


| Basic Information | |
|---|---|
| Family ID | F073448 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 38 residues |
| Representative Sequence | QDGMRGARIAFLREVSNPAETRKVLVEMVQQARSQAE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 89.17 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.167 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 6.67 |
| PF13474 | SnoaL_3 | 2.50 |
| PF00144 | Beta-lactamase | 1.67 |
| PF03928 | HbpS-like | 1.67 |
| PF12867 | DinB_2 | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF13338 | AbiEi_4 | 0.83 |
| PF13519 | VWA_2 | 0.83 |
| PF03795 | YCII | 0.83 |
| PF01979 | Amidohydro_1 | 0.83 |
| PF03551 | PadR | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF01042 | Ribonuc_L-PSP | 0.83 |
| PF14659 | Phage_int_SAM_3 | 0.83 |
| PF02163 | Peptidase_M50 | 0.83 |
| PF14079 | DUF4260 | 0.83 |
| PF12796 | Ank_2 | 0.83 |
| PF02900 | LigB | 0.83 |
| PF00145 | DNA_methylase | 0.83 |
| PF03544 | TonB_C | 0.83 |
| PF07978 | NIPSNAP | 0.83 |
| PF00117 | GATase | 0.83 |
| PF07238 | PilZ | 0.83 |
| PF02547 | Queuosine_synth | 0.83 |
| PF11154 | DUF2934 | 0.83 |
| PF02586 | SRAP | 0.83 |
| PF04191 | PEMT | 0.83 |
| PF12728 | HTH_17 | 0.83 |
| PF05163 | DinB | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF00355 | Rieske | 0.83 |
| PF13398 | Peptidase_M50B | 0.83 |
| PF13883 | Pyrid_oxidase_2 | 0.83 |
| PF00406 | ADK | 0.83 |
| PF07676 | PD40 | 0.83 |
| PF00480 | ROK | 0.83 |
| PF14329 | DUF4386 | 0.83 |
| PF12681 | Glyoxalase_2 | 0.83 |
| PF03929 | PepSY_TM | 0.83 |
| PF01914 | MarC | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF01648 | ACPS | 0.83 |
| PF12844 | HTH_19 | 0.83 |
| PF00575 | S1 | 0.83 |
| PF04185 | Phosphoesterase | 0.83 |
| PF10518 | TAT_signal | 0.83 |
| PF01425 | Amidase | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.67 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.67 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.67 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.83 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.83 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.83 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.83 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.83 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.83 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.83 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.83 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.83 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.50 % |
| Unclassified | root | N/A | 27.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100476406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 624 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100045810 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100144588 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101091147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300002914|JGI25617J43924_10133064 | Not Available | 867 | Open in IMG/M |
| 3300004156|Ga0062589_102681578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 518 | Open in IMG/M |
| 3300005471|Ga0070698_100414191 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300005537|Ga0070730_10245719 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300005541|Ga0070733_10216309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1256 | Open in IMG/M |
| 3300005552|Ga0066701_10919655 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005556|Ga0066707_10503218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300005610|Ga0070763_10671138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300005712|Ga0070764_10560554 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005894|Ga0075270_1011096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1076 | Open in IMG/M |
| 3300005995|Ga0066790_10423914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300006052|Ga0075029_100089450 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300006052|Ga0075029_101175722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 535 | Open in IMG/M |
| 3300006059|Ga0075017_101486969 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006162|Ga0075030_100044041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3752 | Open in IMG/M |
| 3300006162|Ga0075030_100211070 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300006642|Ga0075521_10414016 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006642|Ga0075521_10426097 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006794|Ga0066658_10050922 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300006854|Ga0075425_101287010 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009029|Ga0066793_10832909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300009093|Ga0105240_10498686 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300009143|Ga0099792_11153891 | Not Available | 524 | Open in IMG/M |
| 3300009523|Ga0116221_1459362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009633|Ga0116129_1042839 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300009643|Ga0116110_1046348 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300010358|Ga0126370_10613151 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010373|Ga0134128_11934747 | Not Available | 649 | Open in IMG/M |
| 3300010376|Ga0126381_102030545 | Not Available | 828 | Open in IMG/M |
| 3300010398|Ga0126383_10378664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1445 | Open in IMG/M |
| 3300012200|Ga0137382_10420058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300012202|Ga0137363_10299166 | Not Available | 1321 | Open in IMG/M |
| 3300012202|Ga0137363_11490238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300012203|Ga0137399_11538891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300012207|Ga0137381_10587028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300012208|Ga0137376_11779902 | Not Available | 506 | Open in IMG/M |
| 3300012209|Ga0137379_10154972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2201 | Open in IMG/M |
| 3300012351|Ga0137386_10538564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 841 | Open in IMG/M |
| 3300013770|Ga0120123_1059667 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300014160|Ga0181517_10321254 | Not Available | 809 | Open in IMG/M |
| 3300014164|Ga0181532_10230543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300014169|Ga0181531_10432100 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300014199|Ga0181535_10614788 | Not Available | 622 | Open in IMG/M |
| 3300016422|Ga0182039_10022138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3944 | Open in IMG/M |
| 3300017927|Ga0187824_10145901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300017943|Ga0187819_10188558 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300017943|Ga0187819_10679556 | Not Available | 581 | Open in IMG/M |
| 3300017955|Ga0187817_10008331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5854 | Open in IMG/M |
| 3300017955|Ga0187817_10634030 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300017955|Ga0187817_10702339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300017959|Ga0187779_10855763 | Not Available | 623 | Open in IMG/M |
| 3300018006|Ga0187804_10345693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300018012|Ga0187810_10352443 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018026|Ga0187857_10367288 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300018034|Ga0187863_10132024 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300018043|Ga0187887_10374061 | Not Available | 841 | Open in IMG/M |
| 3300018086|Ga0187769_10705133 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300018482|Ga0066669_11001245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300019786|Ga0182025_1181616 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300020579|Ga0210407_11050484 | Not Available | 619 | Open in IMG/M |
| 3300020583|Ga0210401_10273133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1550 | Open in IMG/M |
| 3300020583|Ga0210401_10926967 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300021171|Ga0210405_10808465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300021178|Ga0210408_11242082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300021404|Ga0210389_10543589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300021405|Ga0210387_10073033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2810 | Open in IMG/M |
| 3300021420|Ga0210394_10743542 | Not Available | 858 | Open in IMG/M |
| 3300021420|Ga0210394_11100929 | Not Available | 685 | Open in IMG/M |
| 3300021474|Ga0210390_11560973 | Not Available | 521 | Open in IMG/M |
| 3300021559|Ga0210409_10341940 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300022877|Ga0224527_1081486 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025406|Ga0208035_1008804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1634 | Open in IMG/M |
| 3300025878|Ga0209584_10263122 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025916|Ga0207663_11535828 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025934|Ga0207686_10229028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300025987|Ga0208906_1009070 | Not Available | 784 | Open in IMG/M |
| 3300026334|Ga0209377_1122070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1043 | Open in IMG/M |
| 3300026524|Ga0209690_1195187 | Not Available | 650 | Open in IMG/M |
| 3300026872|Ga0207785_1002747 | Not Available | 1840 | Open in IMG/M |
| 3300027070|Ga0208365_1032084 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027648|Ga0209420_1120078 | Not Available | 735 | Open in IMG/M |
| 3300027748|Ga0209689_1167841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
| 3300027821|Ga0209811_10164179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 829 | Open in IMG/M |
| 3300027842|Ga0209580_10296948 | Not Available | 804 | Open in IMG/M |
| 3300027855|Ga0209693_10516993 | Not Available | 570 | Open in IMG/M |
| 3300027905|Ga0209415_10313314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300028563|Ga0265319_1189230 | Not Available | 633 | Open in IMG/M |
| 3300028776|Ga0302303_10078257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300028879|Ga0302229_10562738 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300029883|Ga0311327_10217562 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300029982|Ga0302277_1256593 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300029999|Ga0311339_11011017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 778 | Open in IMG/M |
| 3300029999|Ga0311339_11209336 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300030007|Ga0311338_11433402 | Not Available | 641 | Open in IMG/M |
| 3300030043|Ga0302306_10037825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1934 | Open in IMG/M |
| 3300030659|Ga0316363_10054147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1904 | Open in IMG/M |
| 3300030991|Ga0073994_12420357 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031231|Ga0170824_124973647 | Not Available | 621 | Open in IMG/M |
| 3300031236|Ga0302324_102023084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300031241|Ga0265325_10505092 | Not Available | 524 | Open in IMG/M |
| 3300031344|Ga0265316_11198409 | Not Available | 525 | Open in IMG/M |
| 3300031525|Ga0302326_11457152 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031715|Ga0307476_10126983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
| 3300031718|Ga0307474_10373688 | Not Available | 1106 | Open in IMG/M |
| 3300031718|Ga0307474_11291425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 576 | Open in IMG/M |
| 3300031942|Ga0310916_10518299 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031945|Ga0310913_10379046 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300031954|Ga0306926_10110868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3374 | Open in IMG/M |
| 3300032160|Ga0311301_12075003 | Not Available | 659 | Open in IMG/M |
| 3300032205|Ga0307472_101897704 | Not Available | 594 | Open in IMG/M |
| 3300032892|Ga0335081_10311644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 2077 | Open in IMG/M |
| 3300033134|Ga0335073_10118331 | All Organisms → cellular organisms → Bacteria | 3399 | Open in IMG/M |
| 3300033433|Ga0326726_11840769 | Not Available | 589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.67% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.83% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022877 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025987 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1004764061 | 3300001213 | Wetland | EDGVRGTRIAFLREVNNPEAVRKVLVEMVKHARSPAQ* |
| JGIcombinedJ26739_1000458106 | 3300002245 | Forest Soil | MRGAAIAFLREVSNPVEASKVLVKVVQQTRSRAE* |
| JGIcombinedJ26739_1001445885 | 3300002245 | Forest Soil | TPDGIRGTRIAFLREVSTPIEARKVLVEMVQQASQQV* |
| JGIcombinedJ26739_1010911473 | 3300002245 | Forest Soil | FHVSLNTTDGVRGARIAFPREARNSATTRAILVEMVRQARSQSE* |
| JGI25617J43924_101330641 | 3300002914 | Grasslands Soil | MGGDLAGGMRGARVAFLREVSNPAETRKVLVEMVQQARSQAE* |
| Ga0062384_1002573161 | 3300004082 | Bog Forest Soil | RLKTQDGMRGARIAFLLEVSSPEEARKVLIEMVGQAQRTPNT* |
| Ga0062589_1026815781 | 3300004156 | Soil | HIRAKTDDGMRGARVAFPREVRNSAEVRTIMIEMVQQARQT* |
| Ga0058899_101148242 | 3300004631 | Forest Soil | VRMKISGGMRGARIACLREVSSAAEARKVLVEMVQQARSQT* |
| Ga0070698_1004141912 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTRDGTRGARIAFLRAVNDPAETRKVLVEMVQQARSQAE* |
| Ga0070730_102457192 | 3300005537 | Surface Soil | DGMRGARIAFSREVSNPVETRKVLVEMVRQARLQTE* |
| Ga0070733_102163091 | 3300005541 | Surface Soil | KTQDGMRGARIAFLREVRDSAETRKVMVEMVQQAREK* |
| Ga0066701_109196551 | 3300005552 | Soil | DGMRGARIAFLREVSNPAETRKVLVEMVQQARSKV* |
| Ga0066707_105032181 | 3300005556 | Soil | FHVRVKTQDGMRGARVAFLRVVSNSAETRKVFVEMVQLARSRAE* |
| Ga0070763_106711381 | 3300005610 | Soil | DGMRGTRIAFLREAHNPKEARDVLIEMVQQARQK* |
| Ga0070764_105605542 | 3300005712 | Soil | FHVRVKTKDGVRSARIAFLREVNNPVEARTVLVEMVGQARRM* |
| Ga0075270_10110961 | 3300005894 | Rice Paddy Soil | PERVRGARIAFLREVTDSETARAVLIEMVQQARQR* |
| Ga0066790_104239141 | 3300005995 | Soil | TEEGMRGARIAFSREVTSSAETRKVLVEMVQQARSETE* |
| Ga0075029_1000894503 | 3300006052 | Watersheds | DGMRGARIAFLQEVRNAAEVRKVMVEMVQRARSQAN* |
| Ga0075029_1011757221 | 3300006052 | Watersheds | MRGARIAFLREASNAAETRNVLVEMVQQARSQPE* |
| Ga0075017_1014869691 | 3300006059 | Watersheds | NEIRGARIAFLREVSSPAETREVLVEMVQQARSRAE* |
| Ga0075030_1000440411 | 3300006162 | Watersheds | GMRGARIAFLREANNPAETRKVLVEMVQQARSQAK* |
| Ga0075030_1002110704 | 3300006162 | Watersheds | PDGMRGARIAFLREVSNGAATREVLKEMVQLARQQ* |
| Ga0075521_104140161 | 3300006642 | Arctic Peat Soil | DGIRGARIAFLREVSDLVQTREVFVEMVQQARQG* |
| Ga0075521_104260972 | 3300006642 | Arctic Peat Soil | DTQDGIRGTRIAFLREVSSPAETKEVLAEMVQQARQL* |
| Ga0066658_100509221 | 3300006794 | Soil | TRDGIRGARIAFLREVNNPAETRKVLVEMVQQARSQAE* |
| Ga0075425_1012870102 | 3300006854 | Populus Rhizosphere | DGMRGARIAFLQEVRDAAETRRVLVEMVQHARSQAK* |
| Ga0066793_108329092 | 3300009029 | Prmafrost Soil | QDGMRGARIAFLREVSNPAETRKVLVEMVQQARSQAE* |
| Ga0105240_104986863 | 3300009093 | Corn Rhizosphere | GVRGARIAFLREVRSPAETRKVLVEMVQQARSSAE* |
| Ga0099792_111538911 | 3300009143 | Vadose Zone Soil | TQDGMRGARVAFLREVSNPAEARMVLVEMVQQARS* |
| Ga0116221_14593622 | 3300009523 | Peatlands Soil | KTQDGTRGARIAFMREVSNPAEAGKVLVDMTAQARRI* |
| Ga0116129_10428393 | 3300009633 | Peatland | EGVRGARIAFLREVITPMEARKVLVEMVQQARQQIGALS* |
| Ga0116110_10463483 | 3300009643 | Peatland | MSGARIAFSHEVRNAAETRKVLVEMAQHARSQAK* |
| Ga0126370_106131511 | 3300010358 | Tropical Forest Soil | GMRGARIAFLQEVRDATETRKVLVEMVKQARSQRSEL* |
| Ga0134128_119347471 | 3300010373 | Terrestrial Soil | DGVRGARIAFLREVRSPAETRKVFVEMVQQARSSAG* |
| Ga0126381_1020305451 | 3300010376 | Tropical Forest Soil | TQDGVRGARIAFLREVCNPAEARTVLVEMVRQVRSQK* |
| Ga0126383_103786642 | 3300010398 | Tropical Forest Soil | KTNDGVRGTRIAFLREVATPAEAREVLVEMVRCARQG* |
| Ga0137382_104200581 | 3300012200 | Vadose Zone Soil | DGIRGARIAFLREVNSPAETRKVLVEMVQQARSQAE* |
| Ga0137363_102991661 | 3300012202 | Vadose Zone Soil | KTQDGMRGARIAFLREVNNPAETREVLVEMVQQARSRAE* |
| Ga0137363_114902382 | 3300012202 | Vadose Zone Soil | GFQVRLKTLDGPRGARIGFSREVRSPAEARNVLIEMVAQARQK* |
| Ga0137399_115388911 | 3300012203 | Vadose Zone Soil | DGMRGARIAFLREVSSPAEARKVLVEMVGQARRM* |
| Ga0137381_105870281 | 3300012207 | Vadose Zone Soil | VRLKTQDGTRGARITFVREVSSPAEAKKVLVEMVGQVRRM* |
| Ga0137376_117799022 | 3300012208 | Vadose Zone Soil | PDGMRGARIAFLREVGSTDETRKVLVEMVQQARTQ* |
| Ga0137379_101549721 | 3300012209 | Vadose Zone Soil | MRGARIAFSQEVRDAAETRKVLVEMVQQARSQGE* |
| Ga0137386_105385641 | 3300012351 | Vadose Zone Soil | IRGARIAFLREVNSPAETRKVLVEMVQQARSQAE* |
| Ga0120123_10596671 | 3300013770 | Permafrost | GMRGARIAFLREVSNPAETRKVLVEMVQQARSQAE* |
| Ga0181517_103212541 | 3300014160 | Bog | HVRVKMQDSIRGARIAFSREVTTPTEARMVLVEMVQQARDRH* |
| Ga0181532_102305431 | 3300014164 | Bog | TEDGMKGTRIAFLREVSDPAETREVFIEMVNQARQG* |
| Ga0181531_104321002 | 3300014169 | Bog | GFHIRLKTQDGASGARIAFVREVTNPAAARDVLVKMTAQARRG* |
| Ga0181535_106147881 | 3300014199 | Bog | GVRGGRIAFVREVSNPAETRNVLVEMVQQARQPDEPQHR* |
| Ga0182039_100221388 | 3300016422 | Soil | LKTKDGVRGTRIAFLREVVTPAESREVLVEIVRLARQG |
| Ga0187802_102400581 | 3300017822 | Freshwater Sediment | DGIRGVRVAFLREVHSASQAREVLVEMVQRARQQA |
| Ga0187824_101459012 | 3300017927 | Freshwater Sediment | LKTQDGMRGARVAFSREVRNAAEVRAVLVEMVAQARQK |
| Ga0187819_101885581 | 3300017943 | Freshwater Sediment | GMRGARIAFLREVSNPAETRQVLVEMVQQARSEAE |
| Ga0187819_106795561 | 3300017943 | Freshwater Sediment | TQEGMRGARIAFSREVTSAAEARTVLVEMVAQARQK |
| Ga0187817_100083311 | 3300017955 | Freshwater Sediment | TTPDGMRGARIAFLQEVRDAAETRKVLVEMVQQARSQAQ |
| Ga0187817_106340301 | 3300017955 | Freshwater Sediment | LKLETHEGMRGTRIAFLREVGNPSEARKMLVEMVHRARQR |
| Ga0187817_107023392 | 3300017955 | Freshwater Sediment | TEDGIRGARIAFLREVSNPAETRKVLVEMVQQARSEV |
| Ga0187779_108557632 | 3300017959 | Tropical Peatland | RLKTKDGMRGTRIAFLREVSSPIESREVLREMMKRARQS |
| Ga0187804_103456932 | 3300018006 | Freshwater Sediment | GMRGARIAFLQEVRDAAETRKVLVEMVQQARSQAQ |
| Ga0187810_103524431 | 3300018012 | Freshwater Sediment | ETHEGMRGTRIAFLREVGNPSEAREVLVEMVHQARRR |
| Ga0187857_103672882 | 3300018026 | Peatland | GMRGARIAFLREVSNPVETRKVLVEMVQQARSPTE |
| Ga0187863_101320241 | 3300018034 | Peatland | MRKNQDGAGGARIAFPREVSNAAEARDVLVGMTAQARRL |
| Ga0187887_103740611 | 3300018043 | Peatland | TQEGASGARIAFLREVSSPAEARDVLVEMTAQERRPSL |
| Ga0187769_107051331 | 3300018086 | Tropical Peatland | TLDGVRGARIAFLRKARDPLAARKVLVEMVRQARQG |
| Ga0066669_110012451 | 3300018482 | Grasslands Soil | TQEGMRGARVAFLREVSNPAEARMVLVEMVQQARSGAK |
| Ga0182025_11816164 | 3300019786 | Permafrost | TVWDFNVRLKTKDGTRGARIAFLREVSNPAEARKVLVEMTAQARRV |
| Ga0210407_110504842 | 3300020579 | Soil | TQDGMRGARIAFLREVTNSAETRKVLVEMVQQARSQAE |
| Ga0210401_102731331 | 3300020583 | Soil | LKTEDGTRGARIAFLREVSSPAEARQVLVEMVAEAR |
| Ga0210401_109269671 | 3300020583 | Soil | KTQDGTRGARIGFLREVSSPAEARKVLVEMVGQARRM |
| Ga0210405_108084652 | 3300021171 | Soil | FNVRLKTPERIRGARIAFLREVRTPEDARKVLIEMVNQARQP |
| Ga0210408_112420822 | 3300021178 | Soil | KTQDGMRGARIAFLREASNPAEARMVLVEMVQQARLRQRE |
| Ga0210389_105435891 | 3300021404 | Soil | HDGMRGARIAFSREVVSPAEARTVLVEMTQQARKG |
| Ga0210387_100730333 | 3300021405 | Soil | LKMQDGIRGLRIAFLREVGSPAEARQVLVEMVAQARRM |
| Ga0210394_107435421 | 3300021420 | Soil | TQDGMHGARIAFLREVSDPLQTREVLIEMVRQARQG |
| Ga0210394_111009292 | 3300021420 | Soil | QDGMRGVRIAFLREVSNPAEARKVLVEMVQQARSRAG |
| Ga0210390_115609731 | 3300021474 | Soil | GMRGVRIAFLREVSNPAEARKVLVEMVQQARSASAR |
| Ga0210409_103419401 | 3300021559 | Soil | TQDGTKGARIAFLREVSKPLETRKVLVEMVEKARSKPDRSKV |
| Ga0224527_10814861 | 3300022877 | Soil | TAEGVRGARIAFLHEVRNAGEARNVLVEMVNQARS |
| Ga0208035_10088041 | 3300025406 | Peatland | QDSIRGARIAFSREVTTPTEARMVLVEMVQQARDRH |
| Ga0209584_102631221 | 3300025878 | Arctic Peat Soil | DTQDGIRGTRIAFLREVSSPAETKEVLAEMVQQARQL |
| Ga0207663_115358282 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KTEDALRGARIAFLREANDPAETRKVLVEMVKQARSQAR |
| Ga0207686_102290281 | 3300025934 | Miscanthus Rhizosphere | TQEGMRGARIAFLQEVSNPAETRKVLVEMVQQARSQAE |
| Ga0208906_10090701 | 3300025987 | Rice Paddy Soil | PERVRGARIAFLREVTDSETARAVLIEMVQQARQR |
| Ga0209377_11220701 | 3300026334 | Soil | DALRGARIAFLREANNPAESRKVLVEMVKQARSEAR |
| Ga0209690_11951871 | 3300026524 | Soil | DGIRGARIAFLREVNSPAETRKVLVEMVQQARSQAE |
| Ga0207785_10027471 | 3300026872 | Tropical Forest Soil | VRMKTQDGTRGARVAFLREVGSPTEARNVLMDMVQQARQR |
| Ga0208365_10320842 | 3300027070 | Forest Soil | TPDGMKGARIAFLREVRNSGEARKVLVEMVQRARQQP |
| Ga0209420_11200781 | 3300027648 | Forest Soil | PAGMRGARIAFLREVRTSVETRKVLVEMVQKARPRPPA |
| Ga0209689_11678411 | 3300027748 | Soil | TRDGIRGARIAFLREVNNPAETRKVLVEMVQQARSQAE |
| Ga0209811_101641791 | 3300027821 | Surface Soil | DGMRGARIAFLRELSNPAETRKVLVEMVQYARSQAN |
| Ga0209580_102969481 | 3300027842 | Surface Soil | VKTADGARGARIAFLREARNPDEARKVLVEMVAKAREG |
| Ga0209693_105169931 | 3300027855 | Soil | GMRGARIAFLREVRTSVETRKVLVEMVQKARPRPPA |
| Ga0209415_103133142 | 3300027905 | Peatlands Soil | QDGMRGARIAFLREVSSPAETRKVLVEMVQQARQL |
| Ga0265319_11892302 | 3300028563 | Rhizosphere | LKTRDGASGARIAFLREVGTPAEARDVLVEMTQQARRV |
| Ga0302303_100782571 | 3300028776 | Palsa | RAERRSGRVMPLPNPQDGMRGARIAFLREVSTSAETRKVLVAMVHQARQQ |
| Ga0302229_105627382 | 3300028879 | Palsa | LKTAEGIRGARIAFTREVHNASEARKALVEMAQQARQPA |
| Ga0311327_102175621 | 3300029883 | Bog | SDGIRGARIAFLREVNNPVEARKVLVEMVQQARQRP |
| Ga0302277_12565931 | 3300029982 | Bog | TDDGVKGARIAFLREVGNANEARKVLVEMVQQARRQS |
| Ga0311339_110110171 | 3300029999 | Palsa | MPLPNPQDGMRGARIAFLREVSTSAETRKVLVAMVHQARQQ |
| Ga0311339_112093361 | 3300029999 | Palsa | QDGMKGARIGLLREVSNPGEARKVLVEMVQRARESV |
| Ga0311338_114334021 | 3300030007 | Palsa | ADGMKGCRVAFLRPVSTSAETRKMLVEMVQQARHS |
| Ga0302306_100378254 | 3300030043 | Palsa | LRLKTEDGTRSARIAFLREVSSAEEARTVLVEMVGQARRM |
| Ga0316363_100541471 | 3300030659 | Peatlands Soil | TPDGMRGARIAFLREVRNPKDARDVLIEMVQQARQR |
| Ga0073994_124203571 | 3300030991 | Soil | QDGTRGARIAFLREVSSPAEARKVLVEMAEQARRM |
| Ga0170824_1249736471 | 3300031231 | Forest Soil | KTQDGTRNARIAFLREVTNPTEARKVLVLMVGQARRM |
| Ga0302324_1020230843 | 3300031236 | Palsa | TADGTRGARIAFLREVRTPMEARNVLVEMVKQARQT |
| Ga0265325_105050922 | 3300031241 | Rhizosphere | KIQDGTRGSRIAFLQEVRTPAEARKVLVEMTAQARRI |
| Ga0265316_111984091 | 3300031344 | Rhizosphere | RLKTQEGMRGARIAFLREVSSSAEAREILVEMTAQARRI |
| Ga0302326_114571522 | 3300031525 | Palsa | GFYVRMKTADGPRGARIAFSREVDTAPEARSVLIEMVAQARQR |
| Ga0307476_101269831 | 3300031715 | Hardwood Forest Soil | LKTSEGMRGVRIAFPREVRNTTEARKVLVEMVQRVREQP |
| Ga0307474_103736882 | 3300031718 | Hardwood Forest Soil | MKGARIAFLREVINPGEARKVLVEMVQKARTEHSD |
| Ga0307474_112914252 | 3300031718 | Hardwood Forest Soil | LKTADGMRGARIAFLREVSNSQEVRTVLVQMVQQARS |
| Ga0310916_105182991 | 3300031942 | Soil | QTRDGIRGARIAFLREVSCSAETRKILAAMVQQARSKAE |
| Ga0310913_103790461 | 3300031945 | Soil | QTRDGIRGARIAFLQEVSCSAETRKILAAMVQQARSKAE |
| Ga0306926_101108688 | 3300031954 | Soil | EGMRGARIAFLTEVSNPAETRKVLVEMVQQARSQAK |
| Ga0311301_120750032 | 3300032160 | Peatlands Soil | QDGIRGTRIAFSRDVSNPAETRKVVVEMVQRARSQAR |
| Ga0307472_1018977042 | 3300032205 | Hardwood Forest Soil | KTLDSMRGARIAFLREASNPAETRKVLVEMVQQARSKAR |
| Ga0335081_103116441 | 3300032892 | Soil | DGMRGARIAFLREVSNPAETRNVLVEMVQQARSQAE |
| Ga0335073_101183314 | 3300033134 | Soil | KTPNGMRGARIAFLREASNPAETRKVLVEMVQQARSRAE |
| Ga0326726_118407691 | 3300033433 | Peat Soil | LKTQDGMLGARIAFSREVSNPAETRRVLVEMVQQAHPQAK |
| ⦗Top⦘ |