


| Basic Information | |
|---|---|
| Family ID | F073707 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LKRTLLWLIVAAVLVIGFLLYRSRSGSNLNVTPDAEREIEKAKRR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.55 % |
| % of genes near scaffold ends (potentially truncated) | 19.17 % |
| % of genes from short scaffolds (< 2000 bps) | 66.67 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 6.67 |
| PF00873 | ACR_tran | 6.67 |
| PF14079 | DUF4260 | 4.17 |
| PF01176 | eIF-1a | 2.50 |
| PF02837 | Glyco_hydro_2_N | 1.67 |
| PF02472 | ExbD | 1.67 |
| PF05199 | GMC_oxred_C | 1.67 |
| PF04972 | BON | 1.67 |
| PF11154 | DUF2934 | 1.67 |
| PF12543 | DUF3738 | 1.67 |
| PF01594 | AI-2E_transport | 1.67 |
| PF01011 | PQQ | 1.67 |
| PF09206 | ArabFuran-catal | 1.67 |
| PF02585 | PIG-L | 0.83 |
| PF04365 | BrnT_toxin | 0.83 |
| PF01804 | Penicil_amidase | 0.83 |
| PF13439 | Glyco_transf_4 | 0.83 |
| PF02922 | CBM_48 | 0.83 |
| PF01636 | APH | 0.83 |
| PF01593 | Amino_oxidase | 0.83 |
| PF12796 | Ank_2 | 0.83 |
| PF02566 | OsmC | 0.83 |
| PF01435 | Peptidase_M48 | 0.83 |
| PF01740 | STAS | 0.83 |
| PF06271 | RDD | 0.83 |
| PF00939 | Na_sulph_symp | 0.83 |
| PF12700 | HlyD_2 | 0.83 |
| PF01381 | HTH_3 | 0.83 |
| PF12419 | DUF3670 | 0.83 |
| PF13673 | Acetyltransf_10 | 0.83 |
| PF01613 | Flavin_Reduct | 0.83 |
| PF07638 | Sigma70_ECF | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| PF07730 | HisKA_3 | 0.83 |
| PF05973 | Gp49 | 0.83 |
| PF04397 | LytTR | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 2.50 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.67 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 1.67 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.67 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 1.67 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.83 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.83 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.83 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.83 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.83 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.83 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.83 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.83 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.83 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.83 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.83 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.67 % |
| Unclassified | root | N/A | 48.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101613538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4430 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105887167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1283 | Open in IMG/M |
| 3300000789|JGI1027J11758_12628304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300004080|Ga0062385_10124673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Chroococcaceae → Gloeocapsa | 1291 | Open in IMG/M |
| 3300005330|Ga0070690_100723363 | Not Available | 766 | Open in IMG/M |
| 3300005334|Ga0068869_100092391 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300005365|Ga0070688_100154238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1572 | Open in IMG/M |
| 3300005436|Ga0070713_100015997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5629 | Open in IMG/M |
| 3300005436|Ga0070713_100458645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300005447|Ga0066689_10582831 | Not Available | 706 | Open in IMG/M |
| 3300005458|Ga0070681_10792967 | Not Available | 864 | Open in IMG/M |
| 3300005529|Ga0070741_11404119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea | 580 | Open in IMG/M |
| 3300005535|Ga0070684_100670313 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005535|Ga0070684_101044795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005538|Ga0070731_10483374 | Not Available | 824 | Open in IMG/M |
| 3300005549|Ga0070704_101275686 | Not Available | 671 | Open in IMG/M |
| 3300005577|Ga0068857_100807918 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300005614|Ga0068856_100134642 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300005617|Ga0068859_102655762 | Not Available | 551 | Open in IMG/M |
| 3300005952|Ga0080026_10101343 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006050|Ga0075028_100860182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300006237|Ga0097621_100028520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4399 | Open in IMG/M |
| 3300006893|Ga0073928_10060275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3357 | Open in IMG/M |
| 3300006893|Ga0073928_10996893 | Not Available | 571 | Open in IMG/M |
| 3300009098|Ga0105245_11440345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300009098|Ga0105245_12120330 | Not Available | 616 | Open in IMG/M |
| 3300009148|Ga0105243_10181243 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300009174|Ga0105241_10395122 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae | 1211 | Open in IMG/M |
| 3300009523|Ga0116221_1360134 | Not Available | 631 | Open in IMG/M |
| 3300009551|Ga0105238_12532063 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009628|Ga0116125_1001323 | All Organisms → cellular organisms → Bacteria | 10841 | Open in IMG/M |
| 3300009640|Ga0116126_1254902 | Not Available | 549 | Open in IMG/M |
| 3300010373|Ga0134128_11677996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300010379|Ga0136449_100139685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4794 | Open in IMG/M |
| 3300010379|Ga0136449_103154997 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010379|Ga0136449_103193998 | Not Available | 633 | Open in IMG/M |
| 3300010401|Ga0134121_10344564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1331 | Open in IMG/M |
| 3300010403|Ga0134123_11039748 | Not Available | 838 | Open in IMG/M |
| 3300011119|Ga0105246_10764799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 853 | Open in IMG/M |
| 3300012199|Ga0137383_11026021 | Not Available | 600 | Open in IMG/M |
| 3300012205|Ga0137362_10167039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1887 | Open in IMG/M |
| 3300012207|Ga0137381_11360873 | Not Available | 602 | Open in IMG/M |
| 3300012210|Ga0137378_11767534 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012362|Ga0137361_10193969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1835 | Open in IMG/M |
| 3300012363|Ga0137390_10698543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300012582|Ga0137358_10653260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 704 | Open in IMG/M |
| 3300012917|Ga0137395_10578045 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012960|Ga0164301_10774402 | Not Available | 731 | Open in IMG/M |
| 3300013104|Ga0157370_10049676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4014 | Open in IMG/M |
| 3300013306|Ga0163162_10823237 | Not Available | 1045 | Open in IMG/M |
| 3300013306|Ga0163162_12572241 | Not Available | 586 | Open in IMG/M |
| 3300013308|Ga0157375_10758994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300013308|Ga0157375_12914502 | Not Available | 572 | Open in IMG/M |
| 3300014156|Ga0181518_10422431 | Not Available | 641 | Open in IMG/M |
| 3300014162|Ga0181538_10494651 | Not Available | 644 | Open in IMG/M |
| 3300014162|Ga0181538_10668385 | Not Available | 539 | Open in IMG/M |
| 3300014165|Ga0181523_10067395 | Not Available | 2188 | Open in IMG/M |
| 3300014325|Ga0163163_10023956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5805 | Open in IMG/M |
| 3300015264|Ga0137403_10984595 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018034|Ga0187863_10045737 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halococcaceae → Halococcus → Halococcus hamelinensis → Halococcus hamelinensis 100A6 | 2519 | Open in IMG/M |
| 3300018034|Ga0187863_10177480 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300018043|Ga0187887_10026588 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
| 3300018089|Ga0187774_10364258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300020580|Ga0210403_10201567 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300020581|Ga0210399_11296277 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300020581|Ga0210399_11342560 | Not Available | 561 | Open in IMG/M |
| 3300021170|Ga0210400_10638231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 877 | Open in IMG/M |
| 3300021178|Ga0210408_10237573 | Not Available | 1451 | Open in IMG/M |
| 3300021407|Ga0210383_11788514 | Not Available | 501 | Open in IMG/M |
| 3300022557|Ga0212123_10215627 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300022726|Ga0242654_10078884 | Not Available | 995 | Open in IMG/M |
| 3300025912|Ga0207707_11326842 | Not Available | 577 | Open in IMG/M |
| 3300025928|Ga0207700_10713920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 895 | Open in IMG/M |
| 3300025930|Ga0207701_11460635 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025935|Ga0207709_10651612 | Not Available | 838 | Open in IMG/M |
| 3300025961|Ga0207712_10362973 | Not Available | 1207 | Open in IMG/M |
| 3300026078|Ga0207702_10080115 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300027660|Ga0209736_1043972 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300027842|Ga0209580_10417887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300027869|Ga0209579_10641917 | Not Available | 575 | Open in IMG/M |
| 3300027986|Ga0209168_10017624 | Not Available | 4084 | Open in IMG/M |
| 3300029636|Ga0222749_10669418 | Not Available | 568 | Open in IMG/M |
| 3300029882|Ga0311368_10164744 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300029910|Ga0311369_10110676 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 2740 | Open in IMG/M |
| 3300030617|Ga0311356_11004095 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031090|Ga0265760_10053331 | Not Available | 1220 | Open in IMG/M |
| 3300031234|Ga0302325_10326386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2463 | Open in IMG/M |
| 3300031234|Ga0302325_11093649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300031250|Ga0265331_10291562 | Not Available | 731 | Open in IMG/M |
| 3300031708|Ga0310686_108477113 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031716|Ga0310813_11565028 | Not Available | 615 | Open in IMG/M |
| 3300031718|Ga0307474_10165283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1675 | Open in IMG/M |
| 3300031823|Ga0307478_10052733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3021 | Open in IMG/M |
| 3300031938|Ga0308175_103086405 | Not Available | 518 | Open in IMG/M |
| 3300032160|Ga0311301_10632798 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300032160|Ga0311301_12200082 | Not Available | 633 | Open in IMG/M |
| 3300033480|Ga0316620_10060829 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300033486|Ga0316624_11655968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300033513|Ga0316628_101595218 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016135385 | 3300000364 | Soil | MGLRRFLLWLIIVAVLLIGLLLYRSRSGNNLSITPEAEQEIEKAKRR* |
| INPhiseqgaiiFebDRAFT_1058871672 | 3300000364 | Soil | LLWLIVTALLVTGFAIYRSRSTRLNVTPDAAREIEKAKRR* |
| JGI1027J11758_126283041 | 3300000789 | Soil | VRRALLWLIVTALLVTGFAIYRSRSTRLNVTPDAAREIEKAKRR |
| Ga0062385_101246731 | 3300004080 | Bog Forest Soil | MWVILMKRILPWLIGAAVLVIGFAFYRSRSRSHLNVDPHALEEIERAKRR* |
| Ga0062384_1007861661 | 3300004082 | Bog Forest Soil | MRRILLWSIVAAILLAAVVYFARSRNHLDVTPDAAREIEKAKQR* |
| Ga0070690_1007233632 | 3300005330 | Switchgrass Rhizosphere | LLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR* |
| Ga0068869_1000923913 | 3300005334 | Miscanthus Rhizosphere | VKQLSVKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR* |
| Ga0070688_1001542382 | 3300005365 | Switchgrass Rhizosphere | LLWLIVTALLVTGFLVYRSRSKTRLNVTPDAAREIEKAKRQ* |
| Ga0070709_100392203 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR* |
| Ga0070713_1000042885 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKTKRR* |
| Ga0070713_1000159973 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLLWLIVVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR* |
| Ga0070713_1004586452 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRILLWLVIAGILVIALVLYRSRSRSNLNVAPDAEREIEKAKRK* |
| Ga0070711_1000513391 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VRKLVVLLIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR* |
| Ga0066689_105828312 | 3300005447 | Soil | VKRILVWLIVTAALLIAFVLYRSRSGSNLNIEPHAREVIEKAKGR* |
| Ga0070681_107929672 | 3300005458 | Corn Rhizosphere | MNRILLWLIVALALLIGFVLYRSHSATKLNVTPEAEREIEKAKRR* |
| Ga0070741_114041191 | 3300005529 | Surface Soil | LSYFGGVKRTWVWLIVAAALVIGFVLYRSSSGRKQLNVTPDAEREIEKAKRR* |
| Ga0070734_100358723 | 3300005533 | Surface Soil | LIAVALMVVLLLAFILYRSRSADQLEVDPHAAKEIEKAKRR* |
| Ga0070684_1006703131 | 3300005535 | Corn Rhizosphere | MTRILLWLIVAAVLVIGFLFYRSQPRDRLNVTSYAEQEIERAKR |
| Ga0070684_1010447952 | 3300005535 | Corn Rhizosphere | MKRSLLWLIVVAALLAGWLLYRFKSGSDLIVTPDAAQEIEKAERR* |
| Ga0070730_104041852 | 3300005537 | Surface Soil | VKKLVVLLIVVAILLIGVIVYRARSTRQLDVDPDAAREIEKAKRR* |
| Ga0070731_104833742 | 3300005538 | Surface Soil | VKRILLRLTVAAALVIGFVLYRSRKRSDLNVEPNAREVIEKAKRR* |
| Ga0070732_103414542 | 3300005542 | Surface Soil | VKKMLPWLIALAILLIGVVVYRARSTRRLNVDPAAAREIEKAKQR* |
| Ga0070704_1012756861 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPVRRALLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR* |
| Ga0068857_1008079181 | 3300005577 | Corn Rhizosphere | VKQLLLWLIVAAVLMVGFLLYRSRSRGSLNVTPDAQQEIEQGKAAVVD |
| Ga0068856_1001346424 | 3300005614 | Corn Rhizosphere | MKRSLLWLIVVAALLGGWLLYRFKSGSDLNVTPDAAQEIEKAERR* |
| Ga0068859_1026557622 | 3300005617 | Switchgrass Rhizosphere | VKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR* |
| Ga0080026_101013432 | 3300005952 | Permafrost Soil | VKRILIWFIVAAVLAIGFVLYRSRPASRLDVPQDAQREIERAKQR* |
| Ga0075028_1008601822 | 3300006050 | Watersheds | VKRTLLRLIVAAALIIAFVWYRSRPRMRLNVTPDAARKIEKAKRR* |
| Ga0097621_1000285207 | 3300006237 | Miscanthus Rhizosphere | MKRALLWLIVAAGLVAGLLLYRSRSGSDLNITPEASQEIEKAKRR* |
| Ga0073928_100602754 | 3300006893 | Iron-Sulfur Acid Spring | VKRILLWLIVIAVLVIGFVLYRSRSGSHLNVAPDAQREIDKAKRR* |
| Ga0073928_109968932 | 3300006893 | Iron-Sulfur Acid Spring | MKRVLLWLIVAALLVIGFVLYRARSGSDLNVTRDAADEIEKAKRR* |
| Ga0075426_114906603 | 3300006903 | Populus Rhizosphere | VLIALIALALLLIGFILYRSRSTNQLDVDPEAAREIEKAKRR* |
| Ga0099830_109205181 | 3300009088 | Vadose Zone Soil | VRRLVVLLIVAAILLIGVVVYRSRSTRQLNVDPDAAREIEKAKLR* |
| Ga0105245_114403452 | 3300009098 | Miscanthus Rhizosphere | LIVAAILLAGLLLYRSQSGSTLNVTPDAAREIEGAKRR* |
| Ga0105245_121203302 | 3300009098 | Miscanthus Rhizosphere | MTRALLWLIGGVVLLIAFVLYRSTSVSDLNVTPDAAREIDGARRR* |
| Ga0105243_101812431 | 3300009148 | Miscanthus Rhizosphere | VKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDARREIEKAKRR* |
| Ga0105241_103951223 | 3300009174 | Corn Rhizosphere | VKRRLLWLIVAAILLAGLVLYRSRSGSTLNVTPDAAREIERAKQR* |
| Ga0116221_13601341 | 3300009523 | Peatlands Soil | MKRAMLWLIAAAVLLVAFLVYRSRSGSDFQVTPDAAREIERAKRR* |
| Ga0105238_125320632 | 3300009551 | Corn Rhizosphere | MKRALLWLSFAAALAIAFMLYRSWSGTRLNVTPDARREIEKAKRR* |
| Ga0116125_10013239 | 3300009628 | Peatland | MKKILLWLVVVAVLVIGFVVYRSRSRNHLDVTPDARREIEKAKRR* |
| Ga0116126_12549022 | 3300009640 | Peatland | AMRLLPHAVLEIGFVLYRSLLGIHLNLTPDAERKIEKARRR* |
| Ga0126372_121529341 | 3300010360 | Tropical Forest Soil | VRKALVALIAVAILLIAYAVYRSRSDGLNVDPDAAKEIEKAKRR* |
| Ga0134128_116779962 | 3300010373 | Terrestrial Soil | KHTLIWLIATAILMTGLVLYRSQSRGHLNVTPDAEREIEKARRR* |
| Ga0136449_1001396854 | 3300010379 | Peatlands Soil | VKRLLLWFFVAVLAIAFVLHRSRSGMRLKVTPDAEREIEKAKRR* |
| Ga0136449_1031549972 | 3300010379 | Peatlands Soil | MRKILVWLIVAAVLVIGFVLYRSWSGNRLDVTPDAEHEIEKAKRR* |
| Ga0136449_1031939981 | 3300010379 | Peatlands Soil | GRTTNMETDRSMKRILLWLIFAAVLVIGFVLYSSWSATQLNVTPDAEHEIEKAKRR* |
| Ga0134121_103445642 | 3300010401 | Terrestrial Soil | LLIVTILLVTVFVIYRSRSTRLNVTPDAAREIEKAKRR* |
| Ga0134123_110397482 | 3300010403 | Terrestrial Soil | MRLFLAIILIALLLITFRVYRSRSASHLNVTPDAEREIEKAKRR* |
| Ga0105246_107647992 | 3300011119 | Miscanthus Rhizosphere | MKRALLWLIVAAGLVAGLLLYRSRSGNDLNITPDASQEIEKAKRR* |
| Ga0137383_110260211 | 3300012199 | Vadose Zone Soil | MKAGPTPMKKILLWIIVVAALALGFVLYRSRSRTHLNVTPDAEREIEKAKRR* |
| Ga0137362_101670393 | 3300012205 | Vadose Zone Soil | MKKILPWIIIVAALAIGFVVYRSRSGTHLNVTPDAEREIEKAKRR* |
| Ga0137381_113608731 | 3300012207 | Vadose Zone Soil | MKRILLWLIVAAALVIGFVFYRSRSGSNLNVTPDAEPEIEKAKRR* |
| Ga0137378_117675342 | 3300012210 | Vadose Zone Soil | MKKILIFVIVAAVLLIVFGVYRSRSRDHLDITPDAKREIEKAKRR* |
| Ga0137361_101939691 | 3300012362 | Vadose Zone Soil | PIPAGTTMEWVHLKHTLLWLIVAAVLVIGFVLYRSRSRTHLNVTPDAEREIEKAKRR* |
| Ga0137390_106985432 | 3300012363 | Vadose Zone Soil | VVHVKGILLWLIVAALLVMGFVLYRSRSGNHLNVTPDAEREIEKAKRR* |
| Ga0137358_106532602 | 3300012582 | Vadose Zone Soil | MKAGPTPMKKILLWIIVVAALAIGFVLYRSRSRTHLNVTPDAEREIEKAKRR* |
| Ga0137395_105780453 | 3300012917 | Vadose Zone Soil | MKAGPMLMKKILLWLIVAAALMIGFALYRSRSGTHLNVTPDAE |
| Ga0164301_107744022 | 3300012960 | Soil | MKRTVFWLIVAALLVLGLMVYRSRSRSDLNVAPDAAEEIEKAKRR* |
| Ga0157370_100496763 | 3300013104 | Corn Rhizosphere | MKRTLLWLIVAAALVLAFLLYHSHSATKLNVTPDAEREIEKAKRR* |
| Ga0163162_108232373 | 3300013306 | Switchgrass Rhizosphere | VKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDAEREIEKAKRR* |
| Ga0163162_125722412 | 3300013306 | Switchgrass Rhizosphere | MNRILLWLIIALVLMIGFVLYRSHSTTKLNVTPDAQRE |
| Ga0157375_107589942 | 3300013308 | Miscanthus Rhizosphere | VRSALLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR* |
| Ga0157375_129145021 | 3300013308 | Miscanthus Rhizosphere | MKQLLLWLVVAVVVLIGFLLYRASSENHLNVAPEAEREIEKAKRR* |
| Ga0181518_104224312 | 3300014156 | Bog | LGDVKRTVLWLIVAAILAIGFVLHRSRAGSNLNVTPDAAREIEKAKRR* |
| Ga0181538_104946511 | 3300014162 | Bog | NLSDVKRTVNWVIAAAILVIAFVLYRSRSGSNLNVTPDAAPEIEKVKQR* |
| Ga0181538_106683851 | 3300014162 | Bog | LNRTLSWLIVAAALLIGLVLYHSRSRNHLDVTPDAEREIEKAKRR* |
| Ga0181523_100673951 | 3300014165 | Bog | SEPPLNRTLSWLIVAAALLIGLALYHSRSRNHLDVTPDAEREIEKAKRR* |
| Ga0163163_100239567 | 3300014325 | Switchgrass Rhizosphere | MKRALLWLIVAAGLVAGLLLYRSRSGSDLNITPDASQEIEKAKRR* |
| Ga0137403_109845951 | 3300015264 | Vadose Zone Soil | VGDLNLKRILLLIIVAGLIAIGFLLFRSRPADRLDVTPDAAREIEKAKGR* |
| Ga0187863_100457373 | 3300018034 | Peatland | MKKILLWLVVVAVLVIGFVVYRSRSRNHLDVTPDARREIEKAKRR |
| Ga0187863_101774803 | 3300018034 | Peatland | YGRPLKRIVLWLIVAVVLVAGFVVFHSRSGPHLNVTPDAAREIEKAKRR |
| Ga0187887_100265882 | 3300018043 | Peatland | MKKILLWLIVAAMLVIGFAVYRSRSRNHLDVTPDAQREIERAKRR |
| Ga0187774_103642581 | 3300018089 | Tropical Peatland | VKQALLWLFVVVLVIAFVFYRSRPRIHLNVTPEAER |
| Ga0210407_103627671 | 3300020579 | Soil | VLLIVVAILLIVAMVYRSRSTRELNVDPDAAREIEKAKRH |
| Ga0210407_106713902 | 3300020579 | Soil | VRKFAVLLIVLAILLIAVMVYRSRSTRQLNVDPDASREIEKT |
| Ga0210403_102015673 | 3300020580 | Soil | MKRALLWLIVAAVLLIGFVLYRARSGSDLNVTPDAAREIEKAKRR |
| Ga0210399_112569512 | 3300020581 | Soil | VRKFVVLLIVLAILLIVMVYRSKSTRQLNVDPDAAREIEKAKRR |
| Ga0210399_112962772 | 3300020581 | Soil | MKRILLFLILIAVLVIGLMLYRSRSGRLNVTPDAEREIEKAKRR |
| Ga0210399_113425602 | 3300020581 | Soil | MKRVLLWLIVAAVLVIGFVLYRARSGSGPNVTPDAAQEIEKAMRR |
| Ga0210406_107183451 | 3300021168 | Soil | VKKFVVLLIVLASLLIAVIVYRSRSTRQLNVDPDAAQEIEKA |
| Ga0210400_102058202 | 3300021170 | Soil | VKKFVVLLIVLASLLIAVIVYRSRSTRQLNVDPDAAQEIEKAKRR |
| Ga0210400_106382312 | 3300021170 | Soil | VKQILLWLIVALVLVIGFLLYRSRSGDHLNVTPEAQREIEKAERR |
| Ga0210408_102375732 | 3300021178 | Soil | MNRVLLWLIVAAVLVIGFVLYRSRSGGDLNVTPEAEQEIERAKRR |
| Ga0210383_117885141 | 3300021407 | Soil | LNVKRILLWLILAAVLAIGFLVYRSRSESHLDVTPDAAREIEKAKRR |
| Ga0210384_106518622 | 3300021432 | Soil | VRKFVVLLIVVAILLIVAMVYRSRSTRELNVDPDAAREIEKAKRH |
| Ga0210402_109267731 | 3300021478 | Soil | VRKLVVLLIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR |
| Ga0210409_101420163 | 3300021559 | Soil | VRKFAVLLIVLAILLIAVMVYRSRSTRQLNVDPDASREIEKTKRR |
| Ga0212123_102156272 | 3300022557 | Iron-Sulfur Acid Spring | VKRILLWLIVIAVLVIGFVLYRSRSGSHLNVAPDAQREIDKAKRR |
| Ga0242654_100788842 | 3300022726 | Soil | KRILLWLILAAALIIGVMFYRSRSGSRLDITPDAAREIEKAKQR |
| Ga0207707_113268421 | 3300025912 | Corn Rhizosphere | ILLWLIVALALLIGFVLYRSHSATKLNVTPEAEREIEKAKRR |
| Ga0207663_102298471 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDA |
| Ga0207700_107139202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRSLLWLIVVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR |
| Ga0207701_114606352 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR |
| Ga0207709_106516121 | 3300025935 | Miscanthus Rhizosphere | VKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDARREIEKAKRR |
| Ga0207712_103629731 | 3300025961 | Switchgrass Rhizosphere | VKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR |
| Ga0207702_100801152 | 3300026078 | Corn Rhizosphere | MKRSLLWLISVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR |
| Ga0209736_10439722 | 3300027660 | Forest Soil | LKYIVAAVLVIGFVLYRSHSATKLNVTPDAEREIEKAKRR |
| Ga0209060_101072423 | 3300027826 | Surface Soil | LIAVALMVVLLLAFILYRSRSADQLEVDPHAAKEIEKAKRR |
| Ga0209580_104178871 | 3300027842 | Surface Soil | MKRIILFLGLIAVLVIGLMLYRSRSGHLDVTPDAEREIEKAKRR |
| Ga0209579_106419172 | 3300027869 | Surface Soil | VKRILLRLTVAAALVIGFVLYRSRKRSDLNVEPNAREVIEKAKRR |
| Ga0209168_100176242 | 3300027986 | Surface Soil | VKRTVLWLIVVAALFIAFLLYRSRSGDKLDVAPGAEREIEKARRR |
| Ga0222749_106694181 | 3300029636 | Soil | MKRIILFPILIAALVVGLMLYRSRSGRLNVTPDAEREIEKAKRR |
| Ga0311368_101647442 | 3300029882 | Palsa | MKRILLLVIAAAALIIGILIYRSHTRTHLDVTPEAEREIEKAKRR |
| Ga0311369_101106764 | 3300029910 | Palsa | KTRGMKRILLLVIAAAALIIGILIYRSHTRTHLDVTPEAEREIEKAKRR |
| Ga0311356_110040952 | 3300030617 | Palsa | MKRILLLVIAAAALIIGYLIYRSHTRTHLDVTPEAEREIEKAKRR |
| Ga0265760_100533311 | 3300031090 | Soil | NCKIQGVSNMNRILLWLILAAVLVIGFLLYRSRSEPHLDVTPDAAREIEKAKRR |
| Ga0302325_103263861 | 3300031234 | Palsa | MSNVNRILLWLILASLLAIGFLLYRSRSGPRWDVTPDAAREIEKAKR |
| Ga0302325_110936493 | 3300031234 | Palsa | MKRILLWLLVAATLVIALIVCRSWSDSDVNVTPDAAREIEKAKRR |
| Ga0265331_102915622 | 3300031250 | Rhizosphere | LGDVKRTVIWLIAAAILVVAFVLYRFQSGSNLNVTPGAAREIEKAKRR |
| Ga0310686_1084771133 | 3300031708 | Soil | MAHAKRILFWLIVAAVSVVGFLLYRSQSRSSLNVTPNAREVIEKAKRR |
| Ga0310813_115650282 | 3300031716 | Soil | MKWDVPVRRALLWLIVAALLVTGFIVYRSRSTRLNVTPDAAREIEKAKRR |
| Ga0307474_101652832 | 3300031718 | Hardwood Forest Soil | WLIVAVILVIGFAVYRSRSRNHLEVTPEAGREIERAKRR |
| Ga0307475_102341463 | 3300031754 | Hardwood Forest Soil | VRRLVVLLIVLAILLIGVIVYRSRSSRQLNVDPDAAREIEKAKRH |
| Ga0307478_100527332 | 3300031823 | Hardwood Forest Soil | MKKILVWLIVAVILVIGFAVYRSRSRNHLEVTPEAGREIERAKRR |
| Ga0308175_1030864052 | 3300031938 | Soil | MKRPLLWLIVGAILLVSFALYRSHSGSDLQVTPDAAREIEKAKRR |
| Ga0311301_106327982 | 3300032160 | Peatlands Soil | VKRLLLWFFVAVLAIAFVLHRSRSGMRLKVTPDAEREIEKAKRR |
| Ga0311301_122000822 | 3300032160 | Peatlands Soil | GRTTNMETDRSMKRILLWLIFAAVLVIGFVLYSSWSATQLNVTPDAEHEIEKAKRR |
| Ga0316620_100608293 | 3300033480 | Soil | LKRTLLWLIVAAVLVIGFLLYRSRSGSNLNVTPDAEREIEKAKRR |
| Ga0316624_116559682 | 3300033486 | Soil | LKRTLLWLIVAAVLVIGFLLYRSRSGRNLNVTPDAEREIEKAKRR |
| Ga0316628_1015952182 | 3300033513 | Soil | MKRTLLWVLVAAILLVGFLLYRSQSGSDLNVTPDAAQEIEKAKRR |
| ⦗Top⦘ |