


| Basic Information | |
|---|---|
| Family ID | F073455 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 41 residues |
| Representative Sequence | IDDLNKAGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGKV |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.17 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (55.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 5.88% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 1.67 |
| PF02945 | Endonuclease_7 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.83 % |
| Unclassified | root | N/A | 4.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10152411 | Not Available | 846 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10280199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10014386 | All Organisms → Viruses → Predicted Viral | 3638 | Open in IMG/M |
| 3300001354|JGI20155J14468_10103268 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300001472|JGI24004J15324_10011132 | All Organisms → cellular organisms → Bacteria | 3247 | Open in IMG/M |
| 3300002203|metazooDRAFT_1307249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300002476|metazooDRAFT_10894746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300002835|B570J40625_100734182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300003393|JGI25909J50240_1034657 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
| 3300003499|JGI25930J51415_1001951 | All Organisms → Viruses → Predicted Viral | 4698 | Open in IMG/M |
| 3300004481|Ga0069718_15916450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 715 | Open in IMG/M |
| 3300005420|Ga0068879_1313180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 520 | Open in IMG/M |
| 3300005581|Ga0049081_10249194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300005582|Ga0049080_10072373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1181 | Open in IMG/M |
| 3300005584|Ga0049082_10013658 | All Organisms → Viruses → Predicted Viral | 2768 | Open in IMG/M |
| 3300005912|Ga0075109_1211292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300006027|Ga0075462_10059488 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
| 3300006030|Ga0075470_10061200 | All Organisms → Viruses | 1147 | Open in IMG/M |
| 3300006641|Ga0075471_10105818 | All Organisms → Viruses → Predicted Viral | 1508 | Open in IMG/M |
| 3300006802|Ga0070749_10269536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 960 | Open in IMG/M |
| 3300006850|Ga0075491_1483718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 743 | Open in IMG/M |
| 3300006869|Ga0075477_10211501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 791 | Open in IMG/M |
| 3300006874|Ga0075475_10464087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 502 | Open in IMG/M |
| 3300006875|Ga0075473_10229342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 751 | Open in IMG/M |
| 3300006917|Ga0075472_10625734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 540 | Open in IMG/M |
| 3300007236|Ga0075463_10033045 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
| 3300007345|Ga0070752_1188446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 828 | Open in IMG/M |
| 3300007346|Ga0070753_1094419 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300007363|Ga0075458_10082798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300007544|Ga0102861_1191739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 560 | Open in IMG/M |
| 3300007637|Ga0102906_1129452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 692 | Open in IMG/M |
| 3300007973|Ga0105746_1053514 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300007973|Ga0105746_1204618 | Not Available | 675 | Open in IMG/M |
| 3300008107|Ga0114340_1089941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1889 | Open in IMG/M |
| 3300008107|Ga0114340_1122978 | All Organisms → Viruses | 1001 | Open in IMG/M |
| 3300008108|Ga0114341_10169904 | All Organisms → Viruses | 1248 | Open in IMG/M |
| 3300008108|Ga0114341_10362601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 721 | Open in IMG/M |
| 3300008113|Ga0114346_1023791 | All Organisms → Viruses → Predicted Viral | 4156 | Open in IMG/M |
| 3300008221|Ga0114916_1069818 | All Organisms → Viruses | 917 | Open in IMG/M |
| 3300008262|Ga0114337_1345967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 508 | Open in IMG/M |
| 3300008448|Ga0114876_1144714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300009001|Ga0102963_1208840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 777 | Open in IMG/M |
| 3300009170|Ga0105096_10172740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1090 | Open in IMG/M |
| 3300009435|Ga0115546_1138515 | All Organisms → Viruses | 863 | Open in IMG/M |
| 3300009526|Ga0115004_10834593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 549 | Open in IMG/M |
| 3300010160|Ga0114967_10599181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 530 | Open in IMG/M |
| 3300010354|Ga0129333_11410647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 573 | Open in IMG/M |
| 3300010370|Ga0129336_10152238 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300010370|Ga0129336_10587978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300012964|Ga0153916_11138270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 860 | Open in IMG/M |
| 3300013004|Ga0164293_10432178 | All Organisms → Viruses | 881 | Open in IMG/M |
| 3300013005|Ga0164292_10956118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 536 | Open in IMG/M |
| 3300013372|Ga0177922_10497000 | All Organisms → Viruses → Predicted Viral | 2338 | Open in IMG/M |
| 3300014711|Ga0134314_110343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017707|Ga0181363_1000674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8908 | Open in IMG/M |
| 3300017707|Ga0181363_1096035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300017716|Ga0181350_1166078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 509 | Open in IMG/M |
| 3300017717|Ga0181404_1150800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 561 | Open in IMG/M |
| 3300017723|Ga0181362_1104158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 562 | Open in IMG/M |
| 3300017778|Ga0181349_1103702 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300017784|Ga0181348_1087745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1227 | Open in IMG/M |
| 3300017950|Ga0181607_10111819 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300019784|Ga0181359_1102803 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300020056|Ga0181574_10181971 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300020177|Ga0181596_10397454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 523 | Open in IMG/M |
| 3300020188|Ga0181605_10141351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1151 | Open in IMG/M |
| 3300020810|Ga0181598_1221329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 712 | Open in IMG/M |
| 3300021425|Ga0213866_10355332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 724 | Open in IMG/M |
| 3300021960|Ga0222715_10712401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 504 | Open in IMG/M |
| 3300021963|Ga0222712_10335992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300021963|Ga0222712_10530077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300022065|Ga0212024_1034129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 870 | Open in IMG/M |
| 3300022169|Ga0196903_1026126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 697 | Open in IMG/M |
| 3300022179|Ga0181353_1018225 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300022183|Ga0196891_1045656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 802 | Open in IMG/M |
| 3300022198|Ga0196905_1200336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300022407|Ga0181351_1084376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1259 | Open in IMG/M |
| 3300022407|Ga0181351_1084460 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300022407|Ga0181351_1139454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300022821|Ga0222673_1019019 | All Organisms → Viruses | 1011 | Open in IMG/M |
| 3300023567|Ga0228694_118310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 734 | Open in IMG/M |
| 3300024351|Ga0255141_1070447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300024420|Ga0228632_1077215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 780 | Open in IMG/M |
| 3300025425|Ga0208646_1002019 | All Organisms → Viruses | 8815 | Open in IMG/M |
| 3300025445|Ga0208424_1003116 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
| 3300025513|Ga0208413_1176111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 509 | Open in IMG/M |
| 3300025608|Ga0209654_1055976 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300025698|Ga0208771_1184593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 561 | Open in IMG/M |
| 3300025732|Ga0208784_1064845 | All Organisms → Viruses | 1111 | Open in IMG/M |
| 3300025771|Ga0208427_1139442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 808 | Open in IMG/M |
| 3300025818|Ga0208542_1083759 | All Organisms → Viruses | 939 | Open in IMG/M |
| 3300025869|Ga0209308_10024140 | All Organisms → Viruses → Predicted Viral | 3596 | Open in IMG/M |
| 3300025889|Ga0208644_1114887 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300026478|Ga0255156_1011725 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| 3300026478|Ga0255156_1086790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300027578|Ga0255075_1080227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 570 | Open in IMG/M |
| 3300027608|Ga0208974_1043152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 1319 | Open in IMG/M |
| 3300027659|Ga0208975_1107659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 805 | Open in IMG/M |
| 3300027710|Ga0209599_10009602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 3018 | Open in IMG/M |
| 3300027785|Ga0209246_10164487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 871 | Open in IMG/M |
| 3300027813|Ga0209090_10372581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 692 | Open in IMG/M |
| 3300027900|Ga0209253_10196146 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300028092|Ga0247574_1016133 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300031565|Ga0307379_10478393 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300031628|Ga0308014_1058065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 943 | Open in IMG/M |
| 3300031787|Ga0315900_10535367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300031857|Ga0315909_10435774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 927 | Open in IMG/M |
| 3300031857|Ga0315909_10488205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 854 | Open in IMG/M |
| 3300031963|Ga0315901_10751007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Methylophilales phage HIM624-A | 715 | Open in IMG/M |
| 3300032093|Ga0315902_10356606 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300032093|Ga0315902_11246982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300032516|Ga0315273_11278079 | All Organisms → Viruses | 918 | Open in IMG/M |
| 3300033521|Ga0316616_100331145 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300034062|Ga0334995_0306959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
| 3300034101|Ga0335027_0791366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300034102|Ga0335029_0601001 | Not Available | 617 | Open in IMG/M |
| 3300034106|Ga0335036_0619755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034375|Ga0348336_027567 | All Organisms → Viruses → Predicted Viral | 2749 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.17% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.17% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.33% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.50% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.50% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.50% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.67% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.67% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.67% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.67% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.83% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.83% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.83% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.83% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.83% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006850 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300023567 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025513 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028092 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 28R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101524112 | 3300000101 | Marine | MTVVDKLNQQGIMRGHHVLDQKAFFKWLNDPENRFFRTKQGRI* |
| DelMOSum2010_102801991 | 3300000101 | Marine | DDLNKQGIMRGFHVLDEKRFRAWLNNPDNRFFRTRPGNI* |
| TB_LI09_4DRAFT_100143861 | 3300000231 | Groundwater | PLTVIDDLNKSGIMRGFHVLDKQRFTSWLNNPDNRVFRTRPGTV* |
| JGI20155J14468_101032681 | 3300001354 | Pelagic Marine | LNQKGIMRGFHVLDMPKFKAWLNDPDNRFFRTKQGRV* |
| JGI24004J15324_100111323 | 3300001472 | Marine | MTVIDKLNQKGIMRGFHVLDQKKFKEWLNXPDNRFFRTKQGRI* |
| metazooDRAFT_13072492 | 3300002203 | Lake | IDQLNRKGIMRGFAIINEKEFRKFLNDPENRFFRTRPGQV* |
| metazooDRAFT_108947461 | 3300002476 | Lake | NVVIDDLNAKGIMRGFAVVDEKRFRIFLNDPDNRFFRTRPGQI* |
| B570J40625_1007341821 | 3300002835 | Freshwater | VIDDLNKKGIMRGFHVVDQARFKEWLNNPDNRAFRTRPGRV* |
| JGI25909J50240_10346573 | 3300003393 | Freshwater Lake | FDELNKKGIMRGFHVIDQKGFRRFLNDPDNKVFRTREGTV* |
| JGI25930J51415_10019511 | 3300003499 | Freshwater Lake | PLTVIDDLNAKGIMRGFAVVDEKKFKEFLNSPDNRFFRTRPGRV* |
| Ga0069718_159164501 | 3300004481 | Sediment | FTVVDTLNRKGIMRGFAVIDEKEFRKFLNDPENRFFRTRPGKV* |
| Ga0068879_13131802 | 3300005420 | Freshwater Lake | VVIDDLNKQGIMRGFAVVDEKRFRTFLNNPDNRFFRTRPGQI* |
| Ga0049081_102491942 | 3300005581 | Freshwater Lentic | IDSLNHKGIMRGFHIVDQKRFKEFLNNPDNRVFRTREGKV* |
| Ga0049080_100723731 | 3300005582 | Freshwater Lentic | TIIDTLNRRGIMRGFAVIDEKEFKKFLNDPENRFFRTRPGKV* |
| Ga0049082_100136585 | 3300005584 | Freshwater Lentic | SIPMTVFDELNKRGIVRGFHVIDQKAFRKFLNDPDNKVFRTREGTV* |
| Ga0075109_12112921 | 3300005912 | Saline Lake | VIDDLNKKQIMQGFQVLDLKRFKAFLNHPDNRFFRTKPGKV* |
| Ga0075462_100594883 | 3300006027 | Aqueous | QKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV* |
| Ga0075470_100612003 | 3300006030 | Aqueous | LTVIDQLNKDGIMRGFHILDQKRFKAWLNERDNQAFRTRPGRI* |
| Ga0075471_101058184 | 3300006641 | Aqueous | IASIPLTVIDQLNKDGIMRGFHILDQKRFKAWLNERDNQAFRTRPGRI* |
| Ga0070749_102695363 | 3300006802 | Aqueous | NQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV* |
| Ga0075491_14837182 | 3300006850 | Aqueous | IDELNKQKIMRGFHVVDPKRFKAWLNNPDNRFFRTKQGTV* |
| Ga0075477_102115012 | 3300006869 | Aqueous | NKQGIMRGFHVLDQARFKAWLNEPDNRAFRTRPGRV* |
| Ga0075475_104640871 | 3300006874 | Aqueous | TVIDTLNQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV* |
| Ga0075473_102293422 | 3300006875 | Aqueous | NKKGIMRGFHVVDQARFKEWLNHPDNRAFRTRPGRV* |
| Ga0075472_106257341 | 3300006917 | Aqueous | KGIMRGFHVVDQARFKEWLNHPDNRAFRTRPGRV* |
| Ga0075463_100330451 | 3300007236 | Aqueous | LNQKGIMRGFHVIDQKAFRNWLNDPDNRFFRTRQGKV* |
| Ga0070745_11683181 | 3300007344 | Aqueous | DNKIASIPLTVIDTLNKEGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGKV* |
| Ga0070752_11884462 | 3300007345 | Aqueous | IDTLNQKGIMKGFDVVDQKKFRAWLNDPDNRFFRTRQGKI* |
| Ga0070753_10944193 | 3300007346 | Aqueous | NKQGIMRGFHVLDQKKFKEFLNHPDNRFFRTKQGRI* |
| Ga0075458_100827983 | 3300007363 | Aqueous | NRKGIMRGYQVIDEKRMKAWLNHPDNRFFRTHPGRV* |
| Ga0102861_11917392 | 3300007544 | Estuarine | PLTLIDDLNAKGVMRGFHVIDQTAFKAFLNNPDNRFFRTHPGHI* |
| Ga0102906_11294521 | 3300007637 | Estuarine | ASIPLTVVDDLNKQGIMRGFHVLDQKKFFAWLNDPDNRFFRTKQGRI* |
| Ga0105746_10535144 | 3300007973 | Estuary Water | DDLNKKGIMRGFHVVDQARFKEWLNHPDNRAFRTRPGRV* |
| Ga0105746_12046182 | 3300007973 | Estuary Water | PLTVIDDLNRKRVLKGFKVIDDKAFKAFLNHPDNRFFRTHPGHI* |
| Ga0114340_10899415 | 3300008107 | Freshwater, Plankton | ASIPMTVIDSLNHKGIMRGFHIVDQKRFKEFLNNPDNKVFRTREGKV* |
| Ga0114340_11229783 | 3300008107 | Freshwater, Plankton | ASIPMTVIDSLNHKGIMRGFHIVDQKRFKEFLNNPDNRVFRTREGKV* |
| Ga0114341_101699043 | 3300008108 | Freshwater, Plankton | EIPNSVIADLNVKGIMRGFAVVDQKRMKAFLNDPENRFLRTRPGRI* |
| Ga0114341_103626011 | 3300008108 | Freshwater, Plankton | DSLNHKGIMRGFHIVDQKRFKEFLNDPDNKVFRTREGRI* |
| Ga0114346_10237912 | 3300008113 | Freshwater, Plankton | MTVFDELNKRGIVRGFHVIDQKAFRKFLNDPDNKVFRTREGTV* |
| Ga0114916_10698183 | 3300008221 | Deep Ocean | VIDDLNHKKIMQGFQILDMKKFKEFLNHPDNRFFRTKQGRI* |
| Ga0114337_13459672 | 3300008262 | Freshwater, Plankton | SIPMTVIDSLNHKGIMRGFHIVDQKRFKEFLNDPDNKVFRTREGRI* |
| Ga0114876_11447142 | 3300008448 | Freshwater Lake | ADLNVQGIMRGFAVVDQKRMKAFLNDPANRFLRTRPGRI* |
| Ga0102963_12088402 | 3300009001 | Pond Water | DLNKAGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGRV* |
| Ga0105096_101727402 | 3300009170 | Freshwater Sediment | YTVIDDLNRKGIMRGFAVVDEGAFAAFLNNPDNRFLRVRPGNI* |
| Ga0115546_11385151 | 3300009435 | Pelagic Marine | TVIDELNKQKIMRGFHVVDPKRFKAWLNNPDNRFFRTKQGTV* |
| Ga0115004_108345931 | 3300009526 | Marine | KIASIPMTVVDKLNQQGIMRGFHVLDQKKFFAWLNDSDNRFFRTKKGRI* |
| Ga0114967_105991811 | 3300010160 | Freshwater Lake | SIPLTVFDELNKRGIVRGFQVIDQKAFKKFLNDPDNRVFRTREGIV* |
| Ga0129333_114106472 | 3300010354 | Freshwater To Marine Saline Gradient | NKDGIMRGFHVIDQTRFKHWLNNPDNRAFRTRPGRV* |
| Ga0129336_101522381 | 3300010370 | Freshwater To Marine Saline Gradient | LPLTLIDDLNAKGIMRGFHVIDQTAFKAFLNNPDNRFFRTHPGHI* |
| Ga0129336_105879781 | 3300010370 | Freshwater To Marine Saline Gradient | RKGIMQGFSVKDDKAFRAFLNHPDNRFFRTHPGKI* |
| Ga0153916_111382701 | 3300012964 | Freshwater Wetlands | QGIMRGFHVVDQKRFRHWLNQRDNQAFRTRPGVI* |
| Ga0164293_104321783 | 3300013004 | Freshwater | DDLNAKGIMRGFAVIDEKQMKAWLNNPDNRFFRTRPGKV* |
| Ga0164292_109561181 | 3300013005 | Freshwater | RGIVRGFHVIDQKAFRKFLNDPDNKVFRTREGTV* |
| Ga0177922_104970005 | 3300013372 | Freshwater | SVIADLNVKGIMRGFAVVDQKRMKAFLNDPENRFLRTRPGRI* |
| Ga0134314_1103431 | 3300014711 | Surface Water | VIDELNKQGIMRGFAVMDEKRFRAFLNHPDNRFFRTRPGQL* |
| Ga0181363_100067410 | 3300017707 | Freshwater Lake | PLTVIDDLNAKGIMRGFAVVDEKKFKEFLNSPDNRFFRTRPGRV |
| Ga0181363_10960352 | 3300017707 | Freshwater Lake | VAEIPNSVIADLNVKGIMRGFAVVDQKRMKAFLNDPENRFLRTRPGRI |
| Ga0181350_11660781 | 3300017716 | Freshwater Lake | NAKGVMRGFAVVDEKKFKEFLNSPDNRFFRTRPGRV |
| Ga0181404_11508001 | 3300017717 | Seawater | ASIPMTVIDRLNQKGIMRGFHVLDQKKFKEWLNDPDNRFFRTKQGRI |
| Ga0181362_11041581 | 3300017723 | Freshwater Lake | NKRGIVRGFHVIDQKAFKKFLNDPDNRVFRTREGIV |
| Ga0181349_11037021 | 3300017778 | Freshwater Lake | FDELNKRGIVRGFHVIDQKAFRKFLNDPDNKVFRTREGTV |
| Ga0181348_10877454 | 3300017784 | Freshwater Lake | IPLTVIDDLNAKGVMRGFAVVDEKKFKEFLNSPDNRFFRTRPGRV |
| Ga0181607_101118194 | 3300017950 | Salt Marsh | NQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV |
| Ga0181359_11028033 | 3300019784 | Freshwater Lake | DELNKKGIMRGFHVIDQKGFKKFLNDPDNRVFRTREGTV |
| Ga0181574_101819714 | 3300020056 | Salt Marsh | VIDDLNTKGIMKGFHVVDQKKFRLWLNDPDNRFFRTRQGRI |
| Ga0181596_103974541 | 3300020177 | Salt Marsh | TLNKEGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGKV |
| Ga0181605_101413511 | 3300020188 | Salt Marsh | SIPMVAIDELNKQGIMRGFHVLDQKKFKEFLNHPDNRFFRTKQGRI |
| Ga0181598_12213291 | 3300020810 | Salt Marsh | IDDLNKAGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGKV |
| Ga0213866_103553321 | 3300021425 | Seawater | LNKAGIMRGFHVLDQKKFRAWLNNPDNRFFRTRQGKV |
| Ga0222715_107124011 | 3300021960 | Estuarine Water | LNQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV |
| Ga0222712_103359921 | 3300021963 | Estuarine Water | LNAKGIMRGFHVIDQTAFKAFLNNPDNRFFRTHPGHI |
| Ga0222712_105300771 | 3300021963 | Estuarine Water | SLPNVVIDDLNRQGIMRGFAVVDEKRFRTFLNNPDNRFFRTRPGQI |
| Ga0212024_10341293 | 3300022065 | Aqueous | LNQKGIMRGFHVIDQKAFRNWLNDPDNRFFRTRQGKV |
| Ga0196903_10261262 | 3300022169 | Aqueous | NKIASLPLTVIDKLNQQGIMRGFHVLDQKKFFAWLNDPDNRFFRTKQGRI |
| Ga0181353_10182254 | 3300022179 | Freshwater Lake | SKRGIVRGFHVIDQKAFRKFLNDPDNKVFRTREGTV |
| Ga0196891_10456561 | 3300022183 | Aqueous | PLTVIDTLNQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV |
| Ga0196905_12003361 | 3300022198 | Aqueous | VVTHIARLPLTVIDDLNRKKVMQGFRVIDEKAFRAFLNHPDNRFFRTHPAKV |
| Ga0181351_10843764 | 3300022407 | Freshwater Lake | DELNKKGIMRGFHVIDQKGFRRFLNDPDNKVFRTREGTV |
| Ga0181351_10844604 | 3300022407 | Freshwater Lake | IDELNKKGIMRGFHVIDQKGFRKFLNDPDNRVFRTREGTV |
| Ga0181351_11394541 | 3300022407 | Freshwater Lake | DDLNRKRVLKGFKVIDDKAFKAFLNHPDNRFFRTHPGHI |
| Ga0222673_10190191 | 3300022821 | Saline Water | MTVIDDLNKKQIMQGFQVLDLKRFKAFLNHPDNRFFRTKPGRV |
| Ga0228694_1183102 | 3300023567 | Seawater | MTVIDKLNQKGIMRGFHVLDQKKFKEWLNDPDNRFFRTKQGRI |
| Ga0255147_10722682 | 3300024289 | Freshwater | DLNKQGVMRGFHILDNKRFKEFLNNPDNKVFRTREGRV |
| Ga0255141_10704471 | 3300024351 | Freshwater | IDDLNKQGIMRGFAVMDEKRFRAFLNNPDNRFFRTRPGQI |
| Ga0228632_10772152 | 3300024420 | Seawater | NKQKIMRGFHVLDVKQFKAFLNHPDNRFFRTKQGRI |
| Ga0208646_100201912 | 3300025425 | Saline Lake | NKKQIMQGFQVLDLKRFKAFLNHPDNRFFRTKPGKV |
| Ga0208424_10031164 | 3300025445 | Aqueous | IDDLNAKGVMRGFHVIDQTAFKAFLNNPDNRFFRTHPGHI |
| Ga0208413_11761111 | 3300025513 | Saline Lake | VIDDLNRKGIMRGFAVINEPEMKLFLNDTDNRFFRTRPGRV |
| Ga0209654_10559763 | 3300025608 | Marine | LTVIDDLNKAGIMRGFHVLDQKKFKAWLNNPDNRFFRTRQGRV |
| Ga0208771_11845932 | 3300025698 | Saline Lake | LTVIDDLNRKGIMRGFAVINEPEMKLFLNDPDNRFFRTRPGRV |
| Ga0208784_10648453 | 3300025732 | Aqueous | SIPLTVIDQLNKDGIMRGFHILDQKRFKAWLNERDNQAFRTRPGRI |
| Ga0208427_11394421 | 3300025771 | Aqueous | ASIPMVAIDELNKQGIMRGFHVLDQKKFKEFLNHPDNRFFRTKQGRI |
| Ga0208542_10837593 | 3300025818 | Aqueous | LTVIDTLNQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV |
| Ga0209308_100241405 | 3300025869 | Pelagic Marine | VIDSLNQKGIMRGFHVLDMPKFKAWLNDPDNRFFRTKQGRV |
| Ga0208644_11148874 | 3300025889 | Aqueous | PMVAIDELNKQGIMRGFHVLDQKKFKEFLNHPDNRFFRTKQGRI |
| Ga0255156_10117254 | 3300026478 | Freshwater | VIDDLNRKGIMRGFAVVDQGAFAAFLNNPENRYLRVRPGNV |
| Ga0255156_10867901 | 3300026478 | Freshwater | ARLPLTLVDDLNRKGIMQGFKVVDQTAFKAFLNHPDNRFFRTHPGRV |
| Ga0255075_10802272 | 3300027578 | Freshwater | LTVIDDLNAKGIMRGFAVIDEKQMKAWLNNPDNRFFRTRPGKV |
| Ga0208974_10431523 | 3300027608 | Freshwater Lentic | TIIDTLNRRGIMRGFAVIDEKEFKKFLNDPENRFFRTRPGKV |
| Ga0208975_11076592 | 3300027659 | Freshwater Lentic | IDSLNHKGIMRGFHIVDQKRFKEFLNNPDNRVFRTREGKV |
| Ga0209599_100096026 | 3300027710 | Deep Subsurface | LNRKGIMRGFAVINEKEFRKFLNDPDNRFFRTRPGRV |
| Ga0209246_101644871 | 3300027785 | Freshwater Lake | PMTVFDELNKKGIMRGFHVIDQKGFRRFLNDPDNKVFRTREGTV |
| Ga0209090_103725812 | 3300027813 | Marine | NQKQIMQGFHILDMKRFKEFLNNPDNRFFRTKPGRI |
| Ga0209253_101961464 | 3300027900 | Freshwater Lake Sediment | LVVIDDLNKKGIMRGFHVVDQARFKEWLNNPDNRAFRTRPGRV |
| Ga0247574_10161331 | 3300028092 | Seawater | NKQGIMRGFHVLDQKKFFAWLNDPDNRFFRTKQGRI |
| Ga0307379_104783933 | 3300031565 | Soil | DSLNQKGIMRGFHVLDMPRFKAWLNDPDNRFFRTKQGRV |
| Ga0308014_10580651 | 3300031628 | Marine | NQQGIMRGFHVLDMPKFKHWLNDPDNRFFRTKPGKV |
| Ga0315900_105353671 | 3300031787 | Freshwater | PLTVIDDLNRKGIMRGFKVVDDPAFRAFLNHPDNRFFRTHPGKV |
| Ga0315909_104357743 | 3300031857 | Freshwater | PNVVVDELNKQGIMRGFGVLDEKRFRAFLNNPDNRFFRTRPGQV |
| Ga0315909_104882053 | 3300031857 | Freshwater | TVIDDLNKKGIMRGFHILDNKRFKEFLNNPDNKVFRTREGRV |
| Ga0315901_107510072 | 3300031963 | Freshwater | IPMTVIDSLNHQGIMRGFHIVDQKRFKEFLNNPDNKVFRTREGRV |
| Ga0315902_103566061 | 3300032093 | Freshwater | NSVIADLNVQGIMRGFAVVDQKRMKAFLNDPANRFLRTRPGRI |
| Ga0315902_112469822 | 3300032093 | Freshwater | AELPNSVIADLNTKGIMRGFTVIDQKRMKAFLNDPENRYLRTRPGRV |
| Ga0315273_112780791 | 3300032516 | Sediment | LNKKGIMRGFHVIDQKGFRKFLNDPDNKVFRTREGTV |
| Ga0316616_1003311454 | 3300033521 | Soil | NSVIADLNAQGIMRGFTVVDQKRMKAFLNDPANRFLRTRPGRV |
| Ga0334995_0306959_901_1035 | 3300034062 | Freshwater | PYTVIDDLNRKGIMRGFAVVDESAFASFLNNPDNRFLRVRPGNI |
| Ga0335027_0791366_290_421 | 3300034101 | Freshwater | MTVIDDLNRKRVMQGFKVIDQKAFRAFLNHPDNRFFRTHPGHI |
| Ga0335029_0601001_1_126 | 3300034102 | Freshwater | VFDELNKKGIVRGFHVIDHKAFRRFLNDPDNKVFRTREGTV |
| Ga0335036_0619755_3_137 | 3300034106 | Freshwater | PNSVIADLNVKGIMRGFAVVDQKRMKAFLNDPENRFLRTRPGRI |
| Ga0348336_027567_2633_2749 | 3300034375 | Aqueous | TLNQKGIMRGFHVIDQKAFRVWLNDPDNRFFRTRQGKV |
| ⦗Top⦘ |