


| Basic Information | |
|---|---|
| Family ID | F073620 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLES |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.17 % |
| % of genes near scaffold ends (potentially truncated) | 90.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 2.99% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03358 | FMN_red | 6.67 |
| PF05368 | NmrA | 5.00 |
| PF08281 | Sigma70_r4_2 | 5.00 |
| PF00106 | adh_short | 3.33 |
| PF13561 | adh_short_C2 | 2.50 |
| PF02566 | OsmC | 2.50 |
| PF13564 | DoxX_2 | 1.67 |
| PF02954 | HTH_8 | 1.67 |
| PF00248 | Aldo_ket_red | 1.67 |
| PF14534 | DUF4440 | 1.67 |
| PF02678 | Pirin | 1.67 |
| PF02738 | MoCoBD_1 | 1.67 |
| PF01047 | MarR | 1.67 |
| PF00107 | ADH_zinc_N | 0.83 |
| PF00440 | TetR_N | 0.83 |
| PF13602 | ADH_zinc_N_2 | 0.83 |
| PF14552 | Tautomerase_2 | 0.83 |
| PF06537 | DHOR | 0.83 |
| PF12852 | Cupin_6 | 0.83 |
| PF13185 | GAF_2 | 0.83 |
| PF13460 | NAD_binding_10 | 0.83 |
| PF01638 | HxlR | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF06779 | MFS_4 | 0.83 |
| PF10604 | Polyketide_cyc2 | 0.83 |
| PF02515 | CoA_transf_3 | 0.83 |
| PF01197 | Ribosomal_L31 | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.50 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.50 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.67 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.83 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.83 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100397414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 617 | Open in IMG/M |
| 3300000955|JGI1027J12803_103999553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2867 | Open in IMG/M |
| 3300000955|JGI1027J12803_109270839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300001082|JGI12664J13189_1008894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 621 | Open in IMG/M |
| 3300001867|JGI12627J18819_10413802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300002910|JGI25615J43890_1004186 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300002912|JGI25386J43895_10094310 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300004480|Ga0062592_100856860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 813 | Open in IMG/M |
| 3300005330|Ga0070690_100812068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 726 | Open in IMG/M |
| 3300005347|Ga0070668_101456901 | Not Available | 625 | Open in IMG/M |
| 3300005434|Ga0070709_10802733 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005538|Ga0070731_10144887 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300005538|Ga0070731_10564707 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005541|Ga0070733_10716884 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005586|Ga0066691_10825573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005591|Ga0070761_10919082 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005843|Ga0068860_100607939 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300005921|Ga0070766_11234100 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006028|Ga0070717_11482341 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006358|Ga0068871_100565536 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006797|Ga0066659_11206883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 632 | Open in IMG/M |
| 3300006844|Ga0075428_101440083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 722 | Open in IMG/M |
| 3300006847|Ga0075431_101589928 | Not Available | 611 | Open in IMG/M |
| 3300006893|Ga0073928_10072368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2987 | Open in IMG/M |
| 3300006969|Ga0075419_11238053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. LAMO17WK12:I5 | 552 | Open in IMG/M |
| 3300007255|Ga0099791_10198752 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009038|Ga0099829_10586692 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300009094|Ga0111539_12443966 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009147|Ga0114129_11018238 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300009156|Ga0111538_10153030 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300009156|Ga0111538_11459996 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300009162|Ga0075423_12995721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300009645|Ga0116106_1267222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 544 | Open in IMG/M |
| 3300010046|Ga0126384_10768872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300010134|Ga0127484_1069086 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010304|Ga0134088_10401492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 668 | Open in IMG/M |
| 3300010400|Ga0134122_11155105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 771 | Open in IMG/M |
| 3300011270|Ga0137391_10456802 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300011271|Ga0137393_11075557 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012198|Ga0137364_11071762 | Not Available | 607 | Open in IMG/M |
| 3300012202|Ga0137363_11054031 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012203|Ga0137399_11539710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012203|Ga0137399_11747324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300012205|Ga0137362_10773222 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012206|Ga0137380_10278546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1502 | Open in IMG/M |
| 3300012207|Ga0137381_11464117 | Not Available | 575 | Open in IMG/M |
| 3300012211|Ga0137377_10386915 | Not Available | 1336 | Open in IMG/M |
| 3300012212|Ga0150985_121854802 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 616 | Open in IMG/M |
| 3300012351|Ga0137386_10901185 | Not Available | 633 | Open in IMG/M |
| 3300012685|Ga0137397_10334368 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012917|Ga0137395_10885633 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012922|Ga0137394_10473576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300012930|Ga0137407_10099041 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300012930|Ga0137407_10482592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300012930|Ga0137407_12268927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300012944|Ga0137410_10198020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1554 | Open in IMG/M |
| 3300012944|Ga0137410_10296433 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300012944|Ga0137410_11038465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300013100|Ga0157373_11442060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK412 | 524 | Open in IMG/M |
| 3300014168|Ga0181534_10017933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 3606 | Open in IMG/M |
| 3300017792|Ga0163161_12006973 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300018013|Ga0187873_1135033 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300018034|Ga0187863_10265208 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300018044|Ga0187890_10225305 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300018052|Ga0184638_1245832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 617 | Open in IMG/M |
| 3300018429|Ga0190272_12260168 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020034|Ga0193753_10001814 | All Organisms → cellular organisms → Bacteria | 17706 | Open in IMG/M |
| 3300020061|Ga0193716_1066403 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300020170|Ga0179594_10007150 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
| 3300020581|Ga0210399_10009911 | All Organisms → cellular organisms → Bacteria | 7450 | Open in IMG/M |
| 3300020582|Ga0210395_11302833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia solitsugae | 532 | Open in IMG/M |
| 3300020583|Ga0210401_11612516 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021073|Ga0210378_10214676 | Not Available | 733 | Open in IMG/M |
| 3300021181|Ga0210388_11471870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 570 | Open in IMG/M |
| 3300021407|Ga0210383_10745637 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021420|Ga0210394_10878052 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300021432|Ga0210384_11615397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 554 | Open in IMG/M |
| 3300021433|Ga0210391_10517745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300021433|Ga0210391_11443062 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300022557|Ga0212123_10399985 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300022557|Ga0212123_10567268 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300022694|Ga0222623_10349542 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300022712|Ga0242653_1003402 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300023030|Ga0224561_1004352 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300024288|Ga0179589_10377563 | Not Available | 647 | Open in IMG/M |
| 3300025910|Ga0207684_10712755 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300025910|Ga0207684_11571897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300025916|Ga0207663_10219810 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300025935|Ga0207709_10252353 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300026330|Ga0209473_1093990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1255 | Open in IMG/M |
| 3300026361|Ga0257176_1047182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
| 3300026557|Ga0179587_10279867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1072 | Open in IMG/M |
| 3300026557|Ga0179587_10766992 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027692|Ga0209530_1175365 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027729|Ga0209248_10033541 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300027889|Ga0209380_10104409 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300027889|Ga0209380_10454243 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300027895|Ga0209624_10738580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 648 | Open in IMG/M |
| 3300027895|Ga0209624_10764379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 636 | Open in IMG/M |
| 3300028047|Ga0209526_10045196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3098 | Open in IMG/M |
| 3300028381|Ga0268264_11015811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 836 | Open in IMG/M |
| 3300028906|Ga0308309_10237436 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300030760|Ga0265762_1004813 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
| 3300030760|Ga0265762_1018348 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300030813|Ga0265750_1079519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 544 | Open in IMG/M |
| 3300031234|Ga0302325_12471091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 621 | Open in IMG/M |
| 3300031525|Ga0302326_12000721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 749 | Open in IMG/M |
| 3300031715|Ga0307476_10147749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia phenazinium | 1686 | Open in IMG/M |
| 3300031715|Ga0307476_10647638 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031718|Ga0307474_10801034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 745 | Open in IMG/M |
| 3300031740|Ga0307468_100592086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 903 | Open in IMG/M |
| 3300031740|Ga0307468_101074937 | Not Available | 715 | Open in IMG/M |
| 3300031740|Ga0307468_101462623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300031754|Ga0307475_10922186 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031820|Ga0307473_10612847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 753 | Open in IMG/M |
| 3300031823|Ga0307478_10731817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 828 | Open in IMG/M |
| 3300031852|Ga0307410_10940318 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031962|Ga0307479_11364732 | Not Available | 668 | Open in IMG/M |
| 3300031962|Ga0307479_11781406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 568 | Open in IMG/M |
| 3300032180|Ga0307471_100492244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1373 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1003974142 | 3300000955 | Soil | MKNARGLLEEFTAASFRDPKEAAAMFTEDGAFEMPYLE |
| JGI1027J12803_1039995531 | 3300000955 | Soil | MSMKNAKELMLEFTASSFRDPQKAAEMFAEDGAFEMPYLASFGVPSEYK |
| JGI1027J12803_1092708391 | 3300000955 | Soil | MKNARQLLEEFIATSFRHPKQAASMFTTDGTFEMPYLED |
| JGI12664J13189_10088941 | 3300001082 | Forest Soil | MKNAKELMLEYTAYSFRDPKKAAEMFAENGAFELP |
| JGI12627J18819_104138021 | 3300001867 | Forest Soil | MKNARQLLEEFIATSFRDPKQAASMFTADVTFEMPYLENLGFRPVDR |
| JGI25615J43890_10041862 | 3300002910 | Grasslands Soil | MKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGLQPIYRG* |
| JGI25386J43895_100943102 | 3300002912 | Grasslands Soil | MKNAKELLEEFTAASFRDPKKAAEMFAEDGAFEMPYLESL |
| Ga0062592_1008568602 | 3300004480 | Soil | MKNAKELLLEFTAFSLRDLEKAAAMFGEEGAFEMPYLEGLGVQGR* |
| Ga0070690_1008120681 | 3300005330 | Switchgrass Rhizosphere | MKNAKELLEEYTATSFRDPKKAAEMFSEDGAFEMPYLESFGMP |
| Ga0070668_1014569011 | 3300005347 | Switchgrass Rhizosphere | MKSARELLEEFTAASFRDPKKAAEMFTEHGAFEMPYLESLGV |
| Ga0070709_108027332 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATF |
| Ga0070731_101448873 | 3300005538 | Surface Soil | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATF |
| Ga0070731_105647072 | 3300005538 | Surface Soil | MKNARELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATF |
| Ga0070733_107168841 | 3300005541 | Surface Soil | MKNAKELMIEYTAFSLREPKKAAEMFAEDGAFELPYLA |
| Ga0066691_108255731 | 3300005586 | Soil | MSRKNAKELMLEFIAFSFRDTKKAAEMFAEDGAFEM |
| Ga0070761_109190822 | 3300005591 | Soil | MKNARELMLEYTAFSLRDPKKAAEMFAEDGAFELPYLA |
| Ga0068860_1006079393 | 3300005843 | Switchgrass Rhizosphere | MKNARELLEEFTGTSFRDPRKAAEMFAEDGAFEMP |
| Ga0070766_112341002 | 3300005921 | Soil | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATFG |
| Ga0070717_114823412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNAKELMLGYTAFSFREPKKAAEMFAEDGAFELPYLATFG |
| Ga0068871_1005655361 | 3300006358 | Miscanthus Rhizosphere | MKNAKELMLEYTAFSFREPKKAAEMFADDGAFELPYLATFGL |
| Ga0066659_112068831 | 3300006797 | Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESVGVP |
| Ga0075428_1014400831 | 3300006844 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFG |
| Ga0075431_1015899281 | 3300006847 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYE |
| Ga0073928_100723684 | 3300006893 | Iron-Sulfur Acid Spring | MKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPYLATFG* |
| Ga0075419_112380531 | 3300006969 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGIPG |
| Ga0099791_101987522 | 3300007255 | Vadose Zone Soil | MKTAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYEG |
| Ga0099829_105866922 | 3300009038 | Vadose Zone Soil | MARNRRIAMKNAKELMLEYTAFSIRDPKKAAEMFAEDGAFEM |
| Ga0111539_124439662 | 3300009094 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGIPGRY |
| Ga0114129_110182383 | 3300009147 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFGIPGRYE |
| Ga0111538_101530301 | 3300009156 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFGLPGRYEGR |
| Ga0111538_114599961 | 3300009156 | Populus Rhizosphere | MKNAKELLEEFTAASFRDPKEAAEMFTEDGAFEMPYLESLG |
| Ga0075423_129957212 | 3300009162 | Populus Rhizosphere | MKNARELLEEFTATSFRDPKKAAEMFADDGAFEMPYLESLGVPG |
| Ga0116106_12672222 | 3300009645 | Peatland | MVRNRRISMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELP |
| Ga0126384_107688722 | 3300010046 | Tropical Forest Soil | LKNARQLLEEFTASSFRDTKKSSEMFAEDGAFEMPY |
| Ga0127484_10690861 | 3300010134 | Grasslands Soil | MKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESVGVPGRYEGREA |
| Ga0134088_104014921 | 3300010304 | Grasslands Soil | MKSAKELLEEFTAASFRDPKKAAQMFTKDGAFEMPYLESLGVP |
| Ga0134122_111551051 | 3300010400 | Terrestrial Soil | MKNARELLEEFTASSFRDPKKAAEMFAEDGAFEMPY |
| Ga0137391_104568022 | 3300011270 | Vadose Zone Soil | MKKAKELMLEFTALAIRDPQKTAEMFTKDGAFEMPYLAAFGYPTQYKGHEA |
| Ga0137393_110755571 | 3300011271 | Vadose Zone Soil | MKNARELLEEFTAASFRDPKKAAEMFTDDGAFEMP |
| Ga0137364_110717621 | 3300012198 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMP* |
| Ga0137363_110540311 | 3300012202 | Vadose Zone Soil | MVRNRRRSMKNAKELMLEYTAFSLRDPKKAAEMFVEDGAFE |
| Ga0137399_115397102 | 3300012203 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFG |
| Ga0137399_117473241 | 3300012203 | Vadose Zone Soil | MEEGSHMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLE |
| Ga0137362_107732221 | 3300012205 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYEGREAIEG |
| Ga0137380_102785461 | 3300012206 | Vadose Zone Soil | MSMKNAKELMLEFTASSFKDPKQAAEMFAEDGAFEMPYLATF |
| Ga0137381_114641171 | 3300012207 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAEMFTDDGAFEMPYLESFGIPGR |
| Ga0137377_103869151 | 3300012211 | Vadose Zone Soil | MKNARLLLEEFIATSFRDPKQAASMFTAGGTFEIPYLE |
| Ga0150985_1218548021 | 3300012212 | Avena Fatua Rhizosphere | MKNARELLEEFTAASFRDPKKAAEMFTEGGAFEMPYLESVGLPGRKK |
| Ga0137386_109011851 | 3300012351 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLE |
| Ga0137397_103343683 | 3300012685 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKSAEMFTEDGAFEMPYLESFGFPGRYEG |
| Ga0137395_108856331 | 3300012917 | Vadose Zone Soil | MKTAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESVGVPGRYQGRDAIEG |
| Ga0137394_104735763 | 3300012922 | Vadose Zone Soil | MKNAKELLEEFAAASFRDPKKAAEMFSEDGAFEMPYLESF |
| Ga0137407_100990411 | 3300012930 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAKMFTDDGAFEMPY |
| Ga0137407_104825923 | 3300012930 | Vadose Zone Soil | MVRNRRVSMKNTKELMLEYTAFSFRDPKTAAEMFAEDGAF |
| Ga0137407_122689271 | 3300012930 | Vadose Zone Soil | MKNARELLEEFTATSFRDPKKAAEMFTEDGAFEMPYLESLGVP |
| Ga0137410_101980201 | 3300012944 | Vadose Zone Soil | MKNAKELLEEFAAASFRDPKKAAEMFSEDGAFEMPYLESFGLPGRYE |
| Ga0137410_102964332 | 3300012944 | Vadose Zone Soil | MKNARELLEEFTASSFRDPKKAAEMFAEDGAFEIPYLESVGVPGRY |
| Ga0137410_110384653 | 3300012944 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFGLPGRYE |
| Ga0157373_114420601 | 3300013100 | Corn Rhizosphere | MKNAKELMLEFTASSFRNPQKAAEMFAEDGAFEMPYLAS |
| Ga0181534_100179336 | 3300014168 | Bog | MKNARQLLEEFTAGSFRDPQQAAAMFAEDGVLEMP* |
| Ga0163161_120069731 | 3300017792 | Switchgrass Rhizosphere | MKGSQMKNAKELLEEFTAASFRDPKQAAEMFTEDGAFEMPYLESFGIPGRY |
| Ga0187873_11350331 | 3300018013 | Peatland | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLST |
| Ga0187863_102652081 | 3300018034 | Peatland | MKNAKELMLEYTAYSFRDPKKAAEMFAENGAFELPYLAT |
| Ga0187890_102253052 | 3300018044 | Peatland | MKNAKELMLEYTALSFKDPKRAAEMFTEDGAFEMPYLAALGL |
| Ga0184638_12458322 | 3300018052 | Groundwater Sediment | MKNAKELLEEFTAASFRDPKKAAEMFADDGAFEMPYLES |
| Ga0190272_122601682 | 3300018429 | Soil | MKGSHMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEIPYLESVG |
| Ga0193753_100018141 | 3300020034 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMPYLATFG |
| Ga0193716_10664033 | 3300020061 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMSYLATF |
| Ga0179594_100071501 | 3300020170 | Vadose Zone Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPY |
| Ga0210399_1000991112 | 3300020581 | Soil | MKNAKELMLEFTASSFRDPQKAAEMFAEDGAFEMPY |
| Ga0210395_113028332 | 3300020582 | Soil | MKNAKELTLECTAFSFRDPKKAAEMFAEDGAFELPYLATWGDPLR |
| Ga0210401_116125162 | 3300020583 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYRATFGLPTEYR |
| Ga0210378_102146762 | 3300021073 | Groundwater Sediment | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFG |
| Ga0210388_114718701 | 3300021181 | Soil | MKNARELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATFGL |
| Ga0210383_107456371 | 3300021407 | Soil | MKNAKELMLEYTAFSFREPKKAVAMFAEDGAFELPYLATFG |
| Ga0210394_108780522 | 3300021420 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFTADGAFEMPYLASFGLPP |
| Ga0210384_116153971 | 3300021432 | Soil | MKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYL |
| Ga0210391_105177453 | 3300021433 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLA |
| Ga0210391_114430622 | 3300021433 | Soil | MKNAKELMLEYTVFSFRDPKKAAEMFAEDGAFELPYLATFEIG |
| Ga0212123_103999852 | 3300022557 | Iron-Sulfur Acid Spring | MKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGFQPIYR |
| Ga0212123_105672682 | 3300022557 | Iron-Sulfur Acid Spring | MKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPYLAT |
| Ga0222623_103495421 | 3300022694 | Groundwater Sediment | MKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYL |
| Ga0242653_10034023 | 3300022712 | Soil | MKNAKELMLEYTASSIRDPKKAAEMFAEDGAFEMPYLTTFGI |
| Ga0224561_10043521 | 3300023030 | Soil | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLAT |
| Ga0179589_103775632 | 3300024288 | Vadose Zone Soil | MKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGLQPIYRG |
| Ga0207684_107127552 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNARQLLEEFIATSFRDPKQAASMFTADGTFEMADLED |
| Ga0207684_115718972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNARELLEEFTSASFRDPKKAAEMFTEDGAFEMPYLESLDVPGRY |
| Ga0207663_102198103 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNAKELMLEYTGFSLRDPKKAAEMFAEDGAFELPYLAT |
| Ga0207709_102523534 | 3300025935 | Miscanthus Rhizosphere | MKNAKELLEEFTAASFRDPKEAAEMFTEDGAFEMPYL |
| Ga0209473_10939901 | 3300026330 | Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLES |
| Ga0257176_10471821 | 3300026361 | Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYL |
| Ga0179587_102798672 | 3300026557 | Vadose Zone Soil | MKNARELLEEFTASSFRDPKKAAEMFAEDGAFEMPYLESV |
| Ga0179587_107669922 | 3300026557 | Vadose Zone Soil | MKSAKELLEEFTASSFRDPRKAAEMVIEDGAFEMPYLESFGIPGRYERS |
| Ga0209530_11753651 | 3300027692 | Forest Soil | MKTAKELMLEYTAYSFRDPKKAAEMFAEDGAFEMP |
| Ga0209248_100335413 | 3300027729 | Bog Forest Soil | MKNAKELMLEYTAFSFKDPKTAAEMFAEDGAFELPYLAT |
| Ga0209380_101044091 | 3300027889 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFGEDGAFELPYLATF |
| Ga0209380_104542432 | 3300027889 | Soil | MKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMPYLASFGLPPR |
| Ga0209624_107385801 | 3300027895 | Forest Soil | MKNAKELMLEYTAFSFGNPKKAAEMFAEDGAFELPY |
| Ga0209624_107643793 | 3300027895 | Forest Soil | MKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPI |
| Ga0209526_100451963 | 3300028047 | Forest Soil | MKNARQLLEEFIATSFRDAKQAASMFTADGTFEMPYL |
| Ga0268264_110158111 | 3300028381 | Switchgrass Rhizosphere | MKNARELLEEFTGTSFRDPRKAAEMFAEDGAFEMPYLE |
| Ga0308309_102374363 | 3300028906 | Soil | MKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYLAT |
| Ga0265762_10048136 | 3300030760 | Soil | LEYTAFSFRDLKKAAEMFAEDGAFELPYLATFGLPTQYRG |
| Ga0265762_10183483 | 3300030760 | Soil | MKNAKELMLEYSAFSFRDPKKAAEMFAEDGAFELPYLATF |
| Ga0265750_10795192 | 3300030813 | Soil | MKNAKELMLEYSAFSFRDPKKAAEMFAEDGAFELPYLATFG |
| Ga0302325_124710912 | 3300031234 | Palsa | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYL |
| Ga0302326_120007211 | 3300031525 | Palsa | MKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPY |
| Ga0307476_101477493 | 3300031715 | Hardwood Forest Soil | MKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATFG |
| Ga0307476_106476382 | 3300031715 | Hardwood Forest Soil | VKKAKELMLEFTALAIKDPQKTAEMFTEDGAFEMPYLAAFGYPTQYK |
| Ga0307474_108010341 | 3300031718 | Hardwood Forest Soil | MKNARELMIEYTAFSLRDPKKAAEMFAEDGAFELPYLATFG |
| Ga0307468_1005920861 | 3300031740 | Hardwood Forest Soil | MKTARELREEFTAASFRDPRKAAEMFTEHGAFEMPYL |
| Ga0307468_1010749372 | 3300031740 | Hardwood Forest Soil | MKNARALLEEFTAASFRDPKKAAEMFTEDGAFEMPYL |
| Ga0307468_1014626231 | 3300031740 | Hardwood Forest Soil | MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFGSPGRYEG |
| Ga0307475_109221864 | 3300031754 | Hardwood Forest Soil | MTNARHILEEFTASLFVDPKKAAKCLLQDGAFEMPYLD |
| Ga0307473_106128472 | 3300031820 | Hardwood Forest Soil | MKDARVLLEEFTAASFRDPKKAAEMFSEDGAFEMPY |
| Ga0307478_107318173 | 3300031823 | Hardwood Forest Soil | MKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYLATF |
| Ga0307410_109403181 | 3300031852 | Rhizosphere | MKNAKELLEEFTAASFRDPKQAAEMFTEDGAFEMPYLESFG |
| Ga0307479_113647321 | 3300031962 | Hardwood Forest Soil | MTNARQILEEFTASSFLDPKKAAKCLLQDGAFEMPYLDSLRFPWRYGNN |
| Ga0307479_117814061 | 3300031962 | Hardwood Forest Soil | VKKAKELMLEFTALAIKDPQKTAEMFTEDGAFEMPYLAAFGYPTQYKGQEA |
| Ga0307471_1004922442 | 3300032180 | Hardwood Forest Soil | MKNAKDLLEEFTASSFRDPKKAAEMFTEDGAFEMPYLESFGFPGRYAGREA |
| ⦗Top⦘ |