


| Basic Information | |
|---|---|
| Family ID | F073294 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFED |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.83 % |
| % of genes near scaffold ends (potentially truncated) | 90.83 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (47.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.92% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 5.00 |
| PF00106 | adh_short | 3.33 |
| PF00171 | Aldedh | 2.50 |
| PF00561 | Abhydrolase_1 | 2.50 |
| PF08546 | ApbA_C | 1.67 |
| PF13495 | Phage_int_SAM_4 | 1.67 |
| PF00496 | SBP_bac_5 | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| PF13379 | NMT1_2 | 0.83 |
| PF01035 | DNA_binding_1 | 0.83 |
| PF07476 | MAAL_C | 0.83 |
| PF06742 | DUF1214 | 0.83 |
| PF12705 | PDDEXK_1 | 0.83 |
| PF03050 | DDE_Tnp_IS66 | 0.83 |
| PF02371 | Transposase_20 | 0.83 |
| PF08388 | GIIM | 0.83 |
| PF00872 | Transposase_mut | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| PF07929 | PRiA4_ORF3 | 0.83 |
| PF00885 | DMRL_synthase | 0.83 |
| PF13185 | GAF_2 | 0.83 |
| PF00239 | Resolvase | 0.83 |
| PF13436 | Gly-zipper_OmpA | 0.83 |
| PF13738 | Pyr_redox_3 | 0.83 |
| PF02738 | MoCoBD_1 | 0.83 |
| PF01425 | Amidase | 0.83 |
| PF00536 | SAM_1 | 0.83 |
| PF13737 | DDE_Tnp_1_5 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.50 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.50 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.50 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.67 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.83 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.83 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.83 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.83 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.83 |
| COG3799 | Methylaspartate ammonia-lyase | Amino acid transport and metabolism [E] | 0.83 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.83 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.83 % |
| Unclassified | root | N/A | 49.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_100728469 | Not Available | 730 | Open in IMG/M |
| 3300005171|Ga0066677_10270485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300005184|Ga0066671_10991931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300005187|Ga0066675_10241414 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300005332|Ga0066388_102178720 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005332|Ga0066388_106009122 | Not Available | 613 | Open in IMG/M |
| 3300005436|Ga0070713_100661201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300005471|Ga0070698_101562152 | Not Available | 612 | Open in IMG/M |
| 3300005554|Ga0066661_10757254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300005569|Ga0066705_10638483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300005764|Ga0066903_101496168 | Not Available | 1274 | Open in IMG/M |
| 3300005921|Ga0070766_10875253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 614 | Open in IMG/M |
| 3300006800|Ga0066660_11092921 | Not Available | 633 | Open in IMG/M |
| 3300006852|Ga0075433_10730365 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009089|Ga0099828_11606650 | Not Available | 572 | Open in IMG/M |
| 3300009090|Ga0099827_11820192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300009137|Ga0066709_104294362 | Not Available | 520 | Open in IMG/M |
| 3300009792|Ga0126374_11230871 | Not Available | 601 | Open in IMG/M |
| 3300009826|Ga0123355_11446764 | Not Available | 675 | Open in IMG/M |
| 3300010048|Ga0126373_10546798 | Not Available | 1205 | Open in IMG/M |
| 3300010359|Ga0126376_10943599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300010359|Ga0126376_11150697 | Not Available | 787 | Open in IMG/M |
| 3300010361|Ga0126378_10017705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6058 | Open in IMG/M |
| 3300010361|Ga0126378_10274129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1786 | Open in IMG/M |
| 3300010361|Ga0126378_10738196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1095 | Open in IMG/M |
| 3300010366|Ga0126379_10754811 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300010376|Ga0126381_100710928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300011270|Ga0137391_11556326 | Not Available | 505 | Open in IMG/M |
| 3300012203|Ga0137399_10361612 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300012203|Ga0137399_10551879 | Not Available | 968 | Open in IMG/M |
| 3300012357|Ga0137384_10633311 | Not Available | 871 | Open in IMG/M |
| 3300012359|Ga0137385_10963033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300012948|Ga0126375_10394584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 998 | Open in IMG/M |
| 3300012971|Ga0126369_13712799 | Not Available | 500 | Open in IMG/M |
| 3300016319|Ga0182033_10342150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1248 | Open in IMG/M |
| 3300016319|Ga0182033_10636089 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300016319|Ga0182033_12013119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300016357|Ga0182032_11635056 | Not Available | 561 | Open in IMG/M |
| 3300016371|Ga0182034_10588186 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300016387|Ga0182040_10329761 | Not Available | 1177 | Open in IMG/M |
| 3300016387|Ga0182040_10610324 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300016387|Ga0182040_10916815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300016404|Ga0182037_10098142 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300016422|Ga0182039_11772880 | Not Available | 565 | Open in IMG/M |
| 3300016445|Ga0182038_11559070 | Not Available | 594 | Open in IMG/M |
| 3300017959|Ga0187779_10505752 | Not Available | 800 | Open in IMG/M |
| 3300018468|Ga0066662_10116950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1935 | Open in IMG/M |
| 3300018482|Ga0066669_10844362 | Not Available | 815 | Open in IMG/M |
| 3300020580|Ga0210403_10080845 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300020580|Ga0210403_10132741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2030 | Open in IMG/M |
| 3300021086|Ga0179596_10501921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300021178|Ga0210408_11400486 | Not Available | 527 | Open in IMG/M |
| 3300021405|Ga0210387_11482814 | Not Available | 581 | Open in IMG/M |
| 3300021432|Ga0210384_11283730 | Not Available | 637 | Open in IMG/M |
| 3300026542|Ga0209805_1135408 | Not Available | 1150 | Open in IMG/M |
| 3300027783|Ga0209448_10185874 | Not Available | 691 | Open in IMG/M |
| 3300030763|Ga0265763_1042549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300030945|Ga0075373_11561648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 888 | Open in IMG/M |
| 3300031057|Ga0170834_100208226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300031231|Ga0170824_126411408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300031446|Ga0170820_12726756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300031474|Ga0170818_104421104 | Not Available | 762 | Open in IMG/M |
| 3300031546|Ga0318538_10623325 | Not Available | 585 | Open in IMG/M |
| 3300031561|Ga0318528_10392463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300031573|Ga0310915_10283743 | Not Available | 1168 | Open in IMG/M |
| 3300031573|Ga0310915_10903012 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031668|Ga0318542_10167409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1098 | Open in IMG/M |
| 3300031668|Ga0318542_10257618 | Not Available | 888 | Open in IMG/M |
| 3300031681|Ga0318572_10162612 | Not Available | 1294 | Open in IMG/M |
| 3300031682|Ga0318560_10366586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 779 | Open in IMG/M |
| 3300031718|Ga0307474_10437465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300031719|Ga0306917_10685492 | Not Available | 805 | Open in IMG/M |
| 3300031719|Ga0306917_11550704 | Not Available | 509 | Open in IMG/M |
| 3300031724|Ga0318500_10120847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1210 | Open in IMG/M |
| 3300031747|Ga0318502_10344327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300031748|Ga0318492_10382893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300031748|Ga0318492_10629533 | Not Available | 573 | Open in IMG/M |
| 3300031751|Ga0318494_10539269 | Not Available | 681 | Open in IMG/M |
| 3300031751|Ga0318494_10719339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300031753|Ga0307477_10049468 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
| 3300031753|Ga0307477_10121083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1824 | Open in IMG/M |
| 3300031754|Ga0307475_10090159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2377 | Open in IMG/M |
| 3300031763|Ga0318537_10117542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300031768|Ga0318509_10168813 | Not Available | 1211 | Open in IMG/M |
| 3300031770|Ga0318521_10173873 | Not Available | 1233 | Open in IMG/M |
| 3300031777|Ga0318543_10249006 | Not Available | 792 | Open in IMG/M |
| 3300031792|Ga0318529_10285571 | Not Available | 768 | Open in IMG/M |
| 3300031793|Ga0318548_10039641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2108 | Open in IMG/M |
| 3300031793|Ga0318548_10135306 | Not Available | 1196 | Open in IMG/M |
| 3300031794|Ga0318503_10043825 | Not Available | 1349 | Open in IMG/M |
| 3300031796|Ga0318576_10096665 | Not Available | 1343 | Open in IMG/M |
| 3300031797|Ga0318550_10596117 | Not Available | 531 | Open in IMG/M |
| 3300031798|Ga0318523_10378541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300031821|Ga0318567_10664618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 591 | Open in IMG/M |
| 3300031823|Ga0307478_10797280 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031846|Ga0318512_10467247 | Not Available | 638 | Open in IMG/M |
| 3300031860|Ga0318495_10538341 | Not Available | 508 | Open in IMG/M |
| 3300031896|Ga0318551_10374153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300031910|Ga0306923_10431699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1496 | Open in IMG/M |
| 3300031941|Ga0310912_11071776 | Not Available | 616 | Open in IMG/M |
| 3300031942|Ga0310916_10316041 | Not Available | 1324 | Open in IMG/M |
| 3300031945|Ga0310913_10224504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 1316 | Open in IMG/M |
| 3300031945|Ga0310913_10958454 | Not Available | 600 | Open in IMG/M |
| 3300031947|Ga0310909_10722641 | Not Available | 826 | Open in IMG/M |
| 3300031954|Ga0306926_10585967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1363 | Open in IMG/M |
| 3300031954|Ga0306926_11869164 | Not Available | 679 | Open in IMG/M |
| 3300032025|Ga0318507_10487988 | Not Available | 536 | Open in IMG/M |
| 3300032041|Ga0318549_10508041 | Not Available | 542 | Open in IMG/M |
| 3300032054|Ga0318570_10066898 | Not Available | 1522 | Open in IMG/M |
| 3300032059|Ga0318533_10693968 | Not Available | 747 | Open in IMG/M |
| 3300032059|Ga0318533_11168486 | Not Available | 563 | Open in IMG/M |
| 3300032060|Ga0318505_10519882 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032066|Ga0318514_10733695 | Not Available | 525 | Open in IMG/M |
| 3300032090|Ga0318518_10709552 | Not Available | 511 | Open in IMG/M |
| 3300032261|Ga0306920_101485143 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300032261|Ga0306920_102930752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300032397|Ga0315287_12524000 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032955|Ga0335076_10181837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2010 | Open in IMG/M |
| 3300033289|Ga0310914_11105789 | Not Available | 694 | Open in IMG/M |
| 3300033289|Ga0310914_11632261 | Not Available | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1007284691 | 3300004091 | Bog Forest Soil | MHFHANYVSTSVFGAGDYYQAMFEAEQDTDDPDSPYLLIQR |
| Ga0066677_102704852 | 3300005171 | Soil | MHFHANYVSTSVSGDGDYYQAMFEAEQDTDDLDSPYLLIQRQFEDPDDNWVLHRNA* |
| Ga0066671_109919312 | 3300005184 | Soil | MHFHANYVSTSVFGDGDYYQAMFQAEQDTDDPDSPYLLIQRQFEDPD |
| Ga0066675_102414141 | 3300005187 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDDPGSPYLLIQRQFEDPDDH |
| Ga0066388_1021787201 | 3300005332 | Tropical Forest Soil | MRFHANYVSTSVSGDYDQAMFEAEPDSDDVDSPYLLIQRQFED |
| Ga0066388_1060091221 | 3300005332 | Tropical Forest Soil | MLARDTRIMRFHANYVSTSVSGDYYQAMFEYEKDADDLLSPY |
| Ga0070713_1006612013 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFHANYVSISVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFENPDDNWC |
| Ga0070698_1015621522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHFHANYVSTSVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFED |
| Ga0066661_107572542 | 3300005554 | Soil | MQFHANYVSTSVFGDGDYYQATFEAEQDTDDPGSPYLLIQRQFEDPDD |
| Ga0066705_106384831 | 3300005569 | Soil | MHFHANYVSTSVSGDGDYYQAMFEAEQDTDDLDSPYLLIQRQFEDPDD |
| Ga0066903_1014961681 | 3300005764 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDADDPDSPY |
| Ga0070766_108752531 | 3300005921 | Soil | MARDTRTMRFQANYISASVSGDYCQAMFAASDTDESDSPCLLIQRQFET |
| Ga0066660_110929211 | 3300006800 | Soil | MCFHANYVSTSASGDGDYYQAMFEAEQDAADLDSPSVLTQSLCEDPDDN* |
| Ga0075433_107303652 | 3300006852 | Populus Rhizosphere | MNFHANYVSTSVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFE |
| Ga0099828_116066501 | 3300009089 | Vadose Zone Soil | MRTMLFHANYVATSVAGDYYQAMFAEEDTDDPDRAYL |
| Ga0099827_118201922 | 3300009090 | Vadose Zone Soil | MRFQANYVSISVSGDYYQAMFEAEEDATDPDSPYLLIQR |
| Ga0066709_1042943621 | 3300009137 | Grasslands Soil | MRTMLFHANYVATSVAGDYYQTKFAEEDTDHPDRAYLIIQRPFEDPE |
| Ga0126374_112308711 | 3300009792 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFQAEQDTDDADSPYLLIQ |
| Ga0123355_114467641 | 3300009826 | Termite Gut | MQFHAECVSVSVAADYYQILFEAEEDSDDLDSPYL |
| Ga0126373_105467982 | 3300010048 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQALFEAEQDTDDPDSP |
| Ga0126376_109435991 | 3300010359 | Tropical Forest Soil | MHFHANYVSTSAFGDGDYYQATFEADQDSDDRDSPYLLIQRQFEDPD |
| Ga0126376_111506973 | 3300010359 | Tropical Forest Soil | HANYVSTSVFGDGDYYQATFEAEQDAVDPGSPYL* |
| Ga0126378_100177054 | 3300010361 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDADSPYLLIQRQFEDPDDNWCYWASF* |
| Ga0126378_102741291 | 3300010361 | Tropical Forest Soil | MRFHANYVSTSVSGDYDQAMFEAEPDSDDVDSPYLLIQRQFEDPDD |
| Ga0126378_107381963 | 3300010361 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFQAKQDTDDPDSPY |
| Ga0126379_107548111 | 3300010366 | Tropical Forest Soil | MRFHANYVSTSVAGECYHAMFEAEQDSDDVDSPYLLIQRQFEDPDDDWC |
| Ga0126381_1007109281 | 3300010376 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFED |
| Ga0137391_115563261 | 3300011270 | Vadose Zone Soil | MDFHANYVSTSVFGDGDYYQAEQDTDDPDSPYLLIQRQFEDPDDNW |
| Ga0137399_103616121 | 3300012203 | Vadose Zone Soil | MHFHANYVSTSVFGDGDYYQAMFQAEQDTDDPDSPYLLIQRQFEDPDDN |
| Ga0137399_105518792 | 3300012203 | Vadose Zone Soil | MHFHANYVSTSVFGDGDYYQATFQAEQDTDDPDSPYLLI |
| Ga0137384_106333111 | 3300012357 | Vadose Zone Soil | MHFHSNYVSTSVFGDGYYYQATFQAEQDTDDTDSPYLLIQRQF |
| Ga0137385_109630332 | 3300012359 | Vadose Zone Soil | MHFHANYVSTSVFGDGDYYQATFQAEQDTDHPDSPYLLIQRQFEDPDDN |
| Ga0126375_103945841 | 3300012948 | Tropical Forest Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDRDSPYLLIQAIRRSR* |
| Ga0126369_137127991 | 3300012971 | Tropical Forest Soil | MLSTSFFGDGDHYRDTFEAEEDTDDPDSIYLLIQREFEDPDDY* |
| Ga0182033_103421501 | 3300016319 | Soil | MHLHANYVSTSVFGDGDYYQATFEAEQDTDDPDSAYLTIQRQFEDPDDHRC |
| Ga0182033_106360893 | 3300016319 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLSIQR |
| Ga0182033_120131191 | 3300016319 | Soil | MRFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLL |
| Ga0182032_116350561 | 3300016357 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDPD |
| Ga0182034_105881861 | 3300016371 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDPDDNWC |
| Ga0182040_103297611 | 3300016387 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLS |
| Ga0182040_106103243 | 3300016387 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPYLLI |
| Ga0182040_109168151 | 3300016387 | Soil | MDFHANYVSTSVFGDGDYYQAIFESEQDTDDPDSPYLLIQRQFEDPDDNW |
| Ga0182037_100981421 | 3300016404 | Soil | MHFHANYVSTSVFGDGDYYQAMFEAEQDSDDLDSPYLLIQRQ |
| Ga0182039_117728802 | 3300016422 | Soil | MHLHANCVSTSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQ |
| Ga0182038_115590702 | 3300016445 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSP |
| Ga0187779_105057521 | 3300017959 | Tropical Peatland | MHFHANYVSTSVFGDGSYYQAMFQAEQDADDFDSPYLLIQRQFEDQDDNLC |
| Ga0066662_101169501 | 3300018468 | Grasslands Soil | MHFHANYVSTSVFGDGDYYQAMFQAEPDTDDAGSPYLLIQRQFED |
| Ga0066669_108443621 | 3300018482 | Grasslands Soil | MHFHANYVSTSVFGDGDYYQAMFQAEEDTDDPDSP |
| Ga0210403_100808451 | 3300020580 | Soil | MHFHANYVSISVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDPD |
| Ga0210403_101327411 | 3300020580 | Soil | MHFHANYVSISVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFEDPDD |
| Ga0179596_105019212 | 3300021086 | Vadose Zone Soil | MHFHANYVSTSVFGDGDYYQATFQAEQDTDDPDSPYLLIQR |
| Ga0210408_114004861 | 3300021178 | Soil | MHFHANYVSTSVFGDGDYYQAMFQAEQDTDDPDSPYLLIQR |
| Ga0210387_114828141 | 3300021405 | Soil | MHFHANYVSTSVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFE |
| Ga0210384_112837301 | 3300021432 | Soil | MHFHANYVSTSVFGDGDYYQATFEVEQDTDDPDSPYL |
| Ga0209805_11354082 | 3300026542 | Soil | MHFHANYVSTSVFGDGDYYQAMFQAEPDTDDAGSPYLLIQRQF |
| Ga0209448_101858741 | 3300027783 | Bog Forest Soil | MHFHANYVSTSVFGAGDYYQAMFEAEQDTDDPDSPYLLIQRQFED |
| Ga0265763_10425492 | 3300030763 | Soil | MHIHANYVSISVFGDGDYYQAMFQAEQDTDDPDSPYLLIQRQFEDPDDNSCYRNA |
| Ga0075373_115616483 | 3300030945 | Soil | MHFHANYVSISVFGDGDYYQATFQAEQDTDDPDSPYLLIQ |
| Ga0170834_1002082261 | 3300031057 | Forest Soil | MNFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDPDDNR |
| Ga0170824_1264114082 | 3300031231 | Forest Soil | MHFHANYVSTSVFGDGDYYQVTFQAEQDTDDPDSPYLLIQRQFEDPDDNWC |
| Ga0170820_127267561 | 3300031446 | Forest Soil | MHFHANYVSISVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFEDPDDNRC |
| Ga0170818_1044211041 | 3300031474 | Forest Soil | MNFHANYVSTSVFGDGDYYQATFQAEQDTDHPDSPYLL |
| Ga0318538_106233251 | 3300031546 | Soil | MDFRANYVSTSVAGDYYQAMFEAEQDADDPDSAYLLIQRQFE |
| Ga0318528_103924631 | 3300031561 | Soil | MRFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYL |
| Ga0310915_102837432 | 3300031573 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSPYLLI |
| Ga0310915_109030121 | 3300031573 | Soil | MNFHANYVSTSVFGDGDYYQATFEAEQDTDDPDALIS |
| Ga0318542_101674091 | 3300031668 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSP |
| Ga0318542_102576181 | 3300031668 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSPYLLIQRQFEDPDDNWCY |
| Ga0318572_101626121 | 3300031681 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPY |
| Ga0318560_103665861 | 3300031682 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDPDALIS |
| Ga0307474_104374653 | 3300031718 | Hardwood Forest Soil | MRFRANHISTSVAGDYYQAMFAADEDTDDPDSPYLLLQRQF |
| Ga0306917_106854921 | 3300031719 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPYL |
| Ga0306917_115507042 | 3300031719 | Soil | MHFHANHVSTSAFAGDYYQAMFEADEEADDPHSPYLLIQRQFEDPD |
| Ga0318500_101208472 | 3300031724 | Soil | MHFHANYVSTSVFGDGDYYQAMFEAEQDTDDPDSPYLLIQRQFEDPDDN |
| Ga0318502_103443271 | 3300031747 | Soil | MHFHANYVSTSVSGDYYQAMFEAEQDSDDLDSPYLL |
| Ga0318492_103828931 | 3300031748 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDPDDNCATSKH |
| Ga0318492_106295331 | 3300031748 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLSIQRQFEDQSDDLCYIEAHDE |
| Ga0318494_105392691 | 3300031751 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPY |
| Ga0318494_107193391 | 3300031751 | Soil | MHFHANYVSTSAFGDGDYYQATFEAEQDSDDRDSPY |
| Ga0307477_100494681 | 3300031753 | Hardwood Forest Soil | MHFHANYVSTSVFGDGDYYQAMFEAEQDTDDPDSLIC |
| Ga0307477_101210831 | 3300031753 | Hardwood Forest Soil | MHFHANYVSTSVFGDGEYYQATFQAEQETDDPDSPYLLIQRQFEDPDAIGATSKCM |
| Ga0307475_100901591 | 3300031754 | Hardwood Forest Soil | MHFHANYVSASVFGDGDYYQATFQAEQDTDDPDSPYLLIQRQFEDPDDNWC |
| Ga0318537_101175421 | 3300031763 | Soil | MDFHANYVSTSVFGDGDCYQATFEAEQDTDDPDSPY |
| Ga0318509_101688132 | 3300031768 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSPYLLIQR |
| Ga0318521_101738731 | 3300031770 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSPD |
| Ga0318543_102490063 | 3300031777 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLSIQRQFEDQSDDLCYIEAHD |
| Ga0318529_102855711 | 3300031792 | Soil | MHFHANSVSTSVFGDGNYYQAAFEAEEDTDDPDSPYLLIQ |
| Ga0318548_100396415 | 3300031793 | Soil | TSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQFEDPDDDRC |
| Ga0318548_101353061 | 3300031793 | Soil | MHLHANYVSTSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQFEDPDDDR |
| Ga0318503_100438252 | 3300031794 | Soil | MHLHANYVSTSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQFEDPDDD |
| Ga0318576_100966651 | 3300031796 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLSIQRQFEDQSDDLCYIEAHDENN |
| Ga0318550_105961171 | 3300031797 | Soil | MDFRANYVSTSVAGDYYQAMFEAEQDADDPDSAYL |
| Ga0318523_103785412 | 3300031798 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPYLLIQRQFEDPDDN |
| Ga0318567_106646181 | 3300031821 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPY |
| Ga0307478_107972802 | 3300031823 | Hardwood Forest Soil | MQFRADYVSISVSGDHYLAMFAAEKDADDPHSPYLLIQRPFEIPDG |
| Ga0318512_104672472 | 3300031846 | Soil | LRGSTHFHANYVSTSVFGDGDYYQATFQAEQDADDAGSPY |
| Ga0318495_105383411 | 3300031860 | Soil | MHFHTNYVSTSVFGDGDYYQATFEAEQDTDDADSPYLLIQRQFEDP |
| Ga0318551_103741531 | 3300031896 | Soil | ELRGGMHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPYLLIQRQFEDPDDN |
| Ga0306923_104316992 | 3300031910 | Soil | MHFHANYVSTSVFGDGDYYQATFEAERDTDEPDSPYLLIQRQLVLYRNT |
| Ga0310912_110717761 | 3300031941 | Soil | MNFHANYVSTSVFGDGDYYQATFEAEQDTDDPDALI |
| Ga0310916_103160414 | 3300031942 | Soil | MHFYANYVSTSVFGDGDYYQAMFEAEQDADDPHSPYLSIQRKFEDQSDDLCY |
| Ga0310913_102245041 | 3300031945 | Soil | MHFHANYVSTSVSGDYYQAMFEAEQDSDDLDSPYLLIQRQ |
| Ga0310913_109584542 | 3300031945 | Soil | MHFHANYVSTSVSGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDP |
| Ga0310909_107226412 | 3300031947 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDNPDSPYLLIQR |
| Ga0306926_105859671 | 3300031954 | Soil | SMHLHANYVSTSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQFEDPDDDRC |
| Ga0306926_118691641 | 3300031954 | Soil | RGSMHFHADYVSTSVFGDGDYYQATFQAKQDTELP |
| Ga0318507_104879881 | 3300032025 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDDPDSPYLLIQRQFEDP |
| Ga0318549_105080411 | 3300032041 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDNPDSPY |
| Ga0318570_100668981 | 3300032054 | Soil | MHLHANYVSTSVFGDGDYYQATFEAEQDAVDPGSPYLLIQRQFEDPDDDRCY |
| Ga0318533_106939682 | 3300032059 | Soil | MRFHANYVSTSVSGDYYQAVFKAERNSDDVDGPYL |
| Ga0318533_111684862 | 3300032059 | Soil | MHFYAKYVSASVFGDGDYNQATFEAEQDTDDPGSPYL |
| Ga0318505_105198821 | 3300032060 | Soil | MHFHANYVSTSVFGDGDYYQAMFEAEQDSNDLDSPYL |
| Ga0318514_107336952 | 3300032066 | Soil | MDFRANYVSTSVAGDYYQAMFEAEQDADDPDSAYLLI |
| Ga0318518_107095521 | 3300032090 | Soil | MDFHANYVSTSVFGDGDCYQATFEAEQDTDDPDSPYLLI |
| Ga0306920_1014851432 | 3300032261 | Soil | MHFHANYVSTSVFGDGDYYQATFEAEQDTDNPDSPYLLIQ |
| Ga0306920_1029307522 | 3300032261 | Soil | MHFHANSVSTSVFGDGDYYQTTFEAEQDTDDADSPYLSIQ |
| Ga0315287_125240002 | 3300032397 | Sediment | MRFHANHVSTSISGDYYQAMIEASEDSNDPDSPYLIIQRQFEM |
| Ga0335076_101818375 | 3300032955 | Soil | GETTRFHANYVSTCVSGDYYQAMFAAEQDSDDVDGPHLLIQRQFEDPDDDWC |
| Ga0310914_111057891 | 3300033289 | Soil | MRFHANYVSTSVSGDYYQAVFKAERNSDDVDGPYLLIQR |
| Ga0310914_116322611 | 3300033289 | Soil | MQFHANHVSVSTFADDYFQVKFEAEEDAEDSDSPYLLIQRQFEDPEDEL |
| ⦗Top⦘ |