga0157375_13031455 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300013503|Ga0120127_10085297 | Not Available | 687 | Open in IMG/M |
| 3300014151|Ga0181539_1216597 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014156|Ga0181518_10111388 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300014158|Ga0181521_10117826 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300014159|Ga0181530_10673043 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300014162|Ga0181538_10717300 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300014657|Ga0181522_10442517 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300014862|Ga0180096_1038982 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300016341|Ga0182035_12052068 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300016357|Ga0182032_11364781 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300016422|Ga0182039_11652997 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300017930|Ga0187825_10303736 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300017970|Ga0187783_10682342 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300017972|Ga0187781_10589407 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300017975|Ga0187782_10858988 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300018014|Ga0187860_1135908 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300018017|Ga0187872_10164750 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300018034|Ga0187863_10821968 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018057|Ga0187858_10468550 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300018086|Ga0187769_10791488 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300019284|Ga0187797_1798339 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021439|Ga0213879_10169783 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300021476|Ga0187846_10126714 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300021476|Ga0187846_10382392 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021858|Ga0213852_1113831 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025157|Ga0209399_10145230 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300025463|Ga0208193_1000247 | All Organisms → cellular organisms → Bacteria | 34119 | Open in IMG/M |
| 3300025507|Ga0208188_1110771 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025931|Ga0207644_11766234 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025960|Ga0207651_10812002 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300026089|Ga0207648_12064675 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026216|Ga0209903_1027154 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300027625|Ga0208044_1128574 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300027648|Ga0209420_1174652 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027740|Ga0214474_1298796 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027812|Ga0209656_10461010 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027825|Ga0209039_10247280 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027867|Ga0209167_10603327 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027869|Ga0209579_10442373 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027874|Ga0209465_10448549 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027898|Ga0209067_10529035 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300028380|Ga0268265_11697679 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300028572|Ga0302152_10228721 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300028783|Ga0302279_10443473 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300028806|Ga0302221_10337636 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028866|Ga0302278_10419360 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300029944|Ga0311352_10715615 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300029957|Ga0265324_10179523 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300029999|Ga0311339_10449496 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300030580|Ga0311355_11712227 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031234|Ga0302325_10080067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6253 | Open in IMG/M |
| 3300031236|Ga0302324_101365616 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031236|Ga0302324_103532027 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031250|Ga0265331_10521987 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031545|Ga0318541_10486500 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031546|Ga0318538_10503243 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031708|Ga0310686_110461736 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031708|Ga0310686_118074734 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031833|Ga0310917_10621226 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031890|Ga0306925_11704015 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031912|Ga0306921_11588366 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031941|Ga0310912_10083151 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
| 3300031946|Ga0310910_11114094 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031965|Ga0326597_10797149 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300032035|Ga0310911_10380768 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300032065|Ga0318513_10654266 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032074|Ga0308173_11419071 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300032076|Ga0306924_10848761 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300032261|Ga0306920_102661677 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300032805|Ga0335078_11540288 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032897|Ga0335071_11565984 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032954|Ga0335083_10756162 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300033158|Ga0335077_11843527 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300033419|Ga0316601_101213858 | Not Available | 756 | Open in IMG/M |
| 3300033488|Ga0316621_11240962 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300033803|Ga0314862_0125310 | Not Available | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.67% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.83% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.83% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000717 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014862 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12543J11896_1033631 | 3300000717 | Tropical Forest Soil | IATAIADRLVENSEIFLLGGDSLRKSKNPNPPAE* |
| Ga0070732_105178722 | 3300005542 | Surface Soil | TTIAAAIADRLVENSEIFLLGGESLRKAQKSPPPAAA* |
| Ga0066707_106473891 | 3300005556 | Soil | ATAIADRLVENSEVFLLGGESLRKPKNPNPPAEKS* |
| Ga0068857_1021487591 | 3300005577 | Corn Rhizosphere | ATAIVDRLVENSEILLLGGDSLRKAKNTSTSPTE* |
| Ga0070761_106592761 | 3300005591 | Soil | IATAIADRLVENSEIFLLGGDSLRKPNKTPNPPAEES* |
| Ga0066903_1061235381 | 3300005764 | Tropical Forest Soil | NTTIATAIADRLVENSEIFLLGGDSLRKGNKNPNPPAAD* |
| Ga0074473_106321701 | 3300005830 | Sediment (Intertidal) | ATAIADRLVENSEILLLGGPSLRKPKNSTSPAEG* |
| Ga0070717_105668861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ILFNTAIADRLVENFEVFLLGGESLRKPKNPNPPAEKSKHGV* |
| Ga0075028_1006356673 | 3300006050 | Watersheds | YNTTIATAIADRLVENSEIFLLGGRSLRNPISQEPDSPAV* |
| Ga0075029_1007153271 | 3300006052 | Watersheds | TTIATAIADRLVENSEIFMFGGDSLRKPKNPNPPAE* |
| Ga0075019_106288662 | 3300006086 | Watersheds | TTIATAIVDRLVENSEIFLLGGDSLRKVKNATTSPAE* |
| Ga0075030_1007797641 | 3300006162 | Watersheds | NTTIAAAIADRLVENSEIFLLGGESLRKAQKSPPPAAA* |
| Ga0075030_1009810682 | 3300006162 | Watersheds | ATAIVDRLVENSEIFLLGGDSLRKVKNATTSPAE* |
| Ga0075030_1014153332 | 3300006162 | Watersheds | IATAIADRLVENSEIFLLAGDSVRKANKNPNPPAE* |
| Ga0075014_1007607801 | 3300006174 | Watersheds | IATAIADRLVENSEIFLLGGDSLRKASKNPTSPEE* |
| Ga0070765_1004065443 | 3300006176 | Soil | NTTIATAIADRLVENSEIFLLAGESLRKGNKSQPPTE* |
| Ga0097621_1009423761 | 3300006237 | Miscanthus Rhizosphere | LFNTTIATAIADRLVENSEIFMFGGDSLRKPKNPNSPAE* |
| Ga0075527_101259981 | 3300006640 | Arctic Peat Soil | TIATAIADRLVENSEIFLLGGDSVRKANKNPNPPAE* |
| Ga0079218_129445783 | 3300007004 | Agricultural Soil | ATAIADRLVENSEIFLLGGDSLRKANKNPNPPAE* |
| Ga0099828_120133202 | 3300009089 | Vadose Zone Soil | YNTTIATAIADRLVENSEIFLLGGESLRKSNKSQPPNES* |
| Ga0115026_107841832 | 3300009111 | Wetland | FNTTIATAIADRLVENSEVFLLGGPSLRKPKNPDSPADKQ* |
| Ga0066709_1012767891 | 3300009137 | Grasslands Soil | TGATSSNTTIATAIADRLVENSEIFRLGGDSLRKPNKNPNPPAEES* |
| Ga0105092_106216741 | 3300009157 | Freshwater Sediment | TTIATAIADRLVENSEIFWLGGDSLRKSKNPNPPAE* |
| Ga0105237_112376041 | 3300009545 | Corn Rhizosphere | IATAIADRLVENSEIFLLGGDSLRKAGKNSTSPEE* |
| Ga0116103_11791411 | 3300009615 | Peatland | TIATAIADRLVENSEIFLLGGESLRKAQKTQSPAPA* |
| Ga0116111_10496901 | 3300009616 | Peatland | TIATAIADRLVENSEIFLLGGDSLRKSKNPNPPAE* |
| Ga0116111_11437032 | 3300009616 | Peatland | IATAIADRLVENSEIFLLGGDSLRKANKNPDPPAEP* |
| Ga0116129_100030010 | 3300009633 | Peatland | MALWRVFAATIADRLVENSEIFLLGGDSLRKPKNPNPPTEKS* |
| Ga0116126_10890323 | 3300009640 | Peatland | TTIAAAIADRLVENSEIFLLGGESLRKAQKSPPPPTS* |
| Ga0116226_103121052 | 3300009787 | Host-Associated | MATAFADRLVENSEIFLLGGDSLRKPNKSSSSPEE* |
| Ga0134070_101923091 | 3300010301 | Grasslands Soil | IATAIADRLVENSEIFLLGGESLRKAQKNQSPPPA* |
| Ga0136653_104532071 | 3300010319 | Anoxic Lake Water | ILHNTTIAAAIVDRLVENSEIFLLGGESLRKAQKNPPPPSS* |
| Ga0116242_110544232 | 3300010355 | Anaerobic Digestor Sludge | ILFNTTIATAIADRLVENSQIFLLGGPSIRRPKKEPAED* |
| Ga0126370_115742312 | 3300010358 | Tropical Forest Soil | IATAIADRLVENSEIFLLGGDSLRKGNRNPNPPAAE* |
| Ga0126378_117599492 | 3300010361 | Tropical Forest Soil | ATAIADRLVENSEIFLLAGDSLRKANKHPDQPAE* |
| Ga0126381_1032473131 | 3300010376 | Tropical Forest Soil | ATAIADRLIENSEIFLLGGDSLRKANPKPPNPPAE* |
| Ga0134122_124897241 | 3300010400 | Terrestrial Soil | NTTIATAIADRLVENSEIFLLGGESLRKGNNKSNPPAAAE* |
| Ga0126350_121475841 | 3300010880 | Boreal Forest Soil | IATAIADRLVENSEIFLLGGDSLRKPKNPNPPAEKS* |
| Ga0137363_107845811 | 3300012202 | Vadose Zone Soil | IATAIADRLVENSEIFLLGGDSLRKANKNPDPPA* |
| Ga0137379_110834362 | 3300012209 | Vadose Zone Soil | DAWRYRDTIATAIADRLVENSEVFLLGGDSLRKGNKGQPA* |
| Ga0137372_111795882 | 3300012350 | Vadose Zone Soil | ATAIADRLVENSEIFLLGGDSLRKPNKNPNPPTEES* |
| Ga0137384_108733591 | 3300012357 | Vadose Zone Soil | ATAIADRLVENSEIFLLGGDSLRKTNKNPNPPAEES* |
| Ga0163199_11768911 | 3300013092 | Freshwater | ILFNTTIATAIADRLVENSEIYLLGGPSVRKPKRNQLADEE* |
| Ga0157375_130314552 | 3300013308 | Miscanthus Rhizosphere | FNTTIATAIADRLVENSEIFLLGGPSRRKPEHNRESSS* |
| Ga0120127_100852973 | 3300013503 | Permafrost | LHNTSIATAIVDRLVESSEVFLLAGDSLRKGNKGQPT* |
| Ga0181539_12165971 | 3300014151 | Bog | ATAIADRLVENSEVFLLGGESFRKVGKNPSPPAES* |
| Ga0181518_101113881 | 3300014156 | Bog | TIATAIVDRLVENSEIFLLGGESLRKAKTPSTPPAE* |
| Ga0181521_101178263 | 3300014158 | Bog | GNILHNTTIAAAIVDRLVENSEIFLLGGESLRKAQKNPPPPPA* |
| Ga0181530_106730432 | 3300014159 | Bog | TTIATAIADRLVENSEILLLGGDSLRKPKSPNPPKSSSRLR* |
| Ga0181538_107173001 | 3300014162 | Bog | TTIATAIADRLVENSEIFLLGGDSLRKGNRTTPPAAE* |
| Ga0181522_104425172 | 3300014657 | Bog | TTIATAIADRLVENSEIFLLGGESLRKAQKSSPPAAA* |
| Ga0180096_10389822 | 3300014862 | Soil | FNTTIATAIADRLVENSEIFMFGGDSLRKPKNPNPPAE* |
| Ga0182035_120520681 | 3300016341 | Soil | TIATAIADRLVENSEIFLLGGDSLRKASKNPTSPDE |
| Ga0182032_113647811 | 3300016357 | Soil | IATAIADRLVENSEIFLLGGDSLRKANKHSDPPAE |
| Ga0182039_116529971 | 3300016422 | Soil | NTTIATAIADRLVENSEIFLLGGESLRKSNKSQPPNES |
| Ga0187825_103037361 | 3300017930 | Freshwater Sediment | LLRLGQYPLQHDAIATAIADRLVENSEIFLLGGESLRKNN |
| Ga0187783_106823421 | 3300017970 | Tropical Peatland | TIAAAIADRLVENSEIFLLGGESLRKAQKSPPPAAA |
| Ga0187781_105894071 | 3300017972 | Tropical Peatland | NTTIAAAIADRLVENSDILLLGGDSLRRPKNPNPPAEKQ |
| Ga0187782_108589882 | 3300017975 | Tropical Peatland | WGNILYNTIATAIADRLVENSEIFLLGRESLRKGNKSQPPTES |
| Ga0187860_11359083 | 3300018014 | Peatland | ELIARGIADRLVENSEIFLLGGESLRKAQKNQSPAPS |
| Ga0187872_101647501 | 3300018017 | Peatland | TTIAAAIADRLVENSEIFLLGGESLRKAQKSPPPPTS |
| Ga0187863_108219682 | 3300018034 | Peatland | IATAIADRLVENSEIFLLGGDSLRKSNRTPHPPVTE |
| Ga0187858_104685501 | 3300018057 | Peatland | TIAAAIADRLVENSEIFLLGGESLRKAQKSPPPPTS |
| Ga0187769_107914881 | 3300018086 | Tropical Peatland | TIATAIADRLVENSEIFLLGGESLRKNNKSQPPAE |
| Ga0187797_17983391 | 3300019284 | Peatland | TTIAAAIADRLVENSEIFLLGGESLRKAQKSPPPAAA |
| Ga0213879_101697831 | 3300021439 | Bulk Soil | TIATAIADRLVENSEIFLLGGESVRKSKTSASPAN |
| Ga0187846_101267142 | 3300021476 | Biofilm | AAAIADRLVENSEILLLGGDSLRKPSKNPDPPAEQS |
| Ga0187846_103823921 | 3300021476 | Biofilm | LFNTTIATAIADRLVENSEIFLLGGPSLRKPKNPDSPADKE |
| Ga0213852_11138312 | 3300021858 | Watersheds | LFNTTIADRLVENSEIFLLGGDSLRKSKNPNPPAE |
| Ga0209399_101452304 | 3300025157 | Thermal Springs | NTTIATAIADRLVENSEIFLLGGDSLRKTNKNPNPPAD |
| Ga0208193_100024710 | 3300025463 | Peatland | MALWRVFAATIADRLVENSEIFLLGGDSLRKPKNPNPPTEKS |
| Ga0208188_11107711 | 3300025507 | Peatland | NTTIAAAIVDRLVENSEIFLLGGESLRKAQKNPPPPSS |
| Ga0207644_117662342 | 3300025931 | Switchgrass Rhizosphere | TIATAIADRLVENSEIFLLGGESLRKGNNKSNPPAAAE |
| Ga0207651_108120022 | 3300025960 | Switchgrass Rhizosphere | TIATAIADRLVENSEIFLLGGDSLRKSRNPNPPAE |
| Ga0207648_120646751 | 3300026089 | Miscanthus Rhizosphere | FNTTIATAIADRLVENFEIFLLGGDRLRKAGKNSNPPEE |
| Ga0209903_10271541 | 3300026216 | Soil | TIATAIADRLVENSEIFLLGGDSLRKASKNPASPEE |
| Ga0208044_11285742 | 3300027625 | Peatlands Soil | TFSSIRTIATAIADRLVENSEIFMFGGDSLRKPKNPNSPAE |
| Ga0209420_11746522 | 3300027648 | Forest Soil | ATAIADRIVENSEVLLLGGDSLRKSNRTPHPPASE |
| Ga0214474_12987962 | 3300027740 | Soil | FNTTIATAIADRLVENSEIFLLGGPSIRKPKKEPADE |
| Ga0209656_104610101 | 3300027812 | Bog Forest Soil | TTIATAIADRLVENSEIFLLGGDSLRKSKNPNPPAE |
| Ga0209039_102472802 | 3300027825 | Bog Forest Soil | TTIATAIADRLVENSEIFLLGGESLRKSNKSQPPTES |
| Ga0209167_106033271 | 3300027867 | Surface Soil | AIADRLVENSEIFLLGGDSVRKLKHSSPPAEPASK |
| Ga0209579_104423731 | 3300027869 | Surface Soil | NTTIAAAIVDRLVENSEIFLLGGESLRKAQKNPPPPSA |
| Ga0209465_104485491 | 3300027874 | Tropical Forest Soil | NTTIATAIADRLVENSEIFLLGGESLRKNNKSQPPTD |
| Ga0209067_105290352 | 3300027898 | Watersheds | TIATAIVDRLVENSEIFLLGGDSLRKVKNATTSPAE |
| Ga0268265_116976793 | 3300028380 | Switchgrass Rhizosphere | NTTIATAIADRLVENSEIFLLGGPSRRKPEHNRESSS |
| Ga0302152_102287211 | 3300028572 | Bog | TIATAIADRLVENSEIFLLGGDSLRKASKSGSPEE |
| Ga0302279_104434731 | 3300028783 | Bog | TTIATAIADRLVESSEIFLLGGDSLRKSNRTPHPPVTE |
| Ga0302221_103376361 | 3300028806 | Palsa | TTIATAIADRLVENSEIFLLGGDSLRKPNKTPNPPAEES |
| Ga0302278_104193602 | 3300028866 | Bog | TIATAIADRLVENSEIFLLGGDSLRKASKSSSPEE |
| Ga0311352_107156153 | 3300029944 | Palsa | TIATAIVDRLIENSEIFLLGGDSLRKTKSPPTSPAE |
| Ga0265324_101795231 | 3300029957 | Rhizosphere | LFNTTIATAIADRLVENSEIFMFGGDSLRKPKNPNPPAE |
| Ga0311339_104494961 | 3300029999 | Palsa | TTIATAIADRLVENSEIFLLGGDSLRKASKNPTSPEE |
| Ga0311355_117122272 | 3300030580 | Palsa | NTTIAAAIADRLVENSEIFLLGGDSVRKLKHSPPQAE |
| Ga0302325_100800671 | 3300031234 | Palsa | TTIATAIADRLVENSEIFLLGGDSLRKPSKNTTSPEE |
| Ga0302324_1013656161 | 3300031236 | Palsa | ATAIADRLVENSEIFLLGGDSLRKGNGKPNPPAAQ |
| Ga0302324_1035320272 | 3300031236 | Palsa | TIATAIADRLVENSEIFLFGGDSLRKPKNPNPPAE |
| Ga0265331_105219871 | 3300031250 | Rhizosphere | IAAAIADRLVENSEIFLLGGESLRKAQKSPPPPAS |
| Ga0318541_104865003 | 3300031545 | Soil | NTTIATAIADRLVENSEIFLLGGDSLRKAKKSSPAS |
| Ga0318538_105032432 | 3300031546 | Soil | TTIATAIADRLVENSEVFLLGGESLRKPKNPNPPAEKS |
| Ga0310686_1104617361 | 3300031708 | Soil | IATAIADRLVENSEIFLLGGDSLRKANKNSSSPEE |
| Ga0310686_1180747341 | 3300031708 | Soil | TTIATAIADRLVENSEIFLLGGDSVRKLKHSPPPAE |
| Ga0310917_106212263 | 3300031833 | Soil | IATAIADRLVENSEIFLLGGDSLRKANKNSPSPEE |
| Ga0306925_117040152 | 3300031890 | Soil | TTIATAIVDRLVENSEILLLGGDSLRKAKNGSTSPAE |
| Ga0306921_115883661 | 3300031912 | Soil | IATAIADRLVENSEIFLLGGDSLRKANKNPDPPAE |
| Ga0310912_100831511 | 3300031941 | Soil | NTTIATAIADRLVENSEIFLLGGESLRKGNKSQPPTES |
| Ga0310910_111140942 | 3300031946 | Soil | ILHNTTIATAIADRLVENSEIILLGGESLRKANKGQPPTE |
| Ga0326597_107971492 | 3300031965 | Soil | LHPARITIATAIADRLVENSEIFLLGGDSLRKANKNSPPPEE |
| Ga0310911_103807681 | 3300032035 | Soil | NTTIATAIADRLVENSEIFMFGGDSLRKPKNPNQPAE |
| Ga0318513_106542662 | 3300032065 | Soil | TIATAIADRLVENSEVFLLGGESFRKAGKNPSPPPAE |
| Ga0308173_114190712 | 3300032074 | Soil | FNTTIATAIADRLVENSEIFMFGGDSLRKPKNPTPPAE |
| Ga0306924_108487612 | 3300032076 | Soil | TTIATAIADRLVENSEIFLLGGESLRKGNKSQPPTES |
| Ga0306920_1026616772 | 3300032261 | Soil | TTIATAIADRLVENSEIFLLGGESLRKSNKSQPPNEP |
| Ga0335078_115402882 | 3300032805 | Soil | FNTTIATAIADRLVENSEIFLLGGDSLRKPKNPNPPAQ |
| Ga0335071_115659842 | 3300032897 | Soil | TIAAAIADRLVENSEIFLLGGPSLRKPKNPDSPVAKE |
| Ga0335083_107561622 | 3300032954 | Soil | IATAIADRLVENSEIFLLGGESLRKANKHSDPPAE |
| Ga0335077_118435272 | 3300033158 | Soil | NTTIATAIVDRLVENSEILLLGGDSLRKAKNPSISPAE |
| Ga0316601_1012138581 | 3300033419 | Soil | IATAIADRLVENSQVFLLGGPSIRKPRKEQSAAEEE |
| Ga0316621_112409621 | 3300033488 | Soil | FNTTIATAIADRLVENSEVFLLGGPSLRKPKNPDSPADKQ |
| Ga0314862_0125310_494_610 | 3300033803 | Peatland | TIATAIADRMIENSHVFLLGGPSIRIPKNKSQSPDPAE |
| ⦗Top⦘ |