


| Basic Information | |
|---|---|
| Family ID | F073581 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.64 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 82.50 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (39.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 13.33 |
| PF00959 | Phage_lysozyme | 4.17 |
| PF11351 | GTA_holin_3TM | 1.67 |
| PF00211 | Guanylate_cyc | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.00 % |
| All Organisms | root | All Organisms | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10263764 | Not Available | 519 | Open in IMG/M |
| 3300002482|JGI25127J35165_1033798 | Not Available | 1162 | Open in IMG/M |
| 3300002483|JGI25132J35274_1074415 | Not Available | 708 | Open in IMG/M |
| 3300004097|Ga0055584_101438146 | Not Available | 716 | Open in IMG/M |
| 3300004457|Ga0066224_1036065 | Not Available | 698 | Open in IMG/M |
| 3300004829|Ga0068515_122819 | Not Available | 782 | Open in IMG/M |
| 3300006025|Ga0075474_10120877 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 835 | Open in IMG/M |
| 3300006027|Ga0075462_10062666 | Not Available | 1175 | Open in IMG/M |
| 3300006027|Ga0075462_10123596 | Not Available | 798 | Open in IMG/M |
| 3300006027|Ga0075462_10194895 | Not Available | 610 | Open in IMG/M |
| 3300006403|Ga0075514_1892699 | All Organisms → cellular organisms → Eukaryota | 1314 | Open in IMG/M |
| 3300006793|Ga0098055_1081954 | Not Available | 1269 | Open in IMG/M |
| 3300006867|Ga0075476_10244371 | Not Available | 641 | Open in IMG/M |
| 3300006868|Ga0075481_10103280 | Not Available | 1057 | Open in IMG/M |
| 3300006868|Ga0075481_10269891 | Not Available | 597 | Open in IMG/M |
| 3300006870|Ga0075479_10189885 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300006874|Ga0075475_10169378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 949 | Open in IMG/M |
| 3300006916|Ga0070750_10206058 | Not Available | 869 | Open in IMG/M |
| 3300006916|Ga0070750_10297298 | Not Available | 691 | Open in IMG/M |
| 3300006919|Ga0070746_10420001 | Not Available | 597 | Open in IMG/M |
| 3300006920|Ga0070748_1030671 | Not Available | 2207 | Open in IMG/M |
| 3300007346|Ga0070753_1228374 | Not Available | 681 | Open in IMG/M |
| 3300007539|Ga0099849_1115793 | Not Available | 1058 | Open in IMG/M |
| 3300008012|Ga0075480_10430761 | Not Available | 645 | Open in IMG/M |
| 3300009000|Ga0102960_1332096 | Not Available | 536 | Open in IMG/M |
| 3300009001|Ga0102963_1049197 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1746 | Open in IMG/M |
| 3300009001|Ga0102963_1242679 | Not Available | 714 | Open in IMG/M |
| 3300009136|Ga0118735_10280549 | Not Available | 567 | Open in IMG/M |
| 3300010149|Ga0098049_1081233 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1020 | Open in IMG/M |
| 3300010149|Ga0098049_1117370 | Not Available | 828 | Open in IMG/M |
| 3300010153|Ga0098059_1142942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 944 | Open in IMG/M |
| 3300010296|Ga0129348_1122386 | Not Available | 909 | Open in IMG/M |
| 3300010316|Ga0136655_1085562 | Not Available | 959 | Open in IMG/M |
| 3300011118|Ga0114922_10295347 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1354 | Open in IMG/M |
| 3300011118|Ga0114922_11668127 | Not Available | 511 | Open in IMG/M |
| 3300011252|Ga0151674_1071679 | Not Available | 631 | Open in IMG/M |
| 3300017697|Ga0180120_10435180 | Not Available | 512 | Open in IMG/M |
| 3300017710|Ga0181403_1051825 | Not Available | 858 | Open in IMG/M |
| 3300017739|Ga0181433_1022872 | Not Available | 1654 | Open in IMG/M |
| 3300017744|Ga0181397_1018060 | Not Available | 2097 | Open in IMG/M |
| 3300017744|Ga0181397_1070929 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 939 | Open in IMG/M |
| 3300017748|Ga0181393_1102838 | Not Available | 734 | Open in IMG/M |
| 3300017758|Ga0181409_1097845 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 876 | Open in IMG/M |
| 3300017768|Ga0187220_1068937 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1064 | Open in IMG/M |
| 3300017772|Ga0181430_1177446 | Not Available | 613 | Open in IMG/M |
| 3300017950|Ga0181607_10215387 | Not Available | 1121 | Open in IMG/M |
| 3300017950|Ga0181607_10440751 | Not Available | 704 | Open in IMG/M |
| 3300018036|Ga0181600_10338116 | Not Available | 746 | Open in IMG/M |
| 3300018415|Ga0181559_10739236 | Not Available | 526 | Open in IMG/M |
| 3300018421|Ga0181592_11090657 | Not Available | 510 | Open in IMG/M |
| 3300018424|Ga0181591_10740904 | Not Available | 688 | Open in IMG/M |
| 3300018876|Ga0181564_10435108 | Not Available | 710 | Open in IMG/M |
| 3300019459|Ga0181562_10188292 | Not Available | 1091 | Open in IMG/M |
| 3300019703|Ga0194021_1009112 | Not Available | 848 | Open in IMG/M |
| 3300019707|Ga0193989_1018051 | Not Available | 759 | Open in IMG/M |
| 3300019737|Ga0193973_1005676 | Not Available | 1144 | Open in IMG/M |
| 3300019744|Ga0193998_1082872 | Not Available | 512 | Open in IMG/M |
| 3300020053|Ga0181595_10139167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 1130 | Open in IMG/M |
| 3300020191|Ga0181604_10152315 | Not Available | 1170 | Open in IMG/M |
| 3300020191|Ga0181604_10177782 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1052 | Open in IMG/M |
| 3300021373|Ga0213865_10113558 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300021425|Ga0213866_10090645 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1676 | Open in IMG/M |
| 3300021958|Ga0222718_10071207 | Not Available | 2124 | Open in IMG/M |
| 3300021958|Ga0222718_10170979 | Not Available | 1209 | Open in IMG/M |
| 3300021959|Ga0222716_10402881 | Not Available | 794 | Open in IMG/M |
| 3300021960|Ga0222715_10256212 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1015 | Open in IMG/M |
| 3300022050|Ga0196883_1006710 | Not Available | 1344 | Open in IMG/M |
| 3300022050|Ga0196883_1040158 | Not Available | 569 | Open in IMG/M |
| 3300022071|Ga0212028_1020591 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1152 | Open in IMG/M |
| 3300022158|Ga0196897_1025156 | Not Available | 722 | Open in IMG/M |
| 3300022158|Ga0196897_1046667 | Not Available | 513 | Open in IMG/M |
| 3300022178|Ga0196887_1113155 | Not Available | 592 | Open in IMG/M |
| 3300022183|Ga0196891_1079514 | Not Available | 582 | Open in IMG/M |
| 3300022187|Ga0196899_1122325 | Not Available | 748 | Open in IMG/M |
| 3300022308|Ga0224504_10104864 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300022922|Ga0255779_1029816 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10291999 | Not Available | 565 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10499019 | Not Available | 589 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10252094 | Not Available | 709 | Open in IMG/M |
| 3300025070|Ga0208667_1011887 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1941 | Open in IMG/M |
| 3300025083|Ga0208791_1009386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2365 | Open in IMG/M |
| 3300025083|Ga0208791_1013331 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1846 | Open in IMG/M |
| 3300025083|Ga0208791_1028225 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1078 | Open in IMG/M |
| 3300025110|Ga0208158_1014578 | Not Available | 2109 | Open in IMG/M |
| 3300025127|Ga0209348_1060941 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1243 | Open in IMG/M |
| 3300025508|Ga0208148_1012637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2546 | Open in IMG/M |
| 3300025610|Ga0208149_1046525 | Not Available | 1135 | Open in IMG/M |
| 3300025610|Ga0208149_1076015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 833 | Open in IMG/M |
| 3300025645|Ga0208643_1003468 | Not Available | 7418 | Open in IMG/M |
| 3300025652|Ga0208134_1088530 | Not Available | 880 | Open in IMG/M |
| 3300025655|Ga0208795_1110811 | Not Available | 724 | Open in IMG/M |
| 3300025671|Ga0208898_1038386 | All Organisms → Viruses | 1864 | Open in IMG/M |
| 3300025674|Ga0208162_1055952 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1302 | Open in IMG/M |
| 3300025687|Ga0208019_1058536 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1303 | Open in IMG/M |
| 3300025759|Ga0208899_1124936 | Not Available | 918 | Open in IMG/M |
| 3300025803|Ga0208425_1059869 | Not Available | 936 | Open in IMG/M |
| 3300025803|Ga0208425_1108233 | Not Available | 643 | Open in IMG/M |
| 3300025806|Ga0208545_1009560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3570 | Open in IMG/M |
| 3300025816|Ga0209193_1122351 | Not Available | 628 | Open in IMG/M |
| 3300025889|Ga0208644_1270444 | Not Available | 692 | Open in IMG/M |
| 3300026187|Ga0209929_1164564 | Not Available | 533 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10290101 | Not Available | 590 | Open in IMG/M |
| 3300032088|Ga0315321_10744091 | Not Available | 563 | Open in IMG/M |
| 3300032277|Ga0316202_10091976 | Not Available | 1405 | Open in IMG/M |
| 3300032373|Ga0316204_10039197 | Not Available | 4545 | Open in IMG/M |
| 3300033742|Ga0314858_189402 | Not Available | 528 | Open in IMG/M |
| 3300034374|Ga0348335_021687 | Not Available | 3066 | Open in IMG/M |
| 3300034374|Ga0348335_136930 | Not Available | 694 | Open in IMG/M |
| 3300034375|Ga0348336_124928 | Not Available | 814 | Open in IMG/M |
| 3300034418|Ga0348337_193279 | Not Available | 516 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 39.17% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.17% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.33% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.33% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.50% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.50% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.67% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.67% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.83% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.83% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.83% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.83% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001828 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300019707 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MG | Environmental | Open in IMG/M |
| 3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
| 3300019744 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102637642 | 3300000116 | Marine | MSITHEEVVNAAEAERILNSPVFKEAIENLKNEYITYWLNS |
| ACM3_10169993 | 3300001828 | Marine Plankton | MSITHEEAVKAEQAQQILNSEIFKEVLENLKQTYID |
| JGI25127J35165_10337981 | 3300002482 | Marine | MAISHEEVVKAAQAEQILESDVFKEAIENLKNEYVTHWLNLRNIDD |
| JGI25132J35274_10744151 | 3300002483 | Marine | MPTHKEVVKAAEAEKILESDVFQEAMQSLKDEYMQAWLNSKNPD |
| Ga0055584_1014381462 | 3300004097 | Pelagic Marine | MSITHEEVVNAAEAERILNSPVFKEAIENLKNEYITHWLNS |
| Ga0066224_10360652 | 3300004457 | Marine | MSVSHDEVLKAAQAEQLLTSDVFKEAIENLKNEYITHWLNS |
| Ga0068515_1228191 | 3300004829 | Marine Water | MSVSHEEVVKAAQAEQILTSDVFKEAIENLKNEYITHWLNSRDISD |
| Ga0075474_101208772 | 3300006025 | Aqueous | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSR |
| Ga0075462_100626661 | 3300006027 | Aqueous | MAVTHEEAVKAEQARLLLESDVFKEAVENLKNEYITHWLNSR |
| Ga0075462_101235961 | 3300006027 | Aqueous | MSVTHEEVVKAAQAEQILNSDTFQEAIENLKNEYITHWLNLR |
| Ga0075462_101948951 | 3300006027 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRG |
| Ga0075514_18926991 | 3300006403 | Aqueous | MSVSHEEVVKAAQAEQILTSEVFKEAVENLKNEYI |
| Ga0098055_10819541 | 3300006793 | Marine | MAVSQEDVIKAAQAEQILTSDVFKEALENLKNEYITHWLNSRD |
| Ga0075476_102443712 | 3300006867 | Aqueous | MSTTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0075481_101032801 | 3300006868 | Aqueous | MAISHEEVVKAAQAEQLLTSDVFKEAIENLKNEYITHWLNS |
| Ga0075481_102698912 | 3300006868 | Aqueous | MSITHEEAVQAEQAEILLKSDVFKNAMENLKNEYITH |
| Ga0075479_101898851 | 3300006870 | Aqueous | MSITHEEAVQAEQAEILLKSDVFKNAMENLKNEYITHWLNSRD |
| Ga0075475_101693781 | 3300006874 | Aqueous | MSVSHEEVVKAAQAEQILESDVFKEAIENLKNEYV |
| Ga0070750_102060582 | 3300006916 | Aqueous | MAISQDDVLKAAQAEQLLTSDVFKEAIENLKNEYITHW |
| Ga0070750_102972982 | 3300006916 | Aqueous | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRG |
| Ga0070746_104200013 | 3300006919 | Aqueous | MSITHEEVVKAAQAEQILESDVFKEAIENLKNEYITHWL |
| Ga0070748_10306715 | 3300006920 | Aqueous | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINS |
| Ga0070753_12283741 | 3300007346 | Aqueous | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYI |
| Ga0099849_11157932 | 3300007539 | Aqueous | MSVSHEEVVKAAQAEQILTSDVFKEAIENLKNEYITHWLNS |
| Ga0099849_12876631 | 3300007539 | Aqueous | MITHEEAVKAEQAQQILNSEIFKEVLENLKQSYIDAWLKD |
| Ga0075480_104307611 | 3300008012 | Aqueous | MSVTHEETVKAAEAERILNSDVFKEAIENLKNEYITHWLNSR |
| Ga0102960_13320962 | 3300009000 | Pond Water | MSVTHEEAVKAAEAQRILDSDVFKEAVDNIKQEYIFHWLNSRGI |
| Ga0102963_10491972 | 3300009001 | Pond Water | MAISHEEVVKAAQAEQILTSEVFKEAVENLKNEYI |
| Ga0102963_12426791 | 3300009001 | Pond Water | MSVTHEEAVKAAEAERILNSDVFKEAIENLKNEYITHW |
| Ga0118735_102805491 | 3300009136 | Marine Sediment | MSVSHEEVVKAAQAEQILTSEVFKEAVENLKNEYITHW |
| Ga0098049_10812331 | 3300010149 | Marine | MSVSHEEVVKAAQAEQILTSEVFKEALENLKNEYITHWLN |
| Ga0098049_11173702 | 3300010149 | Marine | MAISQDDVLKAAQAEQLLTSDVFKEAIENLKNEYITH |
| Ga0098059_11429424 | 3300010153 | Marine | MSVTHEEVVKAAQAEQILTSEVFKEAIENLKKEYINHWLG |
| Ga0129348_11223863 | 3300010296 | Freshwater To Marine Saline Gradient | MSVTHEETVKAAEAERILNSDVFKEAIENLKNEYITHW |
| Ga0136655_10855621 | 3300010316 | Freshwater To Marine Saline Gradient | MSITHEEVIKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0114922_102953473 | 3300011118 | Deep Subsurface | MSVSHDEVLKAAQAEQLLTSDVFKEAIENLKNEYIT |
| Ga0114922_116681271 | 3300011118 | Deep Subsurface | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWLNSREID |
| Ga0151674_10716792 | 3300011252 | Marine | MSVTHEEVVKAAQAEQILTSDVFKEAIENLKQDRKS |
| Ga0180120_104351802 | 3300017697 | Freshwater To Marine Saline Gradient | MAVTHEEAVKAEQARLLLESDVFKEATENLKNEYITHWLNSR |
| Ga0181403_10518252 | 3300017710 | Seawater | MSVTHEEAVKAEQAQQILNSDVFKEAVENLKNEYITHWL |
| Ga0181433_10228721 | 3300017739 | Seawater | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSRRPEDVQA |
| Ga0181397_10180601 | 3300017744 | Seawater | MSVTHEEAVKAEQARLLLESDVFKEATENLKNEYITHWLNS |
| Ga0181397_10709291 | 3300017744 | Seawater | MSVTHEEAVKAEQAQQILNSDVFKEAVENLKNEYITHWLNS |
| Ga0181393_11028382 | 3300017748 | Seawater | MSVTHEEVVKAAQAEQILTSDVFKEAVENLKQEYITHWLN |
| Ga0181409_10978453 | 3300017758 | Seawater | MSVTHEEAVKAEQAQQILNSDVFKEAVENLKNEYI |
| Ga0187220_10689371 | 3300017768 | Seawater | MSVTHEEAVKAEQAQQILNSDVFKEAIENLKNEYITYWLN |
| Ga0181430_11774462 | 3300017772 | Seawater | MSVTHEEAVKAEQAQQILNSDVFKEAIENLKNEYITYWL |
| Ga0181607_102153872 | 3300017950 | Salt Marsh | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGI |
| Ga0181607_104407511 | 3300017950 | Salt Marsh | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHW |
| Ga0181600_103381162 | 3300018036 | Salt Marsh | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYIT |
| Ga0181559_107392361 | 3300018415 | Salt Marsh | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYI |
| Ga0181592_110906571 | 3300018421 | Salt Marsh | MSITHDEAVKAAQAEQILTSDVFKEAIENLKNEYITH |
| Ga0181593_102686591 | 3300018423 | Salt Marsh | MVTHEEAVKAEQAQQILNSEIFKEVLENLKQTYIDA |
| Ga0181591_107409042 | 3300018424 | Salt Marsh | MSVSHEEVVKAAQAEQILTSDVFKEAIENLKNEYITHWL |
| Ga0181591_108451142 | 3300018424 | Salt Marsh | MPTHEEIVKAEQAQQILNSEIFKEVLENLKQTYIEAWLK |
| Ga0181568_105651211 | 3300018428 | Salt Marsh | MSITHEEAVKAEQAQQILNSEIFKEVLENLKQSYIEA |
| Ga0181564_104351081 | 3300018876 | Salt Marsh | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSR |
| Ga0181562_101882922 | 3300019459 | Salt Marsh | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0194021_10091122 | 3300019703 | Sediment | MPTHEEVVKAEQAEQILNSDVFAEVIENLKNEYINFWLN |
| Ga0193989_10180511 | 3300019707 | Sediment | MPTHEEVVKAEQAEQILNSDVFKEVVENLKNEYINFW |
| Ga0193973_10056761 | 3300019737 | Sediment | MSITHEEVVKAAQAEQILESDVFKEAIENLKNEYITHWLNLRNID |
| Ga0193998_10828721 | 3300019744 | Sediment | MSITHEEAVKAAQAEQILDSDIFKEAIENLKNEYVTHWLNLRNIDD |
| Ga0181595_101391674 | 3300020053 | Salt Marsh | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITH |
| Ga0181604_101523151 | 3300020191 | Salt Marsh | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWL |
| Ga0181604_101777821 | 3300020191 | Salt Marsh | MSVSHEEVVKAAQAEQILTSEVFKEAVENLKNEYITHWL |
| Ga0213865_101135581 | 3300021373 | Seawater | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0213864_103110051 | 3300021379 | Seawater | MSITHEEAVKAEQAQQILNSEIFKEVLENLKQTYIDAWLKDQ |
| Ga0213866_100906451 | 3300021425 | Seawater | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWL |
| Ga0222718_100712071 | 3300021958 | Estuarine Water | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGID |
| Ga0222718_101709794 | 3300021958 | Estuarine Water | MSITHEEAVKAAEAERILNSDVFKEAIENLKNEYITYWLNSRGID |
| Ga0222716_104028812 | 3300021959 | Estuarine Water | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITH |
| Ga0222715_102562122 | 3300021960 | Estuarine Water | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWLN |
| Ga0196883_10067101 | 3300022050 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNF |
| Ga0196883_10401583 | 3300022050 | Aqueous | MSVSHEEVVKAAQAEQILESDVFKEAIENLKNEYG |
| Ga0212028_10205911 | 3300022071 | Aqueous | MSVTHEEAVKAAEAQRILDSDVFKEAVENLKQEYIFHWLNS |
| Ga0196897_10251561 | 3300022158 | Aqueous | MSVSHEEVVKAAQAEQILNSDVFKEAIENLKNEYIT |
| Ga0196897_10466671 | 3300022158 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGIDD |
| Ga0196887_11131552 | 3300022178 | Aqueous | MSVTHEEAVKAEQARLLLESDVFKEATENLKNEYITH |
| Ga0196891_10795141 | 3300022183 | Aqueous | MSITHEEAVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0196899_11223251 | 3300022187 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNS |
| Ga0224504_101048641 | 3300022308 | Sediment | MSISHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWLNSREI |
| Ga0255779_102981611 | 3300022922 | Salt Marsh | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITH |
| Ga0255758_100311872 | 3300022928 | Salt Marsh | MAITHEEAVKAEQARLLLESDVFKEAVENLKSNTSRIG |
| (restricted) Ga0255043_102919993 | 3300024338 | Seawater | MSVTHEEVVKAAQAEQILTSEVFKEAIENLKNEYITH |
| (restricted) Ga0255048_104990191 | 3300024518 | Seawater | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSRRPEDV |
| (restricted) Ga0255044_102520941 | 3300024529 | Seawater | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWLNSREI |
| Ga0208667_10118874 | 3300025070 | Marine | MSVSHEEVVKAAQAEQILTSEVFKEALENLKNEYITHWLNSRDI |
| Ga0208791_10093861 | 3300025083 | Marine | MSVTHEEVVKAAEAERILNSPVFKEAIENLKNEYI |
| Ga0208791_10133311 | 3300025083 | Marine | MSVSHEEVVKAAQAEQILTSEVFKEALENLKNEYITHWL |
| Ga0208791_10282252 | 3300025083 | Marine | MSVSHEEVVKAAQAEQILTSEVFKEAVENLKNEYITHWLNS |
| Ga0208158_10145781 | 3300025110 | Marine | MSVTHEEAVKAEQAQQILNSDVFKEAVENLKNEYITHWLNSRNID |
| Ga0209348_10609413 | 3300025127 | Marine | MSITHEEAVKAAQAEAILDSDVFKEALENLKNEYTNIWLNTRD |
| Ga0208148_10126376 | 3300025508 | Aqueous | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSRKPEDIQA |
| Ga0208149_10465252 | 3300025610 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYI |
| Ga0208149_10760151 | 3300025610 | Aqueous | MSVSHEEVVKAAQAEQILESDVFKEAIENLKNEYI |
| Ga0208643_10034681 | 3300025645 | Aqueous | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSRR |
| Ga0208134_10885303 | 3300025652 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWL |
| Ga0208795_11108111 | 3300025655 | Aqueous | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYIT |
| Ga0208898_10383867 | 3300025671 | Aqueous | MSVSHEEVVKAAQAEQILESDVFKEAIENLKNEYVTHW |
| Ga0208898_11589122 | 3300025671 | Aqueous | MPTHEEIVKAEQAQQILNSEIFKEVLENLKQSYIDAWLKDQ |
| Ga0208162_10559521 | 3300025674 | Aqueous | MSVSHEEVVRAAQAEQLLTSDVFKEAIENLKNEYITH |
| Ga0208019_10585363 | 3300025687 | Aqueous | MSITHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGI |
| Ga0208899_11249363 | 3300025759 | Aqueous | MSVTHEETVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGID |
| Ga0208425_10598691 | 3300025803 | Aqueous | MAVTHEEAVKAEQARLLLESDVFKEAVENLKNEYITHWL |
| Ga0208425_11082332 | 3300025803 | Aqueous | MSVSHEEVVKAAQAEQILTSEVFKEAVENLKNEYITHWLN |
| Ga0208545_10095608 | 3300025806 | Aqueous | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSR |
| Ga0209193_11223511 | 3300025816 | Pelagic Marine | MPTHEEVVKAAEAERILESDVFQEALQNLKSEYMQAWINSRRPEDIQA |
| Ga0208645_11744582 | 3300025853 | Aqueous | MVTHEEAVKAEQAQQILNSEIFKEVLENLKQTYIDAWLKD |
| Ga0208645_11874301 | 3300025853 | Aqueous | MSITHEEAVKAEQAQQILNSEIFKEVLENLKQTYIDA |
| Ga0208644_12704441 | 3300025889 | Aqueous | MAISHEEVVKAAQAEQLLTSDVFKEAIENLKNEYITHWLNSRDISD |
| Ga0209929_11645641 | 3300026187 | Pond Water | MSITHEEAVKAAEAERILNSDVFKEAIENLKNEYITHWLNSRGI |
| (restricted) Ga0255041_102901011 | 3300027837 | Seawater | MAVTQEEAVKAEQAQQILDSDVFKEAVENLKQEYIFHWLNSR |
| Ga0315321_107440911 | 3300032088 | Seawater | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHWLNS |
| Ga0316202_100919761 | 3300032277 | Microbial Mat | MSVTHEEVVKAAEAERILNSDVFKEAIENLKNEYITHW |
| Ga0316204_1003919714 | 3300032373 | Microbial Mat | MSVSHEEVVKAAQAEQILTSEVFKEAIENLKNEYITHWLNS |
| Ga0314858_189402_3_110 | 3300033742 | Sea-Ice Brine | MSITHEEVVNAAEAERILNSPVFKEAIENLKNEYIT |
| Ga0348335_021687_2939_3064 | 3300034374 | Aqueous | MAISHEEVVKAAQAEQLLTSDVFKEAIENLKNEYITHWLNSR |
| Ga0348335_136930_574_693 | 3300034374 | Aqueous | MSVTHEETVKAAEAERILNSDVFKEAIENLKNEYITHWLN |
| Ga0348336_124928_701_814 | 3300034375 | Aqueous | MSVSHEEVVKAAQAEQLLTSDVFKEAIENLKNEYITHW |
| Ga0348337_193279_3_128 | 3300034418 | Aqueous | MSVSHEEVVRAAQAEQLLTSDVFKEAIENLKNEYITHWLNSR |
| ⦗Top⦘ |