


| Basic Information | |
|---|---|
| Family ID | F073313 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MRLVRYLQHWLGGAGPRLHVADFVPDTHPIRQWADTFPWAALV |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.12 % |
| % of genes near scaffold ends (potentially truncated) | 86.67 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 4.17 |
| PF07592 | DDE_Tnp_ISAZ013 | 2.50 |
| PF13358 | DDE_3 | 2.50 |
| PF05598 | DUF772 | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF00106 | adh_short | 0.83 |
| PF00582 | Usp | 0.83 |
| PF14690 | zf-ISL3 | 0.83 |
| PF13359 | DDE_Tnp_4 | 0.83 |
| PF02446 | Glyco_hydro_77 | 0.83 |
| PF01078 | Mg_chelatase | 0.83 |
| PF13610 | DDE_Tnp_IS240 | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF03050 | DDE_Tnp_IS66 | 0.83 |
| PF03626 | COX4_pro | 0.83 |
| PF01627 | Hpt | 0.83 |
| PF08369 | PCP_red | 0.83 |
| PF01243 | Putative_PNPOx | 0.83 |
| PF13586 | DDE_Tnp_1_2 | 0.83 |
| PF05168 | HEPN | 0.83 |
| PF13701 | DDE_Tnp_1_4 | 0.83 |
| PF00665 | rve | 0.83 |
| PF07045 | DUF1330 | 0.83 |
| PF01909 | NTP_transf_2 | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF00239 | Resolvase | 0.83 |
| PF13546 | DDE_5 | 0.83 |
| PF13384 | HTH_23 | 0.83 |
| PF01610 | DDE_Tnp_ISL3 | 0.83 |
| PF16980 | CitMHS_2 | 0.83 |
| PF13480 | Acetyltransf_6 | 0.83 |
| PF11984 | DUF3485 | 0.83 |
| PF12759 | HTH_Tnp_IS1 | 0.83 |
| PF09954 | DUF2188 | 0.83 |
| PF09585 | Lin0512_fam | 0.83 |
| PF02653 | BPD_transp_2 | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 4.17 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 4.17 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 4.17 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 4.17 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 4.17 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 4.17 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.83 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.83 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.83 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.83 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.83 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.83 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.83 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.83 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.17 % |
| Unclassified | root | N/A | 10.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11273087 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1155 | Open in IMG/M |
| 3300005347|Ga0070668_100298752 | Not Available | 1350 | Open in IMG/M |
| 3300005544|Ga0070686_100221994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
| 3300005615|Ga0070702_101734645 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 520 | Open in IMG/M |
| 3300006796|Ga0066665_11655418 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006797|Ga0066659_10682944 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 838 | Open in IMG/M |
| 3300006844|Ga0075428_102760743 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 500 | Open in IMG/M |
| 3300006846|Ga0075430_101533116 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006853|Ga0075420_100605498 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300006854|Ga0075425_100722311 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1143 | Open in IMG/M |
| 3300006969|Ga0075419_10162581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1465 | Open in IMG/M |
| 3300007255|Ga0099791_10251961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 837 | Open in IMG/M |
| 3300009089|Ga0099828_10128950 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2218 | Open in IMG/M |
| 3300009089|Ga0099828_10190487 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300009090|Ga0099827_10527620 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1015 | Open in IMG/M |
| 3300009090|Ga0099827_10818376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300009100|Ga0075418_11490639 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 734 | Open in IMG/M |
| 3300009137|Ga0066709_104376004 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009143|Ga0099792_10825167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 609 | Open in IMG/M |
| 3300009146|Ga0105091_10450833 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 647 | Open in IMG/M |
| 3300009157|Ga0105092_10739421 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009455|Ga0114939_10510879 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009691|Ga0114944_1334162 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009691|Ga0114944_1394038 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 583 | Open in IMG/M |
| 3300009803|Ga0105065_1053765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300009803|Ga0105065_1067537 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 543 | Open in IMG/M |
| 3300009804|Ga0105063_1081532 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 517 | Open in IMG/M |
| 3300009808|Ga0105071_1094683 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 536 | Open in IMG/M |
| 3300009812|Ga0105067_1028947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 804 | Open in IMG/M |
| 3300009812|Ga0105067_1033965 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 759 | Open in IMG/M |
| 3300009812|Ga0105067_1036015 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 742 | Open in IMG/M |
| 3300009860|Ga0130032_1077484 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 557 | Open in IMG/M |
| 3300010043|Ga0126380_10996642 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300010043|Ga0126380_12187494 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010046|Ga0126384_10348127 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1234 | Open in IMG/M |
| 3300010046|Ga0126384_11601772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300010047|Ga0126382_12473162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia rosea | 506 | Open in IMG/M |
| 3300010358|Ga0126370_10580939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 963 | Open in IMG/M |
| 3300010358|Ga0126370_11095434 | Not Available | 734 | Open in IMG/M |
| 3300010359|Ga0126376_10159855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1817 | Open in IMG/M |
| 3300010359|Ga0126376_12974748 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 523 | Open in IMG/M |
| 3300010399|Ga0134127_12821222 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010400|Ga0134122_11385371 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 716 | Open in IMG/M |
| 3300011003|Ga0138514_100142938 | Not Available | 531 | Open in IMG/M |
| 3300012205|Ga0137362_10996149 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 714 | Open in IMG/M |
| 3300012207|Ga0137381_11743072 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 513 | Open in IMG/M |
| 3300012212|Ga0150985_101363035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1034 | Open in IMG/M |
| 3300012212|Ga0150985_115359700 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012355|Ga0137369_10441993 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 930 | Open in IMG/M |
| 3300012356|Ga0137371_10253892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1373 | Open in IMG/M |
| 3300012357|Ga0137384_11168743 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012360|Ga0137375_10155822 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2223 | Open in IMG/M |
| 3300012361|Ga0137360_11745224 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012402|Ga0134059_1061730 | Not Available | 579 | Open in IMG/M |
| 3300012469|Ga0150984_105827729 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 687 | Open in IMG/M |
| 3300012515|Ga0157338_1041466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300012517|Ga0157354_1071885 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 543 | Open in IMG/M |
| 3300012901|Ga0157288_10215898 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012907|Ga0157283_10223904 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012925|Ga0137419_11199732 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 635 | Open in IMG/M |
| 3300012930|Ga0137407_10810971 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 884 | Open in IMG/M |
| 3300012948|Ga0126375_10808345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 743 | Open in IMG/M |
| 3300012948|Ga0126375_10953750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 694 | Open in IMG/M |
| 3300012948|Ga0126375_11898960 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 523 | Open in IMG/M |
| 3300014879|Ga0180062_1095017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 676 | Open in IMG/M |
| 3300015371|Ga0132258_10937304 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
| 3300015371|Ga0132258_11286155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Pseudorivibacter → Pseudorivibacter rhizosphaerae | 1849 | Open in IMG/M |
| 3300015371|Ga0132258_13177348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1134 | Open in IMG/M |
| 3300018031|Ga0184634_10195424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 920 | Open in IMG/M |
| 3300018061|Ga0184619_10477828 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 553 | Open in IMG/M |
| 3300018063|Ga0184637_10012417 | All Organisms → cellular organisms → Bacteria | 5112 | Open in IMG/M |
| 3300018079|Ga0184627_10436522 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 681 | Open in IMG/M |
| 3300018079|Ga0184627_10457462 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 663 | Open in IMG/M |
| 3300018079|Ga0184627_10571154 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018466|Ga0190268_11656201 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 567 | Open in IMG/M |
| 3300018476|Ga0190274_12981786 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 568 | Open in IMG/M |
| 3300019789|Ga0137408_1028126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300022563|Ga0212128_10170140 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300022563|Ga0212128_10620736 | Not Available | 653 | Open in IMG/M |
| 3300025149|Ga0209827_11279866 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 717 | Open in IMG/M |
| 3300025157|Ga0209399_10394094 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 538 | Open in IMG/M |
| 3300025160|Ga0209109_10467079 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 578 | Open in IMG/M |
| 3300025660|Ga0209045_1104355 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → Methanosarcina mazei | 839 | Open in IMG/M |
| 3300025900|Ga0207710_10229275 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 924 | Open in IMG/M |
| 3300025908|Ga0207643_10673025 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025910|Ga0207684_11745261 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 500 | Open in IMG/M |
| 3300026119|Ga0207966_1023055 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300026535|Ga0256867_10004306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6210 | Open in IMG/M |
| 3300027163|Ga0209878_1024511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 800 | Open in IMG/M |
| 3300027862|Ga0209701_10341497 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 850 | Open in IMG/M |
| 3300027875|Ga0209283_10236614 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300027882|Ga0209590_10381402 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 910 | Open in IMG/M |
| 3300027909|Ga0209382_11433740 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027909|Ga0209382_11761889 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 605 | Open in IMG/M |
| 3300027961|Ga0209853_1125126 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300028536|Ga0137415_10799395 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 754 | Open in IMG/M |
| 3300028608|Ga0247819_10434514 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 764 | Open in IMG/M |
| 3300028878|Ga0307278_10163634 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300030496|Ga0268240_10151942 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 571 | Open in IMG/M |
| 3300030902|Ga0308202_1122176 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 557 | Open in IMG/M |
| 3300030990|Ga0308178_1070908 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 691 | Open in IMG/M |
| 3300031114|Ga0308187_10370618 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 558 | Open in IMG/M |
| 3300031198|Ga0307500_10304155 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031548|Ga0307408_100252275 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300031573|Ga0310915_11090481 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 555 | Open in IMG/M |
| 3300031731|Ga0307405_10404866 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1069 | Open in IMG/M |
| 3300031804|Ga0310124_10330753 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → Rhodopirellula europaea | 917 | Open in IMG/M |
| 3300031833|Ga0310917_10582566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 760 | Open in IMG/M |
| 3300031945|Ga0310913_10860138 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 638 | Open in IMG/M |
| 3300032000|Ga0310903_10531059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 618 | Open in IMG/M |
| 3300032180|Ga0307471_101267675 | Not Available | 900 | Open in IMG/M |
| 3300032180|Ga0307471_104096767 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 515 | Open in IMG/M |
| 3300034177|Ga0364932_0120614 | Not Available | 997 | Open in IMG/M |
| 3300034676|Ga0314801_040379 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.67% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.83% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.83% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009860 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 12m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025660 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026119 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_112730873 | 3300000890 | Soil | RLVRYLQYWLSGTGAPLHVADFVPETHPIRQWADTFPWAAL |
| Ga0070668_1002987524 | 3300005347 | Switchgrass Rhizosphere | MSLVRYLQPWLRGPGVPLHVAACVPATHPMRPWAATFPWAALVAAMERSFAPR |
| Ga0070686_1002219943 | 3300005544 | Switchgrass Rhizosphere | MGLIRHLQYWLRGTGTPLHVTDFVPQTAPIRQWADTFPWAALVRAIEQSFDKRFPK |
| Ga0070702_1017346451 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLRHLQHWLTGTGRPLRVADFVPESHPIRQWADTFPWAALVAAVERNFAQRFPTPTA |
| Ga0066903_1014382312 | 3300005764 | Tropical Forest Soil | MRLLHHLQHGLRGSGPRLQVADVVPKTDSIRQWTDTFPWAKLVEAVE* |
| Ga0066665_116554181 | 3300006796 | Soil | MRLFRHLQHWLTGCGPRLRGADFVPVMHPIRQWADTCPWAAL |
| Ga0066659_106829442 | 3300006797 | Soil | MRFVRYLQHWLGGTGARLQVTDFVPVLHPIRQWADTFPWAALVSAIEESFDTRFPKKSP |
| Ga0075428_1027607431 | 3300006844 | Populus Rhizosphere | MMRLVRYLQHWLGGAGPRLQVADFVPDTHPIRQWANTFPWAALVAAVEHSFAQRFPK |
| Ga0075430_1015331162 | 3300006846 | Populus Rhizosphere | MRLVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTFPWA |
| Ga0075420_1006054983 | 3300006853 | Populus Rhizosphere | MGLMRHLQHWLRGTGPPLHVTDFIPQTDPIRQWADTFPWAALVSATDS* |
| Ga0075425_1007223113 | 3300006854 | Populus Rhizosphere | MRLVRYLQHWLGGAGPRLHVADCVPDTHPIRPWAD |
| Ga0075419_101625811 | 3300006969 | Populus Rhizosphere | MRLVRHLQHWLNGPGTPLQVIDFVPKTPPIRQWADTFPWAALGGA |
| Ga0099791_102519611 | 3300007255 | Vadose Zone Soil | MRLVRCLQHWLSGTDPRLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFA |
| Ga0099828_101289504 | 3300009089 | Vadose Zone Soil | MGLVRSLQHWLRGTGAPLHVADFVPDTPPMRPWADTFPWAALVAAIAPSFAQRFP* |
| Ga0099828_101904872 | 3300009089 | Vadose Zone Soil | MRLARFLQHWLSGTGTRLHVTDFVPEPHPIRQWADTFPWTALVRAIEYSFPTRFP |
| Ga0099827_105276202 | 3300009090 | Vadose Zone Soil | MRLVRSLQHWLSGTDPRLHITDFVPEGHPIRQWADTFPWATLVSAIEQSFATRFPKKS |
| Ga0099827_108183761 | 3300009090 | Vadose Zone Soil | MRLLRHLQHWFTGHGLQIAVADFVPETHPIRQWADTFP |
| Ga0075418_114906391 | 3300009100 | Populus Rhizosphere | VYYLQHWLGGTGAHLQVADFVPSMHPIRQWADTFPWGALVRAIAQS |
| Ga0066709_1043760041 | 3300009137 | Grasslands Soil | MRFLRYLQHWLTGHGTSLQVADFVPTTHPIRQGAETLPWAALVAAIDLSVTPR |
| Ga0099792_108251671 | 3300009143 | Vadose Zone Soil | MRLLRHLQHWLTGQGFEIAVAEFVPETHPIRQWADT |
| Ga0105091_104508331 | 3300009146 | Freshwater Sediment | MQLLRYLQHWLTGHGPCLQVADFVPETHPLRQWADTF |
| Ga0105092_107394211 | 3300009157 | Freshwater Sediment | MPLLQYLQHWLTGRRPRLQVADFVPDTHPIRQWADT |
| Ga0114939_105108791 | 3300009455 | Groundwater | MRLLRTLQHWLTGRGPCLQVADFVPETHPLRQWADT |
| Ga0114944_13341622 | 3300009691 | Thermal Springs | MRILRHLQHWLTGHGFHIAVADFVPETHPVRQWADTFPWAALVA |
| Ga0114944_13940381 | 3300009691 | Thermal Springs | MRLLRHLQHWLTGHGLQIAVADFVPETHPIRQWADTFPWTALVAAVDRSVAQR |
| Ga0126374_105023751 | 3300009792 | Tropical Forest Soil | MRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFP |
| Ga0105065_10537652 | 3300009803 | Groundwater Sand | MRLLRHLQHWLTGQGLHIAVAEFVPETHPVRQWADTFPWAALVAAVDR |
| Ga0105065_10675372 | 3300009803 | Groundwater Sand | MRLVHYLQHWLSGRGTPLQVTDFVPASHPLRQWADTFPWVALVSA |
| Ga0105063_10815321 | 3300009804 | Groundwater Sand | VRLVRYLQHWLSGTGQCLYVADFVPDTHPIRQWADTFPWAAL |
| Ga0105071_10946831 | 3300009808 | Groundwater Sand | MQLLRYLQHWLTGRGPCLQVGDFVPKTHPLRQWADTFPWAALVAAVDRSFAQRFPKP |
| Ga0105067_10289471 | 3300009812 | Groundwater Sand | MRLIRHLQHWLGGSGPRLRVADIVPKTHSIRQWADTFPWTEMVE |
| Ga0105067_10339651 | 3300009812 | Groundwater Sand | MRLLRHLQHWLTGPGRPLVVTDFVPETPRLRQWADTFPWTALVAAVE |
| Ga0105067_10360151 | 3300009812 | Groundwater Sand | MRLVRSLQHWLSGTGVPLPVTDFVPESHPLRQWADTFPWAAL |
| Ga0105082_11257381 | 3300009814 | Groundwater Sand | MRLLRHLQHGRSGSGPRLHVADVVPQTHAIRRWAETFPWAKWV |
| Ga0130032_10774842 | 3300009860 | Meromictic Pond | MSMLRHLCHWLTGRGQRIPVSEFVPPTHPLRQWADTCPWAAWIRAIEASFA |
| Ga0126380_109966422 | 3300010043 | Tropical Forest Soil | MRFVHYLQHWLGGTRAPLQVTDFVPVIHPIRQWAD |
| Ga0126380_121874941 | 3300010043 | Tropical Forest Soil | MRLVRYLQHWLSSIGPRLQVADFVPDSHPIRQWADTFPW |
| Ga0126384_103481271 | 3300010046 | Tropical Forest Soil | MQLFRYLQHWLTGRGPCLQVADFVPETHPLRQWTETFPWAALVAAV |
| Ga0126384_116017722 | 3300010046 | Tropical Forest Soil | MRVVHYLRHWLGGTGARLQVTDFVPVMHPIRQWADTLPWAALVSAIE |
| Ga0126382_124731621 | 3300010047 | Tropical Forest Soil | MRFVHYLQHWLGGSGARLQVTDFVPVMHPIRQWADTFPWAALVSAIEQS |
| Ga0126370_105809391 | 3300010358 | Tropical Forest Soil | MRLLRHLQHWLSSSGPRLPVADVVPKTNSIRRWADTFPWAKLVAAVEQSVASRFPKRSPLNF* |
| Ga0126370_110954342 | 3300010358 | Tropical Forest Soil | MRLVRYLQHWLGGTGPHLQVTDFVPDAHPIRQWADTFPWPMLVAAIEQSF |
| Ga0126376_101598551 | 3300010359 | Tropical Forest Soil | MRLVRYLQHWLGGAGPRLHVADFVPDTHPIRQWADTFPWAALV |
| Ga0126376_129747481 | 3300010359 | Tropical Forest Soil | MPLLRHLQHWLRGSGPRLQVADVVPKTDSIRQWTDTFPWAKLVEAVEQSCARRFP |
| Ga0134127_128212222 | 3300010399 | Terrestrial Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVSA |
| Ga0134122_113853711 | 3300010400 | Terrestrial Soil | MRLLRHLQHWLRGSGPRLQVADVVPKTNSIRQWTDTFPWAKLVEAVEQSCASRFPKRAPG |
| Ga0138514_1001429381 | 3300011003 | Soil | MGLIRHLQHWLRGTGTPLHVTDFVPQTDPIRQWADTF |
| Ga0137362_109961492 | 3300012205 | Vadose Zone Soil | MPLLRYLQHWLTGRGPRLQVADFVPETHSLRQWADTF |
| Ga0137381_117430721 | 3300012207 | Vadose Zone Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALISAIEQSFD |
| Ga0150985_1013630353 | 3300012212 | Avena Fatua Rhizosphere | MRLVHYLQHWLSGTGTRLQVTDFVPESHPIRQWADTFPWAALVSAIEHSFAARFPTRS |
| Ga0150985_1153597001 | 3300012212 | Avena Fatua Rhizosphere | MHLVRSLHHWMSGIGPRLHVADCVPDRHPIRQGADTFP |
| Ga0137369_104419933 | 3300012355 | Vadose Zone Soil | MPLLRYLQHWLTGRGPRLQVADFVPETHSLRQWADTFPWAALVAAVDRSFAQRFPKP |
| Ga0137371_102538921 | 3300012356 | Vadose Zone Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAA |
| Ga0137384_111687432 | 3300012357 | Vadose Zone Soil | MRLVHFLQHWLSGTGTRLHVTDVVPESHPIRQWAETFPWAALVSAIE |
| Ga0137375_101558223 | 3300012360 | Vadose Zone Soil | MQILRFLQHWLTGRGPCLQVADFVPETHPLRQWAETFPWAALGRSR* |
| Ga0137360_117452242 | 3300012361 | Vadose Zone Soil | MRLARFLQHWLSGTGIRLQVTDFVPEPHPIRQWADTFPWTALV |
| Ga0134059_10617303 | 3300012402 | Grasslands Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVR |
| Ga0150984_1058277291 | 3300012469 | Avena Fatua Rhizosphere | MRLLRYLQHWVSGTGLPLQVVDFVPDTDPIRQWADTFPWPA |
| Ga0157338_10414662 | 3300012515 | Arabidopsis Rhizosphere | MGLVRYLQHWLSGTGAPLHVADFVPDTHPIRQWTETF |
| Ga0157354_10718851 | 3300012517 | Unplanted Soil | MRFVRYLQPWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALLSAIEQSFA |
| Ga0157288_102158982 | 3300012901 | Soil | MRLVRYLQHWWGGAGPRLHVADCVPDTHPIRPWADTCPWAALVAAVEHSFAQRFPKRA |
| Ga0157283_102239041 | 3300012907 | Soil | MRLVRYLQHWLGGAGPRLHVADCVPDTHPIRPWADTCPWAALVA |
| Ga0137419_111997321 | 3300012925 | Vadose Zone Soil | MRLLRGLQHWLSGTGLPLHVADFVPDTHPIRQWADTFPWTALVA |
| Ga0137407_108109711 | 3300012930 | Vadose Zone Soil | MPILRYLQHWLTGRGACLQGAAFVPDTHPLRQWADTF |
| Ga0126375_108083452 | 3300012948 | Tropical Forest Soil | MRLLRHLQHWLSSSGPRLQVADVVPKTNSIRRWADTFPWAKLVAAVEQSVASRFPKRSPLNF* |
| Ga0126375_109537501 | 3300012948 | Tropical Forest Soil | MRLVRYLQHWLGGTGTRLQVTDFVPVMHPIRQWADTFPWAALVRAI* |
| Ga0126375_118989602 | 3300012948 | Tropical Forest Soil | MRVVRYLQHWLSGPGAPLQVADFVPVMHPIRQWADTFPWMA |
| Ga0163162_124618872 | 3300013306 | Switchgrass Rhizosphere | MRLLRHLQHWLRGSGPRLQVADVVPKTNAIRQWTDTFPWAK |
| Ga0180062_10950172 | 3300014879 | Soil | MRLVHYLQHWLGGTGARLQVTDFVPIMHPIRQWADTFPWAALV |
| Ga0132258_109373044 | 3300015371 | Arabidopsis Rhizosphere | MRLVRYLQHWLGGAGPRLQVAVFVPDTHPLRQWADTFPWAVLVAAVE |
| Ga0132258_112861551 | 3300015371 | Arabidopsis Rhizosphere | MRVVHYLRHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALLSAIEQSFAPRFPKKSS |
| Ga0132258_131773483 | 3300015371 | Arabidopsis Rhizosphere | MRLLRYLQHWLTGAGRLIRVADFVPESHPVRQWADTFPWTVLIAAVERNFAQ |
| Ga0184634_101954241 | 3300018031 | Groundwater Sediment | MRILRHLQHWFTGQGFHIAVADFVPETHPVRQWADTFPWAALVAAVERSGA |
| Ga0184619_104778281 | 3300018061 | Groundwater Sediment | MGLIRHLQHWLRGTGTPLHVTDFVPQTDPIRQWADTFPWAALVRAIEQSFDNRF |
| Ga0184637_100124176 | 3300018063 | Groundwater Sediment | MRLVRYLQHWLSDTGTPLQVTDFVPKTHPIRQWADTFPWAALVSAIE |
| Ga0184627_104365221 | 3300018079 | Groundwater Sediment | MRLLRHLQPWFTGQGFPIAVADFVPETQPVRQWADTLPWAA |
| Ga0184627_104574621 | 3300018079 | Groundwater Sediment | MRLLRGLQHWLSGTGLPLQVADFVPDTHPIRQWADTFPWTALVAAIEHSFATRFPK |
| Ga0184627_105711541 | 3300018079 | Groundwater Sediment | MSLLRHLQHWLTGPGRPLAVADFVPETHPLRQWADTF |
| Ga0190268_116562012 | 3300018466 | Soil | MPLLRDLQHWLTGRGPYLQVADFVPATHPLRQWADTFPWAAVVAAVDRRF |
| Ga0190274_129817861 | 3300018476 | Soil | MRLLSHLQHWLSGQGPRLQVADFVPETHPICQWADTFPWAALVDAVDKSVAERFPK |
| Ga0137408_10281262 | 3300019789 | Vadose Zone Soil | MRLFRHLQHWLGGNGSRLQVADVVPHTHSIRQWADT |
| Ga0212128_101701404 | 3300022563 | Thermal Springs | MGIVRQLQHWLGGSGPRLRVHDVVPLDHPLRLWADTFPWSQMTDALEQSFQR |
| Ga0212128_106207361 | 3300022563 | Thermal Springs | MQLLRYLQHWLTGRGPCLQVADFVPETHPIRQWADTFPWAALV |
| Ga0209827_112798661 | 3300025149 | Thermal Springs | MRLLRTLQHWLTGRGPCLQVADFVPETHPLRQWADTFPWAALVAAVD |
| Ga0209399_103940941 | 3300025157 | Thermal Springs | MRLFRHLQHWLTGCGPRLRVADFVPVMHPIRQWADTFPWAALVAALERSFAQRFPTDSSR |
| Ga0209109_104670792 | 3300025160 | Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMDPIRQWADTFPWAALVSAIEQSFDTRFPKK |
| Ga0209045_11043551 | 3300025660 | Marine | MGIVRQLQHWLGGKGPRLVVADFVPEDHPLRLWSDTFP |
| Ga0207710_102292752 | 3300025900 | Switchgrass Rhizosphere | MGLLRHLQHWLTGAGRPLQVADFVPETHPVRQWADTFPWAALVAAVERNF |
| Ga0207643_106730252 | 3300025908 | Miscanthus Rhizosphere | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTFPWAALVSAIEQSFAT |
| Ga0207684_117452612 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFVRYLQHWLGGTGARLQVADFVPVMHPIRQWADPFP |
| Ga0207703_121901092 | 3300026035 | Switchgrass Rhizosphere | MRLLRHLQHWLRGSGPRLQVADVVPKTNAIRQWTDTFPWAKLV |
| Ga0207966_10230554 | 3300026119 | Marine | MRTLRQLRHWLTDRGQRIPVSDFVSPTHPLRQWSDTFPWAA |
| Ga0256867_100043065 | 3300026535 | Soil | MGLVHHFQHWLRGAGTPLQVTDFIPQSDPIRQWADTFPWDALVQAI |
| Ga0209878_10245111 | 3300027163 | Groundwater Sand | MRLLRHLQHGRSGSGPRLHVADVVPQTHAIRRWAETFPWSK |
| Ga0209701_103414972 | 3300027862 | Vadose Zone Soil | MRLVRSLQHGLNGTGTRLHVTDFVPETDPIRRWADTFPWATLVGAIEHSVAKR |
| Ga0209283_102366141 | 3300027875 | Vadose Zone Soil | MRLVRSLQHWLSGTDPHLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFA |
| Ga0209590_103814022 | 3300027882 | Vadose Zone Soil | MRLVRSLQHWLSGTDPHLHVTDFVPEGHPIRQWADTFPWATLVSAIEQSFATRFPKKS |
| Ga0209382_114337401 | 3300027909 | Populus Rhizosphere | MRLVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTFPWAA |
| Ga0209382_117618892 | 3300027909 | Populus Rhizosphere | MPLLRYLQHWLTGRGPCLQVADFVPETHPLRQWAETFPWAALVRGRGPLV |
| Ga0209853_11251262 | 3300027961 | Groundwater Sand | MRLLRHLQHWLTGPGRPLVVADFVPETHPLRQWADTFP |
| Ga0137415_107993951 | 3300028536 | Vadose Zone Soil | MRVVRYLQHWWGGAGPCLPVADFVPDTHPLRPWADTFPWAALVTAI |
| Ga0247819_104345142 | 3300028608 | Soil | MRFVRYLQHWLSGTGARLQVTDFVPVMHPIRQWADTLP |
| Ga0307278_101636342 | 3300028878 | Soil | MQLLRYLQHWLTGRGPRLQVAEFVPETQPIRQWADTLPWAGLVA |
| Ga0268240_101519421 | 3300030496 | Soil | MRLVRYLQHWLSGPGVPLHVADFVPDTHPIRQWADTFPWAALGAAIEHSFAQRFP |
| Ga0308202_11221761 | 3300030902 | Soil | MGLLRHLQHWLRGTGTPLPVTDFVPQTDPIRQWADTFPWAALVSATEQS |
| Ga0308178_10709082 | 3300030990 | Soil | MGLLRHLQHWLRGTVTPLPVTDFVPQTDPIRQWADTFPWAALVSA |
| Ga0308187_103706182 | 3300031114 | Soil | MRLLRGLQHWLSGTGLPLQVADFVPDTHPIRQWADTFPWTALVAALERSFATRFP |
| Ga0307500_103041551 | 3300031198 | Soil | MRIVRHLQHWLTGRGPRLQVIDFVPETHPLRQWADTFPWAALGAAVDRSV |
| Ga0307408_1002522752 | 3300031548 | Rhizosphere | MRLIHYLQHWLRGTGPRLQVADFVPDTHPIRPWADAFPWVALVTAIEHSFTTRFPKR |
| Ga0310915_110904811 | 3300031573 | Soil | MRLLRHLQHWLSGSGPRLQVAAVVPLTHSMRQWTDTFPWAKMVEAVEQSFARRFPKRAQGGRHP |
| Ga0307405_104048661 | 3300031731 | Rhizosphere | MPLLRSLQPWLTGRGPGLQVADFVPETHPVRQWADTFPWAALVAAIDRRF |
| Ga0310124_103307531 | 3300031804 | Marine | MGFVRQLQHWLSGQGPRLVVADFVPEDHPLRLWADTFPWAPMV |
| Ga0310917_105825661 | 3300031833 | Soil | MGLVRYLQHWLSGTGTPLQVTDFVPQSDPIRQWADTFP |
| Ga0310913_108601382 | 3300031945 | Soil | MRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFPWAKMVEAVEHSFARRFPKR |
| Ga0310903_105310591 | 3300032000 | Soil | MRLVRYLQHGLGGVGPRLHVADFVPDTHPLRQWADSFPWAALVAAVEHSFA |
| Ga0310911_100285231 | 3300032035 | Soil | MRLLRHLQHWLSGSGPRLQVAAVVPPTHSIRQWTDTFPWV |
| Ga0307471_1012676752 | 3300032180 | Hardwood Forest Soil | MRFVRYLQHWLGGTGARLQVTDFVPVMHPIRQWADTF |
| Ga0307471_1040967671 | 3300032180 | Hardwood Forest Soil | VQLLRYLQHWLTGRGPCLQVADFVPETHPIRQWAETLPWAPLVAAVDHSFA |
| Ga0364932_0120614_873_995 | 3300034177 | Sediment | MQILRYLQHWLTGGGPCLQVADFVPATHPLRQWAETFPWAA |
| Ga0314801_040379_711_887 | 3300034676 | Soil | MRLMRYLQHWLGGAGPRLQVADFVPDTHPLRQWADTFPWAVLVAAVEHSFAQRFPKRSP |
| ⦗Top⦘ |