


| Basic Information | |
|---|---|
| Family ID | F073668 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.83 % |
| % of genes near scaffold ends (potentially truncated) | 23.33 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.90% β-sheet: 0.00% Coil/Unstructured: 38.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01818 | Translat_reg | 52.50 |
| PF00011 | HSP20 | 14.17 |
| PF16790 | Phage_clamp_A | 3.33 |
| PF11753 | DUF3310 | 1.67 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.67 |
| PF03104 | DNA_pol_B_exo1 | 0.83 |
| PF00004 | AAA | 0.83 |
| PF00156 | Pribosyltran | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 14.17 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001944|GOS2251_1035617 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300001949|GOS2238_1003082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 841 | Open in IMG/M |
| 3300001954|GOS2235_1005868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 943 | Open in IMG/M |
| 3300001966|GOS2245_1007306 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| 3300002482|JGI25127J35165_1097589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 594 | Open in IMG/M |
| 3300002483|JGI25132J35274_1086670 | Not Available | 644 | Open in IMG/M |
| 3300002488|JGI25128J35275_1072023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 718 | Open in IMG/M |
| 3300002488|JGI25128J35275_1104392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-SSM7 | 570 | Open in IMG/M |
| 3300002955|JGI26062J44793_1032504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 615 | Open in IMG/M |
| 3300003185|JGI26064J46334_1070106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 663 | Open in IMG/M |
| 3300003185|JGI26064J46334_1074062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 644 | Open in IMG/M |
| 3300005074|Ga0070431_1278290 | Not Available | 513 | Open in IMG/M |
| 3300005464|Ga0068484_103172 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300005523|Ga0066865_10001000 | Not Available | 7960 | Open in IMG/M |
| 3300005523|Ga0066865_10193901 | Not Available | 760 | Open in IMG/M |
| 3300005606|Ga0066835_10079111 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300005606|Ga0066835_10121676 | Not Available | 848 | Open in IMG/M |
| 3300005606|Ga0066835_10161593 | Not Available | 745 | Open in IMG/M |
| 3300005606|Ga0066835_10215265 | Not Available | 651 | Open in IMG/M |
| 3300005606|Ga0066835_10225352 | Not Available | 637 | Open in IMG/M |
| 3300005608|Ga0066840_10119684 | Not Available | 552 | Open in IMG/M |
| 3300005934|Ga0066377_10234256 | Not Available | 566 | Open in IMG/M |
| 3300005946|Ga0066378_10195679 | Not Available | 630 | Open in IMG/M |
| 3300005960|Ga0066364_10030341 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
| 3300005960|Ga0066364_10087419 | Not Available | 1037 | Open in IMG/M |
| 3300005960|Ga0066364_10332690 | Not Available | 534 | Open in IMG/M |
| 3300005971|Ga0066370_10110479 | Not Available | 920 | Open in IMG/M |
| 3300005971|Ga0066370_10144997 | Not Available | 812 | Open in IMG/M |
| 3300005971|Ga0066370_10176136 | Not Available | 741 | Open in IMG/M |
| 3300006024|Ga0066371_10170114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 672 | Open in IMG/M |
| 3300006305|Ga0068468_1024468 | All Organisms → Viruses → Predicted Viral | 2414 | Open in IMG/M |
| 3300006332|Ga0068500_1226889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 865 | Open in IMG/M |
| 3300006334|Ga0099675_1142462 | All Organisms → Viruses → Predicted Viral | 1829 | Open in IMG/M |
| 3300006334|Ga0099675_1270672 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300006334|Ga0099675_1283247 | All Organisms → Viruses → Predicted Viral | 3041 | Open in IMG/M |
| 3300006334|Ga0099675_1409779 | Not Available | 639 | Open in IMG/M |
| 3300006334|Ga0099675_1457611 | Not Available | 864 | Open in IMG/M |
| 3300006334|Ga0099675_1769056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 777 | Open in IMG/M |
| 3300006337|Ga0068495_1203433 | All Organisms → Viruses → Predicted Viral | 3118 | Open in IMG/M |
| 3300006337|Ga0068495_1761849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-SSM7 | 997 | Open in IMG/M |
| 3300006345|Ga0099693_1018789 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300006350|Ga0099954_1018817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6697 | Open in IMG/M |
| 3300006350|Ga0099954_1225107 | All Organisms → Viruses → Predicted Viral | 2595 | Open in IMG/M |
| 3300006350|Ga0099954_1334152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 912 | Open in IMG/M |
| 3300006350|Ga0099954_1546358 | Not Available | 830 | Open in IMG/M |
| 3300006351|Ga0099953_1417977 | Not Available | 637 | Open in IMG/M |
| 3300006351|Ga0099953_1552937 | Not Available | 572 | Open in IMG/M |
| 3300006413|Ga0099963_1020310 | All Organisms → Viruses → Predicted Viral | 2965 | Open in IMG/M |
| 3300006413|Ga0099963_1447450 | Not Available | 631 | Open in IMG/M |
| 3300006481|Ga0100229_1028083 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300006481|Ga0100229_1479653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 992 | Open in IMG/M |
| 3300006843|Ga0068496_129463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 905 | Open in IMG/M |
| 3300007114|Ga0101668_1071092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 735 | Open in IMG/M |
| 3300009550|Ga0115013_11229484 | Not Available | 547 | Open in IMG/M |
| 3300012919|Ga0160422_10269458 | Not Available | 1043 | Open in IMG/M |
| 3300012920|Ga0160423_10374068 | Not Available | 975 | Open in IMG/M |
| 3300012920|Ga0160423_10816196 | Not Available | 627 | Open in IMG/M |
| 3300012928|Ga0163110_11199063 | Not Available | 610 | Open in IMG/M |
| 3300012928|Ga0163110_11525689 | Not Available | 542 | Open in IMG/M |
| 3300012928|Ga0163110_11778120 | Not Available | 503 | Open in IMG/M |
| 3300012953|Ga0163179_10457687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1047 | Open in IMG/M |
| 3300012954|Ga0163111_11593371 | Not Available | 648 | Open in IMG/M |
| 3300017720|Ga0181383_1204255 | Not Available | 524 | Open in IMG/M |
| 3300017732|Ga0181415_1157458 | Not Available | 507 | Open in IMG/M |
| 3300017734|Ga0187222_1143029 | Not Available | 533 | Open in IMG/M |
| 3300017738|Ga0181428_1128062 | Not Available | 595 | Open in IMG/M |
| 3300017759|Ga0181414_1183539 | Not Available | 543 | Open in IMG/M |
| 3300020248|Ga0211584_1004803 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
| 3300020249|Ga0211635_1006317 | All Organisms → Viruses → Predicted Viral | 2290 | Open in IMG/M |
| 3300020257|Ga0211704_1073222 | Not Available | 515 | Open in IMG/M |
| 3300020270|Ga0211671_1002729 | All Organisms → Viruses → Predicted Viral | 3868 | Open in IMG/M |
| 3300020288|Ga0211619_1027809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 804 | Open in IMG/M |
| 3300020289|Ga0211621_1007264 | All Organisms → Viruses → Predicted Viral | 2105 | Open in IMG/M |
| 3300020311|Ga0211628_1001860 | All Organisms → Viruses → Predicted Viral | 4594 | Open in IMG/M |
| 3300020343|Ga0211626_1010224 | All Organisms → Viruses → Predicted Viral | 2795 | Open in IMG/M |
| 3300020367|Ga0211703_10051402 | Not Available | 987 | Open in IMG/M |
| 3300020393|Ga0211618_10206101 | Not Available | 671 | Open in IMG/M |
| 3300020401|Ga0211617_10304317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 662 | Open in IMG/M |
| 3300020405|Ga0211496_10077149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → unclassified Cymopoleiavirus → Synechococcus phage S-RSM4 | 1206 | Open in IMG/M |
| 3300020417|Ga0211528_10035434 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
| 3300020419|Ga0211512_10173002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 996 | Open in IMG/M |
| 3300020420|Ga0211580_10008465 | All Organisms → Viruses → Predicted Viral | 4686 | Open in IMG/M |
| 3300020426|Ga0211536_10151913 | Not Available | 902 | Open in IMG/M |
| 3300020433|Ga0211565_10328794 | Not Available | 667 | Open in IMG/M |
| 3300020433|Ga0211565_10490255 | Not Available | 534 | Open in IMG/M |
| 3300020433|Ga0211565_10503770 | Not Available | 526 | Open in IMG/M |
| 3300020436|Ga0211708_10246077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 723 | Open in IMG/M |
| 3300020436|Ga0211708_10465879 | Not Available | 519 | Open in IMG/M |
| 3300020437|Ga0211539_10247829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 735 | Open in IMG/M |
| 3300020441|Ga0211695_10140795 | Not Available | 826 | Open in IMG/M |
| 3300020441|Ga0211695_10260825 | Not Available | 628 | Open in IMG/M |
| 3300020442|Ga0211559_10266839 | Not Available | 801 | Open in IMG/M |
| 3300020448|Ga0211638_10087192 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300020451|Ga0211473_10446536 | Not Available | 661 | Open in IMG/M |
| 3300020454|Ga0211548_10424861 | Not Available | 651 | Open in IMG/M |
| 3300020463|Ga0211676_10166920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1365 | Open in IMG/M |
| 3300020467|Ga0211713_10372479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 691 | Open in IMG/M |
| 3300020471|Ga0211614_10043037 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300021791|Ga0226832_10082448 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300022074|Ga0224906_1073957 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300022074|Ga0224906_1159167 | Not Available | 633 | Open in IMG/M |
| 3300025127|Ga0209348_1007249 | All Organisms → Viruses → Predicted Viral | 4624 | Open in IMG/M |
| 3300025127|Ga0209348_1103073 | Not Available | 884 | Open in IMG/M |
| 3300025127|Ga0209348_1112832 | Not Available | 832 | Open in IMG/M |
| 3300025127|Ga0209348_1120064 | Not Available | 798 | Open in IMG/M |
| 3300025127|Ga0209348_1128389 | Not Available | 762 | Open in IMG/M |
| 3300025127|Ga0209348_1131344 | All Organisms → Viruses | 750 | Open in IMG/M |
| 3300025127|Ga0209348_1134468 | Not Available | 738 | Open in IMG/M |
| 3300025127|Ga0209348_1151181 | Not Available | 682 | Open in IMG/M |
| 3300025127|Ga0209348_1157108 | Not Available | 664 | Open in IMG/M |
| 3300025132|Ga0209232_1230414 | Not Available | 547 | Open in IMG/M |
| 3300026081|Ga0208390_1036620 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300026083|Ga0208878_1103249 | Not Available | 704 | Open in IMG/M |
| 3300026085|Ga0208880_1051150 | Not Available | 894 | Open in IMG/M |
| 3300026321|Ga0208764_10461818 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 587 | Open in IMG/M |
| 3300027702|Ga0209036_1122137 | Not Available | 769 | Open in IMG/M |
| 3300027702|Ga0209036_1124698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 759 | Open in IMG/M |
| 3300027830|Ga0209359_10038237 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
| 3300027830|Ga0209359_10111475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 → Prochlorococcus phage P-SSM2 | 1163 | Open in IMG/M |
| 3300032073|Ga0315315_10097986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM68 | 2728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.33% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 30.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 19.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.83% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 5.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.83% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.83% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.83% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001944 | Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036 | Environmental | Open in IMG/M |
| 3300001949 | Marine microbial communities from Panama City, Panama - GS022 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002955 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003185 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005464 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0025m | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300006843 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0075m | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300020248 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) | Environmental | Open in IMG/M |
| 3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
| 3300020257 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020288 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556132-ERR599045) | Environmental | Open in IMG/M |
| 3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
| 3300020311 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020426 | Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026081 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026083 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2251_10356174 | 3300001944 | Marine | DENLLREVVGDDKNDKKRVANLNEEDDNNEEVLLS* |
| GOS2238_10030823 | 3300001949 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENNDDEEVL |
| GOS2235_10058681 | 3300001954 | Marine | KMEDENLLREVVGDDKNDKKRVANLNEENTDDEEVLLS* |
| GOS2245_10073066 | 3300001966 | Marine | MSNLREDIDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| JGI25127J35165_10975892 | 3300002482 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEEQNDEEVLLS* |
| JGI25132J35274_10866701 | 3300002483 | Marine | MSNLREDVDNLLREVVGXDKXXKKRVANLXEENDNNEEVLLS* |
| JGI25128J35275_10720232 | 3300002488 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLL* |
| JGI25128J35275_11043921 | 3300002488 | Marine | LKMENDDNLLREVVGDYKNDKKKSKNLNEEDENDEEVLLS* |
| JGI26062J44793_10325042 | 3300002955 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENDNNEELLLS* |
| JGI26064J46334_10701062 | 3300003185 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| JGI26064J46334_10740622 | 3300003185 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEEDNNNEEVLLS* |
| Ga0070431_12782901 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | RNKMEDENLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0068484_1031723 | 3300005464 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0066865_100010006 | 3300005523 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS* |
| Ga0066865_101939012 | 3300005523 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0066835_100791112 | 3300005606 | Marine | MEDENLLREVVGDDKNDKKRVANLNEEDNNNEEVLLS* |
| Ga0066835_101216762 | 3300005606 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENNDDEEVLLS* |
| Ga0066835_101615933 | 3300005606 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS* |
| Ga0066835_102152652 | 3300005606 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDLNDEEVLLS* |
| Ga0066835_102253522 | 3300005606 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENDNNEEVLLS* |
| Ga0066840_101196842 | 3300005608 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENSDNEEVLLS* |
| Ga0066377_102342562 | 3300005934 | Marine | MSNLREDVDNLLREVVGDHKNDKKRVANLNEENSDDEEVLLS* |
| Ga0066378_101956793 | 3300005946 | Marine | MEDDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0066364_100303412 | 3300005960 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEEDNNNEEVLLS* |
| Ga0066364_100874192 | 3300005960 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEEQNNEEVLLS* |
| Ga0066364_103326901 | 3300005960 | Marine | MSNLPNLREDVNNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0066370_101104792 | 3300005971 | Marine | MSNLREDVDNLLREVVGDDKNDKKRIANLNEENSDDEECSHFEQ* |
| Ga0066370_101449971 | 3300005971 | Marine | REDVDNLLREVVGDDKNDKKRVANLNEENSDDEECSYLE* |
| Ga0066370_101761361 | 3300005971 | Marine | MSNLKEDIDNLLREVVGDHKNDKKRVANLNEENGDDEEVLLS* |
| Ga0066371_101701142 | 3300006024 | Marine | MEEENLLREVVGDDKNDKKRVANLNEENSDDEELLLS* |
| Ga0068468_10244685 | 3300006305 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS* |
| Ga0068500_12268891 | 3300006332 | Marine | VMSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099675_11424628 | 3300006334 | Marine | MSNLKEDIDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099675_12706723 | 3300006334 | Marine | MSNLPNLREDVNNLLREVVGDDKNDKKRVANLNEEDNKNEEVLLS* |
| Ga0099675_12832478 | 3300006334 | Marine | MSNLPNLREDVNNLLREVVGDDKNDKKRVANLNEENSDDE |
| Ga0099675_14097792 | 3300006334 | Marine | MSNLPNLREDVDNLLKEVVGDHKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099675_14576111 | 3300006334 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNGEEVLLS* |
| Ga0099675_17690562 | 3300006334 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNNEEVLLS* |
| Ga0068495_12034338 | 3300006337 | Marine | MSNLPNLREDIDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0068495_17618492 | 3300006337 | Marine | VDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099693_10187891 | 3300006345 | Marine | MSNLPNLREDVDNLLREVVGDHKNDKKRVANLNEEN |
| Ga0099954_10188179 | 3300006350 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEKNSDDEEVLLS* |
| Ga0099954_12251071 | 3300006350 | Marine | NQRRSKMEDEKLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099954_13341522 | 3300006350 | Marine | MSNLPNLREDVNNLLREVVGDDKNDKKRVANLNEENSNDEEVLLS* |
| Ga0099954_15463582 | 3300006350 | Marine | DDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS* |
| Ga0099953_14179772 | 3300006351 | Marine | VNNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS* |
| Ga0099953_15529372 | 3300006351 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVL |
| Ga0099963_10203107 | 3300006413 | Marine | MSNLPNLREDVNNLLREVVGDDKNDKKRVANLNEEDSNNEEVLLS* |
| Ga0099963_14474502 | 3300006413 | Marine | MSNLPNLREDVDNLLREVVGDHKNDKKRVANLNEENSDDEEVLLS* |
| Ga0100229_10280831 | 3300006481 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEEDNNNE |
| Ga0100229_14796532 | 3300006481 | Marine | MSNLPNLREDVNNILREVVGDDKNDKKRVANLNEENSDDEEELLS* |
| Ga0068496_1294632 | 3300006843 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS*KLI* |
| Ga0101668_10710922 | 3300007114 | Volcanic Co2 Seep Seawater | MEDENLLREVVGDDKNDKKRVANLNEENSDDEELLLS* |
| Ga0115013_112294842 | 3300009550 | Marine | MENDDNLLREVVGDYKNDRKKKKNLNEEEENDEEVLLS* |
| Ga0160422_102694582 | 3300012919 | Seawater | MSDLRKDVDNLLREVVGDYKNDKDSKKNLNEESDEQELLND* |
| Ga0160423_103740682 | 3300012920 | Surface Seawater | MMSDLREDVDNLLREVVGDYKNDKNSKKNLNEESDEKELLND* |
| Ga0160423_108161962 | 3300012920 | Surface Seawater | MSNLREDVDNLLREVVGDHKNDKKRVANLNEEDDNNEEVLLS* |
| Ga0163110_111990632 | 3300012928 | Surface Seawater | MEDENLLREVVGDDKNDKKRVANLNEEDDNNEEVLLS* |
| Ga0163110_115256892 | 3300012928 | Surface Seawater | MEDDNLLREVVGDDKNDKKRVANLNEKNNDDEEVLLS* |
| Ga0163110_117781201 | 3300012928 | Surface Seawater | DENLLREVVGDDKNDKKRVANLNEENGDDEECSYFEQ* |
| Ga0163179_104576872 | 3300012953 | Seawater | MENDDNLLREVVGDYKNDKKKKKNLNEEEENDEEVLLL* |
| Ga0163111_115933711 | 3300012954 | Surface Seawater | MSNLREDVDNLLREVVGDHKNDKKRVANLNEEDNDNEEVLLS* |
| Ga0181383_12042551 | 3300017720 | Seawater | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEENQNDEEVLLS |
| Ga0181415_11574581 | 3300017732 | Seawater | MENDDNLLREVVGDYKNDKKKSKNLNEEEENDEEVLLS |
| Ga0187222_11430292 | 3300017734 | Seawater | KMENDGNLLREVVGDYKNDRKKKKNLNEEEENDEEVLLS |
| Ga0181428_11280621 | 3300017738 | Seawater | RNLKMENDDNLLREVVGDYKNDRKKKKNLNEEEENDEEVLLS |
| Ga0181414_11835391 | 3300017759 | Seawater | MENDDNLLREVVGDYKNDKKKSKNLNEEEENDEEVL |
| Ga0211584_10048033 | 3300020248 | Marine | MSNLKEDIDNLLREVVGDHKNDKKRVANLNEENSDDEEVLLS |
| Ga0211635_10063172 | 3300020249 | Marine | MENDDNLLREVVGDYKNDRKKKKNLNEEEENDEEVLLS |
| Ga0211704_10732221 | 3300020257 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENGDDEEVLLS |
| Ga0211671_10027298 | 3300020270 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS |
| Ga0211619_10278092 | 3300020288 | Marine | MSNLREDVDNLLREVVGDDKNDKKRIANLNEENSDDEECSYFEQ |
| Ga0211621_10072642 | 3300020289 | Marine | MSDLKNDIDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS |
| Ga0211628_10018606 | 3300020311 | Marine | MENDDNLLREVVGDYKNDKKKKKNLNEEEENDEEVLLL |
| Ga0211626_10102248 | 3300020343 | Marine | MENDDNLLREVVGDYKNDKKKKKNLNEEEENDEEVLLS |
| Ga0211703_100514021 | 3300020367 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEENSDD |
| Ga0211618_102061012 | 3300020393 | Marine | VDNLLREVVGDDKNDKKRIANLNEENSDDEECSYFEQ |
| Ga0211617_103043171 | 3300020401 | Marine | MEDDNLLREVVGDDKNDKKRVANLNEENSNDEEVLLS |
| Ga0211496_100771492 | 3300020405 | Marine | MSNLREDVDNLLREVVGDDKNDKKRIANLNEENSDDEECSHFEQ |
| Ga0211528_100354345 | 3300020417 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS |
| Ga0211512_101730022 | 3300020419 | Marine | MSNLKDDVDNLLREVVGDYKNDKKRVENLNEENSDDEECSYFG |
| Ga0211580_100084651 | 3300020420 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEENSNDEEVLLS |
| Ga0211536_101519132 | 3300020426 | Marine | QRRSKMEDENLLREVVGDDKNDKKRVANLNEENSDDEEVLLS |
| Ga0211565_103287942 | 3300020433 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENSDDEEVLLT |
| Ga0211565_104902551 | 3300020433 | Marine | MSDLKEDIDNLLREVVGDHKNDKKRVANLNEENSDDEEVLLS |
| Ga0211565_105037701 | 3300020433 | Marine | MEDENLLREVVGDDKNDRKRVANLNEEDDNNEEVLLS |
| Ga0211708_102460773 | 3300020436 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEKNSDDEEVLLS |
| Ga0211708_104658792 | 3300020436 | Marine | MSNLREDVDNLLREVVGDHKNDKKRVANLNEENSDDEEVLLS |
| Ga0211539_102478291 | 3300020437 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENNNDEELLLS |
| Ga0211695_101407951 | 3300020441 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENSDDEECSYLE |
| Ga0211695_102608251 | 3300020441 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEKNSDDEEVLLS |
| Ga0211559_102668391 | 3300020442 | Marine | MSNLREDVDNLLREVVGDHKNDKKRVANLNEEDDNNEEVLLS |
| Ga0211638_100871923 | 3300020448 | Marine | MSDLKNDVDNLLREVVGDYKNDKKRVENLNEENSDDEECSHFG |
| Ga0211473_104465362 | 3300020451 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLLXKLV |
| Ga0211548_104248612 | 3300020454 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLL |
| Ga0211676_101669202 | 3300020463 | Marine | MENDDNLLREVVGDYKNDRNKKKNLNEEEENDEEVLLS |
| Ga0211713_103724792 | 3300020467 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS |
| Ga0211614_100430373 | 3300020471 | Marine | MMSDLREDVDNLLREVVGDYKNDKDSKKNLNEESDEKELLND |
| Ga0226832_100824482 | 3300021791 | Hydrothermal Vent Fluids | MSNLPNLREDVDNLLREVVGDHKNDKKRVANLNEKNSDDEEVLLS |
| Ga0224906_10739572 | 3300022074 | Seawater | MENDDNLLREVVGDYKNDKKKSKNLNEEDENDEEVLLS |
| Ga0224906_11591671 | 3300022074 | Seawater | MENDDNLLREVVGDYKNDRKKKKNLNEEEENDEEVLL |
| Ga0209348_10072492 | 3300025127 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENDNNEEVLLS |
| Ga0209348_11030731 | 3300025127 | Marine | MEDENLLREVVGDDKNDKKRVANLNEENNDDEEVLLS |
| Ga0209348_11128322 | 3300025127 | Marine | MEDENLLREVVGDDKNDKKRVANLNEEDNDNEEVLLS |
| Ga0209348_11200642 | 3300025127 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENGDDEEVLLS |
| Ga0209348_11283891 | 3300025127 | Marine | MSNLPNLREDVDNLLREVVGDDKNDKKRVANLNEEDNNNEEVLLS |
| Ga0209348_11313441 | 3300025127 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLS |
| Ga0209348_11344682 | 3300025127 | Marine | VMSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDLNDEEVLLS |
| Ga0209348_11511812 | 3300025127 | Marine | MEEENLLREVVGDDKNDKKRVANLNEENSDDEELLLS |
| Ga0209348_11571082 | 3300025127 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEEQNDEEVLLS |
| Ga0209232_12304141 | 3300025132 | Marine | MSDLKNDVDNLLREVVGDYKNDKKTKKNLNEEDLNDEEVLLS |
| Ga0208390_10366203 | 3300026081 | Marine | MSNLRNLKDDVDNLLREVVGDYKNDKKTKKNLNEEEQNNEEVLLS |
| Ga0208878_11032491 | 3300026083 | Marine | MSNLKEDIDNLLREVVGDHKNDKKRVANLNEENGDDEEVLLS |
| Ga0208880_10511502 | 3300026085 | Marine | NLPNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVLLS |
| Ga0208764_104618181 | 3300026321 | Marine | MLSDENLLREVVGDDKNDDKRKTNLNELNEEEWILQQ |
| Ga0209036_11221371 | 3300027702 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEEDNNNEEVLLS |
| Ga0209036_11246981 | 3300027702 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENSDDEEVL |
| Ga0209359_100382375 | 3300027830 | Marine | MSNLKDDVDNLLREVVGDYKNDKKTKKNLNEEDQNDEEVLLL |
| Ga0209359_101114751 | 3300027830 | Marine | MSNLREDVDNLLREVVGDDKNDKKRVANLNEENDNNEELLLS |
| Ga0315315_100979869 | 3300032073 | Seawater | MEDENLLREVVGDDKNDKKRVANLNEEDSDNEEVLLS |
| ⦗Top⦘ |