


| Basic Information | |
|---|---|
| Family ID | F073464 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 8.33 % |
| % of genes near scaffold ends (potentially truncated) | 31.67 % |
| % of genes from short scaffolds (< 2000 bps) | 70.83 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.33% β-sheet: 28.57% Coil/Unstructured: 55.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF04851 | ResIII | 3.33 |
| PF12705 | PDDEXK_1 | 1.67 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.67 |
| PF04965 | GPW_gp25 | 0.83 |
| PF11171 | DUF2958 | 0.83 |
| PF07275 | ArdA | 0.83 |
| PF04984 | Phage_sheath_1 | 0.83 |
| PF12627 | PolyA_pol_RNAbd | 0.83 |
| PF14240 | YHYH | 0.83 |
| PF02086 | MethyltransfD12 | 0.83 |
| PF03692 | CxxCxxCC | 0.83 |
| PF00082 | Peptidase_S8 | 0.83 |
| PF00521 | DNA_topoisoIV | 0.83 |
| PF01844 | HNH | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.83 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.83 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.83 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.83 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.50 % |
| Unclassified | root | N/A | 42.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876023|PC6_p0450151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 807 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10133190 | Not Available | 599 | Open in IMG/M |
| 3300001605|Draft_10176900 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300001748|JGI11772J19994_1019814 | Not Available | 993 | Open in IMG/M |
| 3300001970|GOS2248_10033368 | Not Available | 2315 | Open in IMG/M |
| 3300001970|GOS2248_10075634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1455 | Open in IMG/M |
| 3300004369|Ga0065726_10554 | Not Available | 55604 | Open in IMG/M |
| 3300005512|Ga0074648_1001372 | Not Available | 25794 | Open in IMG/M |
| 3300005512|Ga0074648_1013930 | All Organisms → Viruses → Predicted Viral | 4998 | Open in IMG/M |
| 3300005581|Ga0049081_10006848 | All Organisms → Viruses → Predicted Viral | 4312 | Open in IMG/M |
| 3300005805|Ga0079957_1000157 | Not Available | 56093 | Open in IMG/M |
| 3300005941|Ga0070743_10176510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Shandvirus → Shandvirus sh35 | 705 | Open in IMG/M |
| 3300005943|Ga0073926_10000286 | Not Available | 11082 | Open in IMG/M |
| 3300005992|Ga0073924_1060070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 559 | Open in IMG/M |
| 3300006030|Ga0075470_10070896 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300006639|Ga0079301_1150508 | Not Available | 688 | Open in IMG/M |
| 3300006802|Ga0070749_10161754 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300006867|Ga0075476_10042223 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
| 3300006869|Ga0075477_10412001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 525 | Open in IMG/M |
| 3300007165|Ga0079302_1069391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 772 | Open in IMG/M |
| 3300007538|Ga0099851_1035353 | All Organisms → Viruses → Predicted Viral | 1992 | Open in IMG/M |
| 3300007538|Ga0099851_1147581 | All Organisms → Viruses | 877 | Open in IMG/M |
| 3300007539|Ga0099849_1292037 | Not Available | 590 | Open in IMG/M |
| 3300007539|Ga0099849_1371208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 506 | Open in IMG/M |
| 3300007541|Ga0099848_1088026 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300007541|Ga0099848_1111785 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300007542|Ga0099846_1163477 | Not Available | 797 | Open in IMG/M |
| 3300007603|Ga0102921_1019201 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300007960|Ga0099850_1119569 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300007960|Ga0099850_1241727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 698 | Open in IMG/M |
| 3300008055|Ga0108970_10395296 | All Organisms → Viruses → Predicted Viral | 2271 | Open in IMG/M |
| 3300008107|Ga0114340_1028918 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
| 3300008107|Ga0114340_1207379 | Not Available | 649 | Open in IMG/M |
| 3300008110|Ga0114343_1033287 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300008113|Ga0114346_1100077 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009159|Ga0114978_10012019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6627 | Open in IMG/M |
| 3300009184|Ga0114976_10347589 | Not Available | 784 | Open in IMG/M |
| 3300010293|Ga0116204_1049388 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300010296|Ga0129348_1000735 | All Organisms → Viruses | 11865 | Open in IMG/M |
| 3300010296|Ga0129348_1277143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300010297|Ga0129345_1017625 | All Organisms → Viruses → Predicted Viral | 2777 | Open in IMG/M |
| 3300010297|Ga0129345_1054589 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300010297|Ga0129345_1177578 | Not Available | 762 | Open in IMG/M |
| 3300010299|Ga0129342_1003236 | All Organisms → Viruses | 7237 | Open in IMG/M |
| 3300010299|Ga0129342_1009510 | All Organisms → Viruses → Predicted Viral | 4134 | Open in IMG/M |
| 3300010318|Ga0136656_1210960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 648 | Open in IMG/M |
| 3300010354|Ga0129333_10164217 | All Organisms → Viruses → Predicted Viral | 2033 | Open in IMG/M |
| 3300010354|Ga0129333_10238205 | All Organisms → Viruses → Predicted Viral | 1644 | Open in IMG/M |
| 3300010354|Ga0129333_10555835 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10825723 | Not Available | 570 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10542857 | Not Available | 794 | Open in IMG/M |
| 3300013372|Ga0177922_10341209 | Not Available | 746 | Open in IMG/M |
| 3300017949|Ga0181584_10456961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 791 | Open in IMG/M |
| 3300017987|Ga0180431_10260695 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300018080|Ga0180433_10171803 | All Organisms → Viruses → Predicted Viral | 1788 | Open in IMG/M |
| 3300018420|Ga0181563_10818205 | Not Available | 508 | Open in IMG/M |
| 3300018421|Ga0181592_10251837 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300018682|Ga0188851_1023606 | Not Available | 714 | Open in IMG/M |
| 3300019096|Ga0188835_1011999 | Not Available | 732 | Open in IMG/M |
| 3300020141|Ga0211732_1094969 | Not Available | 612 | Open in IMG/M |
| 3300021364|Ga0213859_10088860 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300021425|Ga0213866_10391607 | Not Available | 679 | Open in IMG/M |
| 3300021961|Ga0222714_10513446 | Not Available | 613 | Open in IMG/M |
| 3300021961|Ga0222714_10571307 | Not Available | 569 | Open in IMG/M |
| 3300021962|Ga0222713_10077248 | All Organisms → Viruses → Predicted Viral | 2442 | Open in IMG/M |
| 3300021962|Ga0222713_10155307 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300021962|Ga0222713_10854450 | Not Available | 503 | Open in IMG/M |
| 3300022190|Ga0181354_1233160 | Not Available | 532 | Open in IMG/M |
| 3300022198|Ga0196905_1181108 | All Organisms → Viruses | 533 | Open in IMG/M |
| 3300022752|Ga0214917_10233185 | Not Available | 874 | Open in IMG/M |
| 3300023176|Ga0255772_10120988 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300024346|Ga0244775_10260159 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300025646|Ga0208161_1047840 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300025655|Ga0208795_1116566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 699 | Open in IMG/M |
| 3300025674|Ga0208162_1121679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 748 | Open in IMG/M |
| 3300025828|Ga0208547_1095318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus | 925 | Open in IMG/M |
| 3300026902|Ga0209851_1007351 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
| 3300027393|Ga0209867_1000190 | Not Available | 14188 | Open in IMG/M |
| 3300027608|Ga0208974_1039227 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
| 3300027608|Ga0208974_1152759 | Not Available | 584 | Open in IMG/M |
| 3300027659|Ga0208975_1008129 | All Organisms → Viruses → Predicted Viral | 3706 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1001236 | Not Available | 42344 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1009568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 9348 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1037503 | Not Available | 3034 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1170998 | Not Available | 907 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1028475 | Not Available | 3680 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1046230 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1240354 | Not Available | 648 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1323108 | Not Available | 512 | Open in IMG/M |
| 3300027734|Ga0209087_1338665 | Not Available | 523 | Open in IMG/M |
| 3300027759|Ga0209296_1000840 | Not Available | 25522 | Open in IMG/M |
| 3300027763|Ga0209088_10007845 | Not Available | 5901 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1085430 | Not Available | 1614 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1059115 | All Organisms → Viruses → Predicted Viral | 1974 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1062843 | All Organisms → Viruses → Predicted Viral | 1879 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1233980 | Not Available | 670 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1018440 | All Organisms → Viruses → Predicted Viral | 4740 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1077711 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1204328 | Not Available | 704 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1307355 | Not Available | 513 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1159093 | Not Available | 809 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1172450 | Not Available | 762 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1031443 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1294298 | Not Available | 612 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1009848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1 | 9008 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1050528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → Synechococcus virus SWAM2 | 2338 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1098724 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1123717 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1280397 | Not Available | 584 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1323344 | Not Available | 521 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1059900 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1081727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Cymopoleiavirus → Synechococcus virus SWAM2 | 1585 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1257650 | Not Available | 618 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10073988 | All Organisms → Viruses → Predicted Viral | 2180 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10139744 | Not Available | 1420 | Open in IMG/M |
| 3300031784|Ga0315899_11342938 | Not Available | 609 | Open in IMG/M |
| 3300031999|Ga0315274_11738576 | Not Available | 576 | Open in IMG/M |
| 3300033233|Ga0334722_10677964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
| 3300033816|Ga0334980_0031009 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300033979|Ga0334978_0000014 | Not Available | 91420 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.33% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.17% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.17% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.33% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.33% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.33% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 3.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.50% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.67% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.67% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.67% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.67% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.67% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.83% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.83% |
| Saline Water Concentrator Pond | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond | 0.83% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.83% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.83% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876023 | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001970 | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026902 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PC6_04501512 | 2236876023 | Saline Water Concentrator Pond | MSTKTWVVKLEIVIDEDSHPRKFIPDAINECLKHQEGEDIVDYDFVCLD |
| BS_KBA_SWE12_21mDRAFT_101331902 | 3300000124 | Marine | MNTKNWVIKIEIAIDEDSHPRKFIPNAIAECLNFGDGEDIIDYEFICLD* |
| Draft_101769003 | 3300001605 | Hydrocarbon Resource Environments | MNTKTWVVTLEIAIDETSHPRKFIPDAINECLNLEEGEDIIDYKFVCLD* |
| JGI11772J19994_10198141 | 3300001748 | Saline Water And Sediment | LEIVIDENSHPRKFIPDAINECLNHQEGEDIVDYNFVCLD* |
| GOS2248_100333685 | 3300001970 | Hypersaline | MSTKTWVVKLEIVIDEDSHPRKFIPDAINECLKHQEGEDIVDYDFVCLD* |
| GOS2248_100756342 | 3300001970 | Hypersaline | MSTKTWVVKLEIVIDEDSHPRKFIPDAINECLNHQEGEDIVDYDFVCLD* |
| Ga0065726_1055435 | 3300004369 | Saline | MTTKTWVVKIEIEIDENSHPRKFIPDAIAECLNLEEGEDIIDYDFICLD* |
| Ga0074648_100137218 | 3300005512 | Saline Water And Sediment | MSTKTWVVKLEIVIDENSHPRKFIPDAINECLNHQEGEDIVDYNFVCLD* |
| Ga0074648_10139307 | 3300005512 | Saline Water And Sediment | MKTKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGEDIVDYEFVCLD* |
| Ga0049081_100068486 | 3300005581 | Freshwater Lentic | MNTKNWVIKIEIAIDENSHPRKFVPDAIAECLNFGDGEDIIDYEFICLD* |
| Ga0079957_100015754 | 3300005805 | Lake | MTTKTWVVKLEIVIDENTHPRKFIPDAIAECLNLEEGEDIIDYNFVCLN* |
| Ga0070743_101765102 | 3300005941 | Estuarine | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0073926_1000028619 | 3300005943 | Sand | MNTKNWVIKIEIAIDENSHPRKFIPDAIADCLNFEEGEDIIDYDFVCLD* |
| Ga0073924_10600701 | 3300005992 | Sand | EIAIDENSHPRKFIPDAIADCLNFEEGEDIIDYDFVCLD* |
| Ga0075470_100708964 | 3300006030 | Aqueous | MTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD* |
| Ga0079301_11505083 | 3300006639 | Deep Subsurface | MTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLDEGEDI |
| Ga0070749_101617543 | 3300006802 | Aqueous | MTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0075476_100422236 | 3300006867 | Aqueous | MITKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGEDIVDYDFVCLD* |
| Ga0075477_104120013 | 3300006869 | Aqueous | MTTKTWIVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0079302_10693912 | 3300007165 | Deep Subsurface | MNTKNWVIRIEIAIDENSHPRKFIPDAIADCLNLEEGEDIIDYDFVCLD* |
| Ga0099851_10353532 | 3300007538 | Aqueous | METKLWVVTLEIEIDANSHPRKFVPDAINECLNLDQGEDIIDYKFVCLD* |
| Ga0099851_11475814 | 3300007538 | Aqueous | VVKLEIVIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0099849_12920372 | 3300007539 | Aqueous | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD* |
| Ga0099849_13712082 | 3300007539 | Aqueous | MTTKTWVVKLEIMIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD* |
| Ga0099848_10880261 | 3300007541 | Aqueous | TKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0099848_11117851 | 3300007541 | Aqueous | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLDEGEDIIDYNF |
| Ga0099846_11634772 | 3300007542 | Aqueous | METKLWVVTLEIEIDANSHPRKFVPDAINECLNLDQGEDIIDYK |
| Ga0102921_10192011 | 3300007603 | Estuarine | MTTKTWVVKLEIAIDENSHPRKFIPEAIAECLNLEEGEDIIDYTFVCLD* |
| Ga0099850_11195696 | 3300007960 | Aqueous | ENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0099850_12417273 | 3300007960 | Aqueous | MIMTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0108970_103952969 | 3300008055 | Estuary | MNTKNWVIKIEIAIDENSHPRKFVPNAIAECLNFGDGEDIIDYEFICLD* |
| Ga0114340_10289184 | 3300008107 | Freshwater, Plankton | MIKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0114340_12073791 | 3300008107 | Freshwater, Plankton | MIMTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0114343_10332875 | 3300008110 | Freshwater, Plankton | MTTKTWVIKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0114346_11000773 | 3300008113 | Freshwater, Plankton | MTTKTWVVKLEIEIDENSHPRKFIPEAIAECLNLEEGEDIIDYTFVCLD* |
| Ga0114978_100120199 | 3300009159 | Freshwater Lake | MATKRWFMTLVVEIDEESNPRKFVPDAINECLDSAKGEDIIDYKFVCPD* |
| Ga0114976_103475893 | 3300009184 | Freshwater Lake | EIDEESNPRKFVPDAINECLDSAKGEDIIDYKFVCPD* |
| Ga0116204_10493883 | 3300010293 | Anoxic Lake Water | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYTFVCLD* |
| Ga0129348_10007353 | 3300010296 | Freshwater To Marine Saline Gradient | MEMNNQQKLIMTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0129348_12771431 | 3300010296 | Freshwater To Marine Saline Gradient | LIMTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD* |
| Ga0129345_10176256 | 3300010297 | Freshwater To Marine Saline Gradient | MEMNNQQKLIMTTKTWVVKLEIAIDENSHPRKFIPDAITECLNLEEGEDIIDYNFVCLD* |
| Ga0129345_10545896 | 3300010297 | Freshwater To Marine Saline Gradient | EIVIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD* |
| Ga0129345_11775782 | 3300010297 | Freshwater To Marine Saline Gradient | MNTKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGEDIVDYDFVCLD* |
| Ga0129342_100323624 | 3300010299 | Freshwater To Marine Saline Gradient | MEMNNQQKLIMTTKTWVVKLEIAIDENSHPRKFIPDAITECLNLEEGEDIIDYNFV |
| Ga0129342_100951010 | 3300010299 | Freshwater To Marine Saline Gradient | MMTTKTWVVKLEIAIDENSHPRKFIPDAITECLNLEEGEDIIDYNFVCLD* |
| Ga0136656_12109603 | 3300010318 | Freshwater To Marine Saline Gradient | VIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0129333_101642172 | 3300010354 | Freshwater To Marine Saline Gradient | MTTKTWVVKLEIAIDENSHPRKFIPEAIAECLNLKEGEDIIDYTFVCLD* |
| Ga0129333_102382057 | 3300010354 | Freshwater To Marine Saline Gradient | MTTKTWVIKLEIVIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD* |
| Ga0129333_105558355 | 3300010354 | Freshwater To Marine Saline Gradient | MTTKTWVVKLEIVIDENSHPRKFIPDAITECLNLEEGEDIIDYNFVCLD* |
| (restricted) Ga0172364_108257233 | 3300013129 | Sediment | FLWYFLHPKLIMTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYTFVCLD |
| (restricted) Ga0172362_105428571 | 3300013133 | Sediment | IMTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYTFVCLD* |
| Ga0177922_103412092 | 3300013372 | Freshwater | MTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID* |
| Ga0181584_104569612 | 3300017949 | Salt Marsh | MTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD |
| Ga0180431_102606955 | 3300017987 | Hypersaline Lake Sediment | MKTKTWVVKLEIAIDEDSHPRKFIPDAINECLNLQEGEDIVDYDFICLD |
| Ga0180433_101718036 | 3300018080 | Hypersaline Lake Sediment | MKTKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGEDIVDYDFVCLD |
| Ga0181563_108182052 | 3300018420 | Salt Marsh | MMTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD |
| Ga0181592_102518374 | 3300018421 | Salt Marsh | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD |
| Ga0188851_10236062 | 3300018682 | Freshwater Lake | MTTKTWVVKIEIEIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFICLD |
| Ga0188835_10119992 | 3300019096 | Freshwater Lake | MTETKRWVVTLEIEIDANSHPRKFIPNAVAECLNLGDGEDIVDYTFVCLD |
| Ga0211732_10949693 | 3300020141 | Freshwater | MKTKTWIVKLEIEIDENSHPRKFVPDAIAECLNLEEGEDIIDYTFICLD |
| Ga0213859_100888603 | 3300021364 | Seawater | MSTKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGENIVNYDFICLD |
| Ga0213866_103916072 | 3300021425 | Seawater | METKLWVVTLEIEIDANSHPRKFVPDAINECLNLDQGEDIIDYKFVCLD |
| Ga0222714_105134461 | 3300021961 | Estuarine Water | MTTKTWVVKLEIAIDENSHPRKFIPEAIAECLNLEEGEDIID |
| Ga0222714_105713073 | 3300021961 | Estuarine Water | VLIMTTKTWVVKLEIAIDENSHPRKFIPEAIAECLNLEEGEDIIDYTFVCLD |
| Ga0222713_100772484 | 3300021962 | Estuarine Water | MTTKTWVVKLEIAIDENSHPRKFIPEAIAECLNLEDGEDIIDYTFVCLD |
| Ga0222713_101553072 | 3300021962 | Estuarine Water | VDLLPNXLTEMATKTWVVKLEIEVDENSHPRKFIPDAINECLNLEEGEDIIDYQFICID |
| Ga0222713_108544501 | 3300021962 | Estuarine Water | EISIDENSHPRKFIPEAIAECLNLEEGEDIIDYTFVCLD |
| Ga0181354_12331601 | 3300022190 | Freshwater Lake | MNTKNWVIRIEIAIDENSHPRKFIPDAIADCLNLEEGEDIIDYDFVCLD |
| Ga0196905_11811081 | 3300022198 | Aqueous | LEIVIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD |
| Ga0214917_102331853 | 3300022752 | Freshwater | MNTKNWVIKIEIAIDENSHPRKFIPDAIAECLNLEEGEDIIDYDFICLD |
| Ga0255772_101209887 | 3300023176 | Salt Marsh | MTTKTWVVKLEIVIDENSHPRKFIPDAIAECLNLDEGEDII |
| Ga0244775_102601592 | 3300024346 | Estuarine | MNTKNWVIRIEIAIDENSHPRKFIPDAIADCLNLEEGEDIIDYDFVCLDL |
| Ga0208161_10478401 | 3300025646 | Aqueous | IVIDENSHPRKFIPDAIAECLNLEEGEDIIDYNFVCLD |
| Ga0208795_11165663 | 3300025655 | Aqueous | MTTKTWVVKLEIVIDENSHPRKFIPDAISECLNLDEGEDIIDYNFVCLD |
| Ga0208162_11216793 | 3300025674 | Aqueous | MTTKTWVVKLEIAIDENSHPRKFIPDAIAECLNLDEGEDIIDYNFVCLD |
| Ga0208547_10953182 | 3300025828 | Aqueous | MITKTWVVKLEIVIDEDSHPRKFIPDAINECLNLQEGEDIVDYDFVCLD |
| Ga0209851_10073514 | 3300026902 | Sand | KIEIAIDENSHPRKFIPDAIADCLNFEEGEDIIDYDFVCLD |
| Ga0209867_100019019 | 3300027393 | Sand | MNTKNWVIKIEIAIDENSHPRKFIPDAIADCLNFEEGEDIIDYDFVCLD |
| Ga0208974_10392277 | 3300027608 | Freshwater Lentic | MTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| Ga0208974_11527592 | 3300027608 | Freshwater Lentic | EIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| Ga0208975_100812910 | 3300027659 | Freshwater Lentic | MNTKNWVIKIEIAIDENSHPRKFVPDAIAECLNFGDGEDIIDYEFICLD |
| (restricted) Ga0247836_100123636 | 3300027728 | Freshwater | MTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| (restricted) Ga0247836_10095682 | 3300027728 | Freshwater | MTLTNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| (restricted) Ga0247836_10375031 | 3300027728 | Freshwater | MTTKTWIIRLEVEIDENSHPRKFIPEAILECLKQEEGEDLIDHTYICLD |
| (restricted) Ga0247836_11709983 | 3300027728 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENSHPCKFIPEAINECLNLEKGEDLIDYSFICLD |
| (restricted) Ga0247833_10284758 | 3300027730 | Freshwater | MTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247833_10462307 | 3300027730 | Freshwater | IDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| (restricted) Ga0247833_12403544 | 3300027730 | Freshwater | QTNKMTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247833_13231081 | 3300027730 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDL |
| Ga0209087_13386651 | 3300027734 | Freshwater Lake | EIDEESNPRKFVPDAINECLDSAKGEDIIDYKFVCPD |
| Ga0209296_100084010 | 3300027759 | Freshwater Lake | MATKRWFMTLVVEIDEESNPRKFVPDAINECLDSAKGEDIIDYKFVCPD |
| Ga0209088_1000784511 | 3300027763 | Freshwater Lake | MNTKNWVIKIEIAIDEDSHPRKFIPNAIAECLNFGDGEDIIDYEFICLD |
| (restricted) Ga0247837_10854301 | 3300027970 | Freshwater | MTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLI |
| (restricted) Ga0247834_10591152 | 3300027977 | Freshwater | MITKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| (restricted) Ga0247834_10628439 | 3300027977 | Freshwater | MTLTNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDL |
| (restricted) Ga0247834_12339802 | 3300027977 | Freshwater | MTLTNKMTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDLIDYSFICID |
| (restricted) Ga0247838_101844010 | 3300028044 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247838_10777116 | 3300028044 | Freshwater | MTLTNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247838_12043283 | 3300028044 | Freshwater | MTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEEGEDIIDYSFICID |
| (restricted) Ga0247838_13073551 | 3300028044 | Freshwater | FSQTNKMTTKTWVIRLEIEIDENSHPCKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247835_11590935 | 3300028114 | Freshwater | EIEIDENSHPRKFIPEAINECLNLEEGEDIIDYSFICID |
| (restricted) Ga0247835_11724501 | 3300028114 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLI |
| (restricted) Ga0247839_10314431 | 3300028553 | Freshwater | MTLTNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICI |
| (restricted) Ga0247839_12942984 | 3300028553 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGED |
| (restricted) Ga0247832_10098482 | 3300028557 | Freshwater | MTTKTWVIRLEIEIDENSHPCKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247843_10505285 | 3300028569 | Freshwater | MTTKIWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247843_10987241 | 3300028569 | Freshwater | NKMTTKIWVIRLEIEIDENSHPCKFIPEAINECLNLEKGEDLIDYSFICLD |
| (restricted) Ga0247843_11237174 | 3300028569 | Freshwater | MTTKTWVIRLEIEIDENSHPRKFIPEAINECLNLEGGEDLIDYSFICID |
| (restricted) Ga0247843_12803971 | 3300028569 | Freshwater | TLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEKGEDLIDYSFICID |
| (restricted) Ga0247843_13233442 | 3300028569 | Freshwater | MTTKTWVIRLEIEIEENSHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247844_10599004 | 3300028571 | Freshwater | MELHNKMTTKTWVIRLEIEIDENSHPCKFIPEAINECLNLEEGEDLIDFSFICLD |
| (restricted) Ga0247844_10817274 | 3300028571 | Freshwater | MTTKIWVIRLEIEIDENDHPCKFIPEAINECLNLEEGEDLIDYSFICLD |
| (restricted) Ga0247844_12576503 | 3300028571 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEKGEDLI |
| (restricted) Ga0247842_100739886 | 3300029268 | Freshwater | MTLTTPNKMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEKGEDLIDYSFICLD |
| (restricted) Ga0247842_101397442 | 3300029268 | Freshwater | MTLSREMTTKTWVIRLEIEIDENDHPRKFIPEAINECLNLEEGEDLIDYSFICLD |
| Ga0315899_113429381 | 3300031784 | Freshwater | VVTLEIEIDANSHPRKFVPDAINECLNLDQGEDIIDYKFVCLD |
| Ga0315274_117385761 | 3300031999 | Sediment | MNTKNWVIKIKIAIDENSHPLKFVPNAIAECLNFGDGEDIIDYEFICLD |
| Ga0334722_106779642 | 3300033233 | Sediment | MNTKNWVIKIEIAIDGNSHPRKFIPDAIADCLNLEEGEDIIDYDFVCLD |
| Ga0334980_0031009_833_982 | 3300033816 | Freshwater | MITKTWVVKLEIAIDENSHPRKFIPDAITECLNLEEGEDIIDYNFVCLD |
| Ga0334978_0000014_34057_34209 | 3300033979 | Freshwater | MLETKTWVVKLEIMIDANSHPRKFIPETISEALNFEMGEDLTHYEFICLD |
| ⦗Top⦘ |