


| Basic Information | |
|---|---|
| Family ID | F073245 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTAEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.17 % |
| % of genes from short scaffolds (< 2000 bps) | 84.17 % |
| Associated GOLD sequencing projects | 41 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (70.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (97.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF08774 | VRR_NUC | 24.37 |
| PF04448 | DUF551 | 18.49 |
| PF14354 | Lar_restr_allev | 12.61 |
| PF02195 | ParBc | 9.24 |
| PF00436 | SSB | 7.56 |
| PF01555 | N6_N4_Mtase | 6.72 |
| PF03796 | DnaB_C | 4.20 |
| PF01695 | IstB_IS21 | 0.84 |
| PF01844 | HNH | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 7.56 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 7.56 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.72 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.72 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.72 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 4.20 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 4.20 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.50 % |
| All Organisms | root | All Organisms | 27.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001759|CSTRM44_101401 | All Organisms → cellular organisms → Bacteria | 12736 | Open in IMG/M |
| 3300002079|CSTR_1024451 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300006805|Ga0075464_10363461 | Not Available | 876 | Open in IMG/M |
| 3300009655|Ga0116190_1036310 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 2231 | Open in IMG/M |
| 3300009655|Ga0116190_1175716 | Not Available | 744 | Open in IMG/M |
| 3300009655|Ga0116190_1193818 | Not Available | 696 | Open in IMG/M |
| 3300009655|Ga0116190_1255171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300009655|Ga0116190_1257719 | Not Available | 575 | Open in IMG/M |
| 3300009658|Ga0116188_1068981 | Not Available | 1508 | Open in IMG/M |
| 3300009658|Ga0116188_1205120 | Not Available | 705 | Open in IMG/M |
| 3300009658|Ga0116188_1265823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 595 | Open in IMG/M |
| 3300009658|Ga0116188_1267523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 593 | Open in IMG/M |
| 3300009664|Ga0116146_1069291 | Not Available | 1579 | Open in IMG/M |
| 3300009666|Ga0116182_1028547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3505 | Open in IMG/M |
| 3300009666|Ga0116182_1193701 | Not Available | 909 | Open in IMG/M |
| 3300009669|Ga0116148_1104100 | Not Available | 1382 | Open in IMG/M |
| 3300009673|Ga0116185_1260825 | Not Available | 760 | Open in IMG/M |
| 3300009673|Ga0116185_1433549 | Not Available | 543 | Open in IMG/M |
| 3300009675|Ga0116149_1076702 | Not Available | 1824 | Open in IMG/M |
| 3300009675|Ga0116149_1127875 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1262 | Open in IMG/M |
| 3300009675|Ga0116149_1411269 | Not Available | 561 | Open in IMG/M |
| 3300009676|Ga0116187_1532131 | Not Available | 502 | Open in IMG/M |
| 3300009685|Ga0116142_10142213 | Not Available | 1265 | Open in IMG/M |
| 3300009685|Ga0116142_10288750 | Not Available | 812 | Open in IMG/M |
| 3300009685|Ga0116142_10462996 | Not Available | 605 | Open in IMG/M |
| 3300009687|Ga0116144_10126046 | Not Available | 1429 | Open in IMG/M |
| 3300009687|Ga0116144_10167305 | Not Available | 1194 | Open in IMG/M |
| 3300009689|Ga0116186_1221708 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300009690|Ga0116143_10258566 | Not Available | 911 | Open in IMG/M |
| 3300009690|Ga0116143_10477314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300009693|Ga0116141_10082201 | Not Available | 1970 | Open in IMG/M |
| 3300009693|Ga0116141_10246356 | Not Available | 964 | Open in IMG/M |
| 3300009693|Ga0116141_10258429 | Not Available | 935 | Open in IMG/M |
| 3300009704|Ga0116145_1311754 | Not Available | 587 | Open in IMG/M |
| 3300009710|Ga0116192_1024608 | Not Available | 2522 | Open in IMG/M |
| 3300009714|Ga0116189_1115250 | Not Available | 1048 | Open in IMG/M |
| 3300009714|Ga0116189_1160548 | Not Available | 828 | Open in IMG/M |
| 3300009720|Ga0116159_1196503 | Not Available | 827 | Open in IMG/M |
| 3300009780|Ga0116156_10158621 | Not Available | 1246 | Open in IMG/M |
| 3300009780|Ga0116156_10231028 | Not Available | 968 | Open in IMG/M |
| 3300009780|Ga0116156_10261041 | Not Available | 892 | Open in IMG/M |
| 3300009781|Ga0116178_10080443 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1782 | Open in IMG/M |
| 3300009783|Ga0116158_10255567 | Not Available | 996 | Open in IMG/M |
| 3300009783|Ga0116158_10493752 | Not Available | 648 | Open in IMG/M |
| 3300010344|Ga0116243_10119652 | Not Available | 1902 | Open in IMG/M |
| 3300010345|Ga0116253_10557567 | Not Available | 699 | Open in IMG/M |
| 3300010346|Ga0116239_10073554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2986 | Open in IMG/M |
| 3300010346|Ga0116239_10293591 | Not Available | 1144 | Open in IMG/M |
| 3300010347|Ga0116238_10087517 | Not Available | 2434 | Open in IMG/M |
| 3300010353|Ga0116236_10903154 | Not Available | 701 | Open in IMG/M |
| 3300010353|Ga0116236_10903154 | Not Available | 701 | Open in IMG/M |
| 3300010353|Ga0116236_10932606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 687 | Open in IMG/M |
| 3300010355|Ga0116242_10553148 | Not Available | 1044 | Open in IMG/M |
| 3300010355|Ga0116242_10553168 | Not Available | 1044 | Open in IMG/M |
| 3300010356|Ga0116237_10383770 | Not Available | 1253 | Open in IMG/M |
| 3300010357|Ga0116249_10332660 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1402 | Open in IMG/M |
| 3300010365|Ga0116251_10461637 | Not Available | 688 | Open in IMG/M |
| 3300012956|Ga0154020_10879532 | Not Available | 701 | Open in IMG/M |
| 3300019222|Ga0179957_1019912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1056 | Open in IMG/M |
| 3300019222|Ga0179957_1215558 | Not Available | 561 | Open in IMG/M |
| 3300019223|Ga0179948_1122088 | Not Available | 746 | Open in IMG/M |
| 3300019223|Ga0179948_1143154 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 889 | Open in IMG/M |
| 3300020814|Ga0214088_1013905 | Not Available | 703 | Open in IMG/M |
| 3300020814|Ga0214088_1116448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5774 | Open in IMG/M |
| 3300025597|Ga0208825_1092938 | Not Available | 727 | Open in IMG/M |
| 3300025613|Ga0208461_1111538 | Not Available | 723 | Open in IMG/M |
| 3300025613|Ga0208461_1114170 | Not Available | 710 | Open in IMG/M |
| 3300025629|Ga0208824_1028044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 2347 | Open in IMG/M |
| 3300025629|Ga0208824_1048410 | Not Available | 1558 | Open in IMG/M |
| 3300025638|Ga0208198_1155440 | Not Available | 604 | Open in IMG/M |
| 3300025638|Ga0208198_1176769 | Not Available | 543 | Open in IMG/M |
| 3300025677|Ga0209719_1017273 | All Organisms → cellular organisms → Bacteria | 3542 | Open in IMG/M |
| 3300025677|Ga0209719_1084929 | Not Available | 994 | Open in IMG/M |
| 3300025682|Ga0209718_1152211 | Not Available | 674 | Open in IMG/M |
| 3300025686|Ga0209506_1009372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5662 | Open in IMG/M |
| 3300025686|Ga0209506_1086542 | Not Available | 993 | Open in IMG/M |
| 3300025708|Ga0209201_1093527 | Not Available | 1101 | Open in IMG/M |
| 3300025708|Ga0209201_1132092 | Not Available | 845 | Open in IMG/M |
| 3300025708|Ga0209201_1154831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300025713|Ga0208195_1133186 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 842 | Open in IMG/M |
| 3300025720|Ga0208197_1057310 | Not Available | 1555 | Open in IMG/M |
| 3300025737|Ga0208694_1259723 | Not Available | 524 | Open in IMG/M |
| 3300025740|Ga0208940_1026841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 2829 | Open in IMG/M |
| 3300025772|Ga0208939_1116842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 984 | Open in IMG/M |
| 3300025784|Ga0209200_1034049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2373 | Open in IMG/M |
| 3300025784|Ga0209200_1106264 | Not Available | 1055 | Open in IMG/M |
| 3300025856|Ga0209604_1069929 | Not Available | 1653 | Open in IMG/M |
| 3300025856|Ga0209604_1152280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 966 | Open in IMG/M |
| 3300025861|Ga0209605_1323486 | Not Available | 545 | Open in IMG/M |
| 3300025871|Ga0209311_1035124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2565 | Open in IMG/M |
| 3300025877|Ga0208460_10228588 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 710 | Open in IMG/M |
| 3300025896|Ga0208916_10210506 | Not Available | 842 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1042236 | Not Available | 2407 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1064608 | Not Available | 1760 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1073964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1138536 | Not Available | 1011 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1172067 | Not Available | 863 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1032395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3083 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1152444 | Not Available | 952 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1242897 | Not Available | 669 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1249298 | Not Available | 656 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1267536 | Not Available | 622 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1317419 | Not Available | 544 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1347391 | Not Available | 507 | Open in IMG/M |
| (restricted) 3300028567|Ga0255342_1204456 | Not Available | 791 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1040097 | Not Available | 2787 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1148807 | Not Available | 1015 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1163910 | Not Available | 941 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1344622 | Not Available | 520 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1013944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis | 5956 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1075981 | Not Available | 1653 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1320258 | Not Available | 580 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1033424 | Not Available | 3050 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1043292 | Not Available | 2496 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1071081 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1719 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1261424 | Not Available | 644 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1291459 | Not Available | 591 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1300637 | Not Available | 577 | Open in IMG/M |
| 3300029288|Ga0265297_10777064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillospiraceae incertae sedis → [Eubacterium] siraeum → [Eubacterium] siraeum 70/3 | 589 | Open in IMG/M |
| 3300029781|Ga0167330_1031147 | Not Available | 965 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 70.83% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 21.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.67% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 1.67% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.83% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.83% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.83% |
| Wastewater | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater | 0.83% |
| Wastewater Treatment Plant | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001759 | Wastewater microbial communities from Belvaux, Luxembourg - M44 | Engineered | Open in IMG/M |
| 3300002079 | CSTRmetagenomics | Engineered | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019223 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA6_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300025597 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025877 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029781 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CSTRM44_10140112 | 3300001759 | Wastewater | MTAEPLTLLDLAAGWTLLIAIVAIVVNVIALLREYFGKNK* |
| CSTR_10244512 | 3300002079 | Wastewater Treatment Plant | MIAEPITLLDLALGLTLLIALVAIVVNVIALVKEYIKSQNVRA* |
| Ga0075464_103634613 | 3300006805 | Aqueous | MTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116190_10363102 | 3300009655 | Anaerobic Digestor Sludge | MIMTAEPLTLLDLAAGLTLLIALVAIVVNVACLVKEYIIDKRNE* |
| Ga0116190_11757163 | 3300009655 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGWTLLIAIVAIMVNVIALIKEVKNENHKL* |
| Ga0116190_11938181 | 3300009655 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116190_12551712 | 3300009655 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGWTLLIAIVAIMVNVIALLREYFGKKK* |
| Ga0116190_12577193 | 3300009655 | Anaerobic Digestor Sludge | EPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116188_10689812 | 3300009658 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGITLIIALVAIVVNVACLMKEYIISRNDRTR* |
| Ga0116188_12051201 | 3300009658 | Anaerobic Digestor Sludge | RRMIMTAEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116188_12658232 | 3300009658 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116188_12675232 | 3300009658 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGLTLLIAIVAIVVNVIALLREYFGKKK* |
| Ga0116146_10692913 | 3300009664 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIMVNVIALLREYFGKKK* |
| Ga0116182_10285472 | 3300009666 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLAAGLTLLIALVAIVVNVIALIKEYLLDKRNK* |
| Ga0116182_11937012 | 3300009666 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116148_11041005 | 3300009669 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA* |
| Ga0116185_12608253 | 3300009673 | Anaerobic Digestor Sludge | MTTEPLTLLDLALGLTLLIALVAIVVNVACLVKEYIIDKRNE* |
| Ga0116185_14335492 | 3300009673 | Anaerobic Digestor Sludge | MTTEPLTLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116149_10767024 | 3300009675 | Anaerobic Digestor Sludge | MTTEPITLLDLAAGLTLLIALVAIVVNVIYLVKEYIKSQNDRAR* |
| Ga0116149_11278752 | 3300009675 | Anaerobic Digestor Sludge | MTLLDLAVCLTLLIAIVAIVVNVACLVKEYIIDKRNE* |
| Ga0116149_14112691 | 3300009675 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116187_15321312 | 3300009676 | Anaerobic Digestor Sludge | MTTEPLTLLDLAAGLTLLIALVAIVVNVIALVREYIIDKRNE* |
| Ga0116142_101422134 | 3300009685 | Anaerobic Digestor Sludge | MIMTTEPITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116142_102887503 | 3300009685 | Anaerobic Digestor Sludge | MTAEPLTLLDLAAGLTLIIALVAIVVNVIDLIKEARK* |
| Ga0116142_104629962 | 3300009685 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGWTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116144_101260462 | 3300009687 | Anaerobic Digestor Sludge | MTTTEPITLLDLAAGLTLIIALVAIVVNVIDLIKEARK* |
| Ga0116144_101673053 | 3300009687 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGLTLLIAIVAIVVNVIYLVKEYIKSQND* |
| Ga0116186_12217082 | 3300009689 | Anaerobic Digestor Sludge | MTAEPLTLLDLAAGLTLIIALVAIVVNVIALVKEYIISRNDRTR* |
| Ga0116143_102585663 | 3300009690 | Anaerobic Digestor Sludge | MIMTAEPLTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA* |
| Ga0116143_104773141 | 3300009690 | Anaerobic Digestor Sludge | MTAEPMTLLDLAAGLTLLIAIVAIVVNVIALIKEYFGRKNV* |
| Ga0116141_100822013 | 3300009693 | Anaerobic Digestor Sludge | MTESITLLDLAAGLTLLIALVAIVVNVIALLREYIIDKRNE* |
| Ga0116141_102463564 | 3300009693 | Anaerobic Digestor Sludge | MTLLDLAAGLTLLIAIVAIVVNVIALIKEVKNENHKL* |
| Ga0116141_102584292 | 3300009693 | Anaerobic Digestor Sludge | MTESITLLDLAAGLTLLIAIVAIVVNVIALIKEVKNE* |
| Ga0116145_13117541 | 3300009704 | Anaerobic Digestor Sludge | MTAEPLTLLDLAAGLTLLIAIVAIVVNVIALLREYFGKKK* |
| Ga0116192_10246083 | 3300009710 | Anaerobic Digestor Sludge | MRITMTAEPITLLDLAAGLTLLIAIIAIVVNVIDLIKEARK* |
| Ga0116189_11152503 | 3300009714 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGLTLLIAIVAIVVNVIALIKEVKNENHKL* |
| Ga0116189_11605482 | 3300009714 | Anaerobic Digestor Sludge | MTTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116159_11965033 | 3300009720 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIMVNVIALLREYFGRNNV* |
| Ga0116156_101586211 | 3300009780 | Anaerobic Digestor Sludge | TLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116156_102310281 | 3300009780 | Anaerobic Digestor Sludge | MIMTAEPMTLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116156_102610413 | 3300009780 | Anaerobic Digestor Sludge | MTTEPITLLDLAAGLTLLIALVAIVVNVIALLREYIIDKRNE* |
| Ga0116178_100804432 | 3300009781 | Anaerobic Digestor Sludge | MTAEPLTLLDLVAGLTLLIALVAIVVNVACLVKEYIIDKRNE* |
| Ga0116158_102555673 | 3300009783 | Anaerobic Digestor Sludge | MTAEPMTLLDLAAGLTLLIALVAIVVNVIALIKEYLLDKRNK* |
| Ga0116158_104937521 | 3300009783 | Anaerobic Digestor Sludge | MTAEPMTLLDLAVCLTLLIAIVAIVVNVIALIKEYFGRKNV* |
| Ga0116243_101196526 | 3300010344 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIALVAIVVNVIALLREYFGKKK* |
| Ga0116253_105575673 | 3300010345 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIMVNVIALLREYFG |
| Ga0116239_100735546 | 3300010346 | Anaerobic Digestor Sludge | MIMTAEPMTLLDLAAGWTLLIAIVAIMVNVIALLREYFGKKK* |
| Ga0116239_102935913 | 3300010346 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIAIVAIVVNVIYLVKEYIKSQND* |
| Ga0116238_100875173 | 3300010347 | Anaerobic Digestor Sludge | MTTEPLTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA* |
| Ga0116236_109031542 | 3300010353 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIVVNVIALLREYFGKKK* |
| Ga0116236_109031544 | 3300010353 | Anaerobic Digestor Sludge | TAEPITLLDLAAGLTLLIAIVAIVVNVIALIKEVKNENHKL* |
| Ga0116236_109326062 | 3300010353 | Anaerobic Digestor Sludge | MTESITLLDLAAGLTLLIALVAIVVNVIYLVKEYIKSQNDRA* |
| Ga0116242_105531481 | 3300010355 | Anaerobic Digestor Sludge | ERRMIMTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV* |
| Ga0116242_105531683 | 3300010355 | Anaerobic Digestor Sludge | MIMTTEPITLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA* |
| Ga0116237_103837702 | 3300010356 | Anaerobic Digestor Sludge | MIMTAEPMTLLDLAAVWTLLIAIVAIMVNVIALIKEYFGRKNV* |
| Ga0116249_103326601 | 3300010357 | Anaerobic Digestor Sludge | TAEPLTLLDLVAGLTLLIALVAIVVNVACLVKEYIIDKRNE* |
| Ga0116251_104616373 | 3300010365 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLAAGLTLLIALVAIVENVI |
| Ga0154020_108795321 | 3300012956 | Active Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVACLVKEYIIDKRNK* |
| Ga0179957_10199123 | 3300019222 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGITLIIALVAIVVNVACLMKEYIISRNDRTR |
| Ga0179957_12155582 | 3300019222 | Anaerobic Digestor Sludge | MTAEPLTLFDLAAGLTLLIAIVAIMVNVIALIKEYFGRKNV |
| Ga0179948_11220881 | 3300019223 | Anaerobic Digestor Sludge | IMTAEPLTLLDLAAGLTLLIALVAIVVNVACLVKEYIIDKRNE |
| Ga0179948_11431542 | 3300019223 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGWTLLIAIVAIMVNVIALLREYFGKKK |
| Ga0214088_10139052 | 3300020814 | Granular Sludge | MIMTAEPITLLDLAAGLTLIIALVAIVVNVIDLIKEARK |
| Ga0214088_11164484 | 3300020814 | Granular Sludge | MYAEPITLLDLAAGLTLLIAIVAIVVNVIALIKEVKNENHKL |
| Ga0208825_10929383 | 3300025597 | Anaerobic Digestor Sludge | ERRMIMTAEPITLLDLAAGLTLLIAIIAIVVNVIDLIKEARK |
| Ga0208461_11115382 | 3300025613 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| Ga0208461_11141702 | 3300025613 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGWTLLIAIVAIMVNVIALIKEVKNENHKL |
| Ga0208824_10280445 | 3300025629 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGWTLLIAIVAIMVNVIALIKEVKNENHKL |
| Ga0208824_10484104 | 3300025629 | Anaerobic Digestor Sludge | MTTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| Ga0208198_11554401 | 3300025638 | Anaerobic Digestor Sludge | TMTAEPITLLDLAAGWTLLIAIVAIMVNVIALIKEVKNENHKL |
| Ga0208198_11767692 | 3300025638 | Anaerobic Digestor Sludge | AEPLTLLDLAAGLTLLIALVAIVVNVACLVKEYIIDKRNE |
| Ga0209719_10172736 | 3300025677 | Anaerobic Digestor Sludge | MIMTAEPLTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA |
| Ga0209719_10849292 | 3300025677 | Anaerobic Digestor Sludge | TLLDLAAGLTLLIALVAIVVNVIALVREYIIDKRNE |
| Ga0209718_11522113 | 3300025682 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIMVNVIALLREYFGRNNV |
| Ga0209506_10093729 | 3300025686 | Anaerobic Digestor Sludge | MTTEPLTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA |
| Ga0209506_10865422 | 3300025686 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIMVNVIALLREYFGKKK |
| Ga0209201_10935272 | 3300025708 | Anaerobic Digestor Sludge | MTAEPMTLLDLAAGWTLLIAIVAIMVNVIALLREYFGKKK |
| Ga0209201_11320921 | 3300025708 | Anaerobic Digestor Sludge | ITLLDLAAGLTLLIALVAIVVNVIYLVKEYIKSQNDRAR |
| Ga0209201_11548312 | 3300025708 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVACLVKEYIIDKRNE |
| Ga0208195_11331862 | 3300025713 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK |
| Ga0208197_10573101 | 3300025720 | Anaerobic Digestor Sludge | MIMTAEPLTLLDLAAGLTLLIALVAIVVNVIALVREYIIDKRNE |
| Ga0208694_12597231 | 3300025737 | Anaerobic Digestor Sludge | MTAEPLTLLDLAAGWTLLIAIVAIMVNVIALLREYFGKKK |
| Ga0208940_10268418 | 3300025740 | Anaerobic Digestor Sludge | MTTEPLTLLDLALGLTLLIAIVAIMVNVIALLREYF |
| Ga0208939_11168422 | 3300025772 | Anaerobic Digestor Sludge | TAEPLTLLDLVAGLTLLIALVAIVVNVACLVKEYIIDKRNE |
| Ga0209200_10340492 | 3300025784 | Anaerobic Digestor Sludge | MIMTAEPITLLDLAAGWTLLIALVAIVVNVIALLREYFGKKK |
| Ga0209200_11062642 | 3300025784 | Anaerobic Digestor Sludge | MTAEPITLLDLAAGLTLLIAIVAIMVNVIALLREYFGKKK |
| Ga0209604_10699293 | 3300025856 | Anaerobic Digestor Sludge | MIMTAEPMTLLDLAAGLTLLIAIVAIVVNVIALIKEVKNENHKL |
| Ga0209604_11522803 | 3300025856 | Anaerobic Digestor Sludge | MTESITLLDLAAGLTLLIALVAIVVNVIYLVKEYIKSQNDRA |
| Ga0209605_13234863 | 3300025861 | Anaerobic Digestor Sludge | SIRSAEPLTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA |
| Ga0209311_10351244 | 3300025871 | Anaerobic Digestor Sludge | MTTEPITLLDLAAGLTLLIALVAIVVNVIALLREYIIDKRNE |
| Ga0208460_102285882 | 3300025877 | Anaerobic Digestor Sludge | MTAEPLTLLDLALGLTLLIAIVAIVVNVIALLREYFGKKK |
| Ga0208916_102105062 | 3300025896 | Aqueous | VRGVEMTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255343_10422366 | 3300028561 | Wastewater | MTTEPITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK |
| (restricted) Ga0255343_10646082 | 3300028561 | Wastewater | MTTAEPLTLLDLALGLTLLIALVAIVVNVIALIKEYLLDKRNK |
| (restricted) Ga0255343_10739641 | 3300028561 | Wastewater | MTESITLLDLALGLTLLIAIVAIVVNVIYLVKEYIKSQND |
| (restricted) Ga0255343_11385361 | 3300028561 | Wastewater | ITMTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255343_11720673 | 3300028561 | Wastewater | MTAEPLTLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255344_10323952 | 3300028564 | Wastewater | MTESITLLDLAAGLTLLIALVAIVVNVIALLREYIIDKRNE |
| (restricted) Ga0255344_11524442 | 3300028564 | Wastewater | VRGRRITMTAEPLTLLDLALGLTLLIAIVAIVVNVIALLREYFGKKK |
| (restricted) Ga0255344_12428971 | 3300028564 | Wastewater | ITMTTEPMTLLDLAVCLTLLIAIVAIVVNVICLVKEYIKSQNDRAR |
| (restricted) Ga0255344_12492982 | 3300028564 | Wastewater | MTAEPITLLDLAAGLTLLIALVAIVVNVIALVREYIKSQNE |
| (restricted) Ga0255344_12675363 | 3300028564 | Wastewater | MIMTAEPMTLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255344_13174191 | 3300028564 | Wastewater | SCYSKDKVIGAEMEALTLLDLAAGLTLLIAIVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255344_13473912 | 3300028564 | Wastewater | MTAEPLTLLDLALGLTLLIALVAIVVNVIALVKEYIKSQND |
| (restricted) Ga0255342_12044562 | 3300028567 | Wastewater | MTAEPLTLLDLALGLTLLIALVAIVVNVIALVREYIKSQNE |
| (restricted) Ga0255345_10400971 | 3300028568 | Wastewater | MTAEPLTLLDLAAGLTLLIAIVAIVVNVIALLREYIIDKRNE |
| (restricted) Ga0255345_11488072 | 3300028568 | Wastewater | MTAEPMTLLDLAVCLTLLIAIVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255345_11639101 | 3300028568 | Wastewater | RITMTTEPMTLLDLAVCLTLLIAIVAIVVNVICLVKEYIKSQNDRAR |
| (restricted) Ga0255345_13446222 | 3300028568 | Wastewater | RRITMTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255341_10139442 | 3300028570 | Wastewater | MTTEPITLLDLAAGLTLLIAIVAIVVNVIALLREYFGKKK |
| (restricted) Ga0255341_10759812 | 3300028570 | Wastewater | MTAEPLTLLDLALGLTLLIAIVAIVVNVIYLVKEYIKSQND |
| (restricted) Ga0255340_13202581 | 3300028576 | Wastewater | MTAEPLTLLDLAAGLTLLIAIVAIVVNVIALIKEYFGRKNV |
| (restricted) Ga0255346_10334243 | 3300028677 | Wastewater | MTESITLLDLAAGLTLLIALVAIVVNVIALLREYFGKKK |
| (restricted) Ga0255346_10432923 | 3300028677 | Wastewater | MTAEPITLLDLAAGLTLLIAIVAIVVNVIALLREYFGKEVHK |
| (restricted) Ga0255346_10710815 | 3300028677 | Wastewater | MTESITLLDLAAGLTLLIALVAIVVNVIALLREYIIDKRNVGEIEKE |
| (restricted) Ga0255346_12614242 | 3300028677 | Wastewater | MEALTLLDLAAGLTLLIALVAIVVNVIALVKEYIKSQNVRA |
| (restricted) Ga0255346_12914593 | 3300028677 | Wastewater | MEALTLLDLALGATLLVALVAVVVNVIALLREYFGKKK |
| (restricted) Ga0255346_13006371 | 3300028677 | Wastewater | MTAEPLTLLDLALGLTLLIAIVAIVVNVIALLREY |
| Ga0265297_107770642 | 3300029288 | Landfill Leachate | MTAEPMTLLDLAVCLTLLIAIVAIVVNVICLVKEYLLDKKYRQ |
| Ga0167330_10311472 | 3300029781 | Biosolids | MIMTTEPITLLDLAAGLTLLIALVAIVVNVIALIKEYFGRKNV |
| ⦗Top⦘ |