


| Basic Information | |
|---|---|
| Family ID | F073224 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 51 residues |
| Representative Sequence | PDSAFAWLERASWRWPHRAVLSDPALDPLRSDPRFARLSERVAREMGLR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 92.50 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (20.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 3.33 |
| PF06983 | 3-dmu-9_3-mt | 2.50 |
| PF00069 | Pkinase | 2.50 |
| PF00753 | Lactamase_B | 2.50 |
| PF02687 | FtsX | 2.50 |
| PF03551 | PadR | 1.67 |
| PF13360 | PQQ_2 | 1.67 |
| PF05163 | DinB | 1.67 |
| PF04389 | Peptidase_M28 | 1.67 |
| PF07676 | PD40 | 1.67 |
| PF07638 | Sigma70_ECF | 1.67 |
| PF13683 | rve_3 | 1.67 |
| PF11695 | DUF3291 | 1.67 |
| PF05685 | Uma2 | 1.67 |
| PF00501 | AMP-binding | 0.83 |
| PF00196 | GerE | 0.83 |
| PF06094 | GGACT | 0.83 |
| PF00775 | Dioxygenase_C | 0.83 |
| PF02423 | OCD_Mu_crystall | 0.83 |
| PF00127 | Copper-bind | 0.83 |
| PF01035 | DNA_binding_1 | 0.83 |
| PF02922 | CBM_48 | 0.83 |
| PF00578 | AhpC-TSA | 0.83 |
| PF01464 | SLT | 0.83 |
| PF11138 | DUF2911 | 0.83 |
| PF03060 | NMO | 0.83 |
| PF13305 | TetR_C_33 | 0.83 |
| PF02311 | AraC_binding | 0.83 |
| PF00266 | Aminotran_5 | 0.83 |
| PF01341 | Glyco_hydro_6 | 0.83 |
| PF03992 | ABM | 0.83 |
| PF03372 | Exo_endo_phos | 0.83 |
| PF04616 | Glyco_hydro_43 | 0.83 |
| PF00248 | Aldo_ket_red | 0.83 |
| PF00296 | Bac_luciferase | 0.83 |
| PF04909 | Amidohydro_2 | 0.83 |
| PF13673 | Acetyltransf_10 | 0.83 |
| PF01965 | DJ-1_PfpI | 0.83 |
| PF00246 | Peptidase_M14 | 0.83 |
| PF13370 | Fer4_13 | 0.83 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF03851 | UvdE | 0.83 |
| PF00884 | Sulfatase | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| PF13540 | RCC1_2 | 0.83 |
| PF11954 | DUF3471 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 10.00 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 2.50 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 2.50 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.67 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.67 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.67 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.67 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.67 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.67 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.83 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.83 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.83 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.83 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.83 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.83 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c1121187 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_102018445 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300000890|JGI11643J12802_10257023 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300000890|JGI11643J12802_11264800 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300004156|Ga0062589_101385072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 685 | Open in IMG/M |
| 3300004157|Ga0062590_101554550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 667 | Open in IMG/M |
| 3300004643|Ga0062591_101539543 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005290|Ga0065712_10199133 | Not Available | 1115 | Open in IMG/M |
| 3300005331|Ga0070670_101941828 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005344|Ga0070661_101251040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 622 | Open in IMG/M |
| 3300005353|Ga0070669_101432733 | Not Available | 600 | Open in IMG/M |
| 3300005364|Ga0070673_100411505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300005456|Ga0070678_101120914 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005535|Ga0070684_102004490 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005615|Ga0070702_100560597 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300005616|Ga0068852_101955092 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005617|Ga0068859_100033794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5134 | Open in IMG/M |
| 3300005618|Ga0068864_101437015 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005719|Ga0068861_101984527 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005834|Ga0068851_10368099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 839 | Open in IMG/M |
| 3300005844|Ga0068862_100004538 | All Organisms → cellular organisms → Bacteria | 11703 | Open in IMG/M |
| 3300006058|Ga0075432_10148189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 900 | Open in IMG/M |
| 3300006844|Ga0075428_100119593 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300006845|Ga0075421_100359712 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300006845|Ga0075421_101851259 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006845|Ga0075421_101869452 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006845|Ga0075421_102535487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 533 | Open in IMG/M |
| 3300006846|Ga0075430_100023368 | All Organisms → cellular organisms → Bacteria | 5261 | Open in IMG/M |
| 3300006847|Ga0075431_100296431 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300006847|Ga0075431_100383443 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300006852|Ga0075433_10126027 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300006853|Ga0075420_101454660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 588 | Open in IMG/M |
| 3300006853|Ga0075420_101695074 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006880|Ga0075429_100073481 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
| 3300006880|Ga0075429_100621206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 947 | Open in IMG/M |
| 3300006880|Ga0075429_101053260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 711 | Open in IMG/M |
| 3300006880|Ga0075429_101563401 | Not Available | 573 | Open in IMG/M |
| 3300006894|Ga0079215_10773583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300006918|Ga0079216_10404128 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006969|Ga0075419_10078689 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300006969|Ga0075419_10220897 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300007004|Ga0079218_10267401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300007004|Ga0079218_11697290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 700 | Open in IMG/M |
| 3300007076|Ga0075435_101485708 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009147|Ga0114129_10145400 | All Organisms → cellular organisms → Bacteria | 3248 | Open in IMG/M |
| 3300009153|Ga0105094_10895699 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300009156|Ga0111538_12504748 | All Organisms → cellular organisms → Bacteria → FCB group | 647 | Open in IMG/M |
| 3300009177|Ga0105248_10420208 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300009789|Ga0126307_11467176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300009840|Ga0126313_10636646 | Not Available | 861 | Open in IMG/M |
| 3300010036|Ga0126305_10716948 | Not Available | 677 | Open in IMG/M |
| 3300010040|Ga0126308_10458003 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300010040|Ga0126308_11040621 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300010044|Ga0126310_11090773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300010399|Ga0134127_13557948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300012893|Ga0157284_10241002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300012940|Ga0164243_10864835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
| 3300012960|Ga0164301_10459427 | Not Available | 908 | Open in IMG/M |
| 3300012971|Ga0126369_11218538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300013100|Ga0157373_11130398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 588 | Open in IMG/M |
| 3300014326|Ga0157380_10437374 | Not Available | 1252 | Open in IMG/M |
| 3300014745|Ga0157377_10165332 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300014968|Ga0157379_10723422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 935 | Open in IMG/M |
| 3300015372|Ga0132256_102967486 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300015374|Ga0132255_102103953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 860 | Open in IMG/M |
| 3300015374|Ga0132255_102812942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 744 | Open in IMG/M |
| 3300018081|Ga0184625_10505881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300018469|Ga0190270_12727714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300018476|Ga0190274_11097514 | Not Available | 875 | Open in IMG/M |
| 3300025910|Ga0207684_11115227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
| 3300025917|Ga0207660_11546024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
| 3300025920|Ga0207649_11155610 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025925|Ga0207650_10842000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 778 | Open in IMG/M |
| 3300025926|Ga0207659_11319437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 619 | Open in IMG/M |
| 3300025941|Ga0207711_11672064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 580 | Open in IMG/M |
| 3300025945|Ga0207679_11670120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
| 3300025981|Ga0207640_10694753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C1TDCM | 871 | Open in IMG/M |
| 3300025986|Ga0207658_10375174 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300027650|Ga0256866_1153512 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027873|Ga0209814_10439693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300027880|Ga0209481_10236721 | Not Available | 918 | Open in IMG/M |
| 3300027880|Ga0209481_10311946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300027886|Ga0209486_10084749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1654 | Open in IMG/M |
| 3300027886|Ga0209486_10493181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
| 3300027886|Ga0209486_11180946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300027909|Ga0209382_11481735 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300028379|Ga0268266_10645272 | All Organisms → cellular organisms → Bacteria → FCB group | 1019 | Open in IMG/M |
| 3300028380|Ga0268265_10009832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6456 | Open in IMG/M |
| 3300028380|Ga0268265_10695770 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300028596|Ga0247821_11264124 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 503 | Open in IMG/M |
| 3300028784|Ga0307282_10199844 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028809|Ga0247824_10539356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 693 | Open in IMG/M |
| 3300028889|Ga0247827_11072308 | Not Available | 552 | Open in IMG/M |
| 3300030336|Ga0247826_11239685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 599 | Open in IMG/M |
| 3300030496|Ga0268240_10103598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
| 3300030620|Ga0302046_10296282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1330 | Open in IMG/M |
| 3300031547|Ga0310887_10524006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 717 | Open in IMG/M |
| 3300031548|Ga0307408_101103465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 736 | Open in IMG/M |
| 3300031731|Ga0307405_10967674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 724 | Open in IMG/M |
| 3300031824|Ga0307413_10324898 | Not Available | 1177 | Open in IMG/M |
| 3300031824|Ga0307413_10562740 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 927 | Open in IMG/M |
| 3300031852|Ga0307410_10394250 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300031852|Ga0307410_11100898 | Not Available | 689 | Open in IMG/M |
| 3300031901|Ga0307406_10908951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 750 | Open in IMG/M |
| 3300031901|Ga0307406_11470581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300031913|Ga0310891_10038095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300031995|Ga0307409_100341250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1409 | Open in IMG/M |
| 3300031995|Ga0307409_100781454 | Not Available | 961 | Open in IMG/M |
| 3300032002|Ga0307416_100338059 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300032002|Ga0307416_100938301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 967 | Open in IMG/M |
| 3300032004|Ga0307414_10396590 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300032004|Ga0307414_11707645 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
| 3300032004|Ga0307414_12232766 | Not Available | 511 | Open in IMG/M |
| 3300032005|Ga0307411_10843770 | Not Available | 810 | Open in IMG/M |
| 3300032017|Ga0310899_10473654 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300032075|Ga0310890_11316994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 591 | Open in IMG/M |
| 3300032126|Ga0307415_100257322 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300032126|Ga0307415_100615893 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 968 | Open in IMG/M |
| 3300032144|Ga0315910_10479961 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300033551|Ga0247830_11643233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 20.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_11211872 | 2228664021 | Soil | AFAWLERASWLWPHRAVLSDPALDPLRSDPRFARLSERVAREMGLR |
| INPhiseqgaiiFebDRAFT_1020184451 | 3300000364 | Soil | FERTSWQWPHRAALDDPALDPLRADPRFPQLAARIQRDMGMR* |
| JGI11643J12802_102570233 | 3300000890 | Soil | PDSAFAWLERASWRWPHRAVLSDPALDPLRADPRFARLSERVAREMGLR* |
| JGI11643J12802_112648001 | 3300000890 | Soil | PDSAFAWLERASWRWPHRAVLSDPALDPLRSDPRFARLSERVAREMGLR* |
| Ga0062589_1013850722 | 3300004156 | Soil | TWTWPHRAVRSDPALDRLRSDPRFAQLSARIEREMGMEPRLAVQ* |
| Ga0062590_1015545501 | 3300004157 | Soil | RSSWLWPHRAALVDPALDPIRTDPRFSRLSDRIAREMGLR* |
| Ga0062591_1015395432 | 3300004643 | Soil | EPFNIGRAYVALQEPDSAFAWLERSSWQWPSRAVRMDPALDPIRSDPRFARLSERIEREMGLR* |
| Ga0065712_101991332 | 3300005290 | Miscanthus Rhizosphere | FAWLEPRTWTWPHRAVRSDPALDRLRSDPRFAQLSARIEREMGMEPRLAVQ* |
| Ga0070670_1019418281 | 3300005331 | Switchgrass Rhizosphere | HIALGEPDSAFAWLDRADWRWPHRGNRYDPTLDPVRADPRFARLSQRIDREMGLR* |
| Ga0070661_1012510401 | 3300005344 | Corn Rhizosphere | SSWKWPHRAVRADPALDPLRSDPRFIRLSERIEREMGLR* |
| Ga0070669_1014327331 | 3300005353 | Switchgrass Rhizosphere | ERANWRWPHRGVRADPALDPLRSDPRFVRLSARVASEMGMAK* |
| Ga0070673_1004115052 | 3300005364 | Switchgrass Rhizosphere | LERSSWQWPHRAVRADPALDPLRADPRFAQLSAKVAKAMGIQ* |
| Ga0070678_1011209141 | 3300005456 | Miscanthus Rhizosphere | AWLERSSWQWPHRAVRIDPALDPLRSDPRFARLTERIDREMGMR* |
| Ga0070684_1020044902 | 3300005535 | Corn Rhizosphere | LERSSWQWPHRAVRSDPALDPLRADPRFARLSARVDREMGMR* |
| Ga0070702_1005605971 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AWFERTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR* |
| Ga0068852_1019550921 | 3300005616 | Corn Rhizosphere | VWLERSNWQFPHRAVRSDPGLDPLRSDARFARLADRIDREMGVR* |
| Ga0068859_1000337941 | 3300005617 | Switchgrass Rhizosphere | IARAHMALGDLDSAFVWFDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR* |
| Ga0068864_1014370152 | 3300005618 | Switchgrass Rhizosphere | ALGDLDSAFVWFDRADWRWPHRGNRYDPTLDPVRADPRFIRLSERVDREMGLR* |
| Ga0068861_1019845271 | 3300005719 | Switchgrass Rhizosphere | ALQEPDSAFAWLERSSWQWPHRAVRMDPALDPIRSDPRFARLSERIEREMGLR* |
| Ga0068851_103680991 | 3300005834 | Corn Rhizosphere | PFSIARAYVAPAEPDSAFAWLEPRTWTWPHRAVRSDPALDRVRSDPRFAQLSARIEREMGMEPRLAVQ* |
| Ga0068862_10000453816 | 3300005844 | Switchgrass Rhizosphere | RAYVALGEPDSAFAWLERATWNFPHRADRRDPALDGGSDARFARLVSRIDREMGLRGTH* |
| Ga0075432_101481891 | 3300006058 | Populus Rhizosphere | ARMALGDLDSAFVWFDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR* |
| Ga0075428_1001195933 | 3300006844 | Populus Rhizosphere | DSAFTWFERASWKWPHRAVLDDPALDPVRADPRFAQLSERIARDMGMR* |
| Ga0075421_1003597121 | 3300006845 | Populus Rhizosphere | LQEPDSAFAWLDKSSWLWPHRAALIDPALDPIRSDPRFAKLSDRIGREMGLR* |
| Ga0075421_1018512591 | 3300006845 | Populus Rhizosphere | VALGEPDSAFAWFDRADWRWPHRGNRYDPALDLVRADPRFARLSERIDREMGVR* |
| Ga0075421_1018694522 | 3300006845 | Populus Rhizosphere | FNIGRAYVALQEPDSAFAWLERSSWQWPHRAVRMDPALDPIRSDPRFARLSERIEREMGLR* |
| Ga0075421_1025354872 | 3300006845 | Populus Rhizosphere | SAFAWLERSRWQWPHRAVLSDPALDPLRSDPRFARLVERVEREMGIR* |
| Ga0075430_1000233681 | 3300006846 | Populus Rhizosphere | AWFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGMR* |
| Ga0075431_1002964311 | 3300006847 | Populus Rhizosphere | PDSAFAWFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGLR* |
| Ga0075431_1003834432 | 3300006847 | Populus Rhizosphere | PDSAFAWFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGMR* |
| Ga0075433_101260272 | 3300006852 | Populus Rhizosphere | LNEPDSAFAWFERTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR* |
| Ga0075420_1014546602 | 3300006853 | Populus Rhizosphere | FSIGRAYVALGEPDSAFAWFDRADWRWPHRGNRYDPALDPVRADPRFTRLSERVAREMGLR* |
| Ga0075420_1016950742 | 3300006853 | Populus Rhizosphere | EPFNIGRAYVALRQPDSAFVWLERSNWRFPHRAVRADPGLDPLRTDIRFTRLADRIDREMGIR* |
| Ga0075429_1000734811 | 3300006880 | Populus Rhizosphere | AWFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGLR* |
| Ga0075429_1006212063 | 3300006880 | Populus Rhizosphere | LGEPDSAFAWFERASWQWPHRAVLDDPALDPVRADPRFAQLSERIARDMGMR* |
| Ga0075429_1010532602 | 3300006880 | Populus Rhizosphere | FSIGRAHIALGEPDSAFAWLDRADWRFPQRGNRFDPTLDPLRADPRFARLSQRIDREMGVR* |
| Ga0075429_1015634011 | 3300006880 | Populus Rhizosphere | FDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGMR* |
| Ga0079215_107735832 | 3300006894 | Agricultural Soil | DSAFAWLERSSWQWPHRAARADPALDPLRADPRFARLTERVDREMGLR* |
| Ga0079216_104041281 | 3300006918 | Agricultural Soil | PDSAFAWLERSPWQWPHRAARGDPALDPLRSDARFTQLSKRIDRDMGIN* |
| Ga0075419_100786892 | 3300006969 | Populus Rhizosphere | WFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGMR* |
| Ga0075419_102208972 | 3300006969 | Populus Rhizosphere | WFDRADWRWPHRGNRYDPALDPVRADPRFARLSDRIDREMGLR* |
| Ga0079218_102674011 | 3300007004 | Agricultural Soil | RSRWQWPHRAVLSDPALDPLRADPRFARLTSRVAREMGIR* |
| Ga0079218_116972901 | 3300007004 | Agricultural Soil | RAFVALRQDDSAFVWLERSNWRWPHRAVRWDPALDRVRSDPRFARLSSRIDSVTGMR* |
| Ga0075435_1014857081 | 3300007076 | Populus Rhizosphere | SAFAWLERSNWKFPHRAVRSDPALDPLRSDPRFSRLAARVEREMGLQR* |
| Ga0114129_101454001 | 3300009147 | Populus Rhizosphere | NWQWPHRAILSDPTLDPLRADPRFARLTARVARDMGIQ* |
| Ga0105094_108956991 | 3300009153 | Freshwater Sediment | NIARAHVALGEVDSAFAWFERSNWRWPHRAALADPALDPIRSDPRYAPMVERIEREMGIR |
| Ga0111538_125047481 | 3300009156 | Populus Rhizosphere | WPHRAALIDPALDPIRSDPRFAQLSDRVEREMGLR* |
| Ga0105248_104202081 | 3300009177 | Switchgrass Rhizosphere | SAFVWLERSNWKFPHRAVRSDPGLDPLRSDARFARLADRIDREMGVR* |
| Ga0126307_114671762 | 3300009789 | Serpentine Soil | LNETDSAFAWLDRSSWRWPHRAVRADPALDPIRSDPRFAQLSARVEREMGIR* |
| Ga0126313_106366461 | 3300009840 | Serpentine Soil | SWKWPHRALRADPALDPIRSDPRFVRLSARIEREMGIKYSPSERR* |
| Ga0126305_107169482 | 3300010036 | Serpentine Soil | PDSAFAWLDRSSWTWPHRALRADPALDPLRSDPRFARLSARIEREMGIK* |
| Ga0126308_104580032 | 3300010040 | Serpentine Soil | WEGFSIARAYVAMSMPDSAFAWLERSSWVWPHRAVRADPALDPLRSDPRFARLSAQVAKEMGMQ* |
| Ga0126308_110406211 | 3300010040 | Serpentine Soil | SIGRAHIALGEPDSAFAWLDRADWRWPHRGNRYDPTLDPVRADPRFARLSQRIDREMGLR |
| Ga0126310_110907731 | 3300010044 | Serpentine Soil | DSAFAWLDRSSWTWPHRAARADPTLDPIRSDPRFIRLSARIDQEMGIR* |
| Ga0134127_135579481 | 3300010399 | Terrestrial Soil | RAYVALQEPDSAFVWLDRSSWLWPHRAAVIDPALDPLRSDPRFARLSDRIEREMGLR* |
| Ga0157284_102410022 | 3300012893 | Soil | ATLELAKASPREPFNIGRAYVALQEPDSAFAWLERSSWQWPSRAVRMDPALDPIRSDPRFARLSERIEREMGLR* |
| Ga0164243_108648352 | 3300012940 | Compost | RAYVALGEPDSAFAWLDRANWKWPHRAVLSDPALDPIRADPRFARLSERVEHEMGLR* |
| Ga0164301_104594271 | 3300012960 | Soil | FPHRAARSDPALDPLRSDLRFSRLAARIEREMGMER* |
| Ga0126369_112185381 | 3300012971 | Tropical Forest Soil | ERSSWLWPHRAVLSDPALDRLRSDPRFARLAARVEREMGMRPKLALE* |
| Ga0157373_111303981 | 3300013100 | Corn Rhizosphere | AEPDSAFAWLEPRTWTWPHRAVRSDPALDRLRSDPRFAQLSARIEREMGMEPRLAVQ* |
| Ga0157380_104373743 | 3300014326 | Switchgrass Rhizosphere | RTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR* |
| Ga0157377_101653321 | 3300014745 | Miscanthus Rhizosphere | GVWLERSNWKLPHRAVRSDPGLDPLRCDARFARLADRIDREMGVR* |
| Ga0157379_107234221 | 3300014968 | Switchgrass Rhizosphere | DAATQPREPFTIARAWIALQERDSAFAWLDRSSWLWPHRAALVDPALDPIRSDPRFARLSDRIEREMGLR* |
| Ga0132256_1029674861 | 3300015372 | Arabidopsis Rhizosphere | LRQSDSAFVWLERSNWKFPHRAVRSDPGLDPLRSDARFARLADRIDREMGVR* |
| Ga0132255_1021039531 | 3300015374 | Arabidopsis Rhizosphere | RAYAGLNEPDSAFAWFERTSWEWPHRAVLDDPALDPLRADPRFAQLASRIQRNMGMR* |
| Ga0132255_1028129421 | 3300015374 | Arabidopsis Rhizosphere | YVALQEPDSAFAWLERSSWQWPHRAVRMDPALDPIRSDPRFARLSERIEREMGLRIGAEPTSPAPSR* |
| Ga0184625_105058811 | 3300018081 | Groundwater Sediment | QWTHRADRRDPGLDAVRSDPRFARLSARIDRDMGVRQ |
| Ga0190270_127277141 | 3300018469 | Soil | SAFAWLDRANWRFGHRAARSDPALDPLRSDPRFAELVLRVDRELGMR |
| Ga0190274_110975141 | 3300018476 | Soil | RLAKVQPREPFTVARGHVALQEPDSAFVWLDRSSWKWPHRAVLADPALDPVRADPRFVQLSARVEREMGLR |
| Ga0207684_111152271 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLNEPDSAFAWFERTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR |
| Ga0207660_115460241 | 3300025917 | Corn Rhizosphere | ESLRRAELQPREPFNIARAYVALGEPDSAFAWLERANWKWPHRAVLSDPALDPIRADPRFVQLSERVAREMGLR |
| Ga0207649_111556101 | 3300025920 | Corn Rhizosphere | LGEPDSAFAWLDRSSWKWPHRALRADPALDPLRSDPRFTRLSERIDHEMGLR |
| Ga0207650_108420001 | 3300025925 | Switchgrass Rhizosphere | QWLASRSYVAPAEPDSAFAWLEPRTWTWPHRAVRSDPALDRLRSDPRFAQLSARIEREMGMEPRLAVQ |
| Ga0207659_113194371 | 3300025926 | Miscanthus Rhizosphere | SWLWPHRAALVDPALDPIRSDPRFARLSDRIEREMGLR |
| Ga0207711_116720642 | 3300025941 | Switchgrass Rhizosphere | FVWFDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR |
| Ga0207679_116701201 | 3300025945 | Corn Rhizosphere | AFSIGRARMALGDLDSAFVWFDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR |
| Ga0207640_106947531 | 3300025981 | Corn Rhizosphere | FVWLERSNWKFPHRAVRSDPGLDPLRSDARFARLADRIDREMGVR |
| Ga0207658_103751741 | 3300025986 | Switchgrass Rhizosphere | AFAWFERTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR |
| Ga0256866_11535122 | 3300027650 | Soil | AALGEKDSAFAWFERSSWRWPHRAVRADPALDRLRADPRFDLLVQRVDREMGLR |
| Ga0209814_104396932 | 3300027873 | Populus Rhizosphere | DSAFAWFDRADWRWPHRGNRYDPALDPVRADPRFARLSQRIDREMGMR |
| Ga0209481_102367212 | 3300027880 | Populus Rhizosphere | RSNWKFPHRAVRAEPALDSLRSDARFVRLVERIDREMGLR |
| Ga0209481_103119461 | 3300027880 | Populus Rhizosphere | AFAWLERSRWQWPHRAVLSDPALDPLRSDPRFARLVERVEREMGIR |
| Ga0209486_100847491 | 3300027886 | Agricultural Soil | IARAYVALQQPDSAFALLERSNWHWTHRADRRDPALDPVRSDPRFARLSARIDQQMGVRQ |
| Ga0209486_104931812 | 3300027886 | Agricultural Soil | VALGEPDSAFAWFDRADWRWPHRGNRYDPALDPVRADPRFARLSQRIDREMGVR |
| Ga0209486_111809462 | 3300027886 | Agricultural Soil | LGEPDSAFAWLDRSSWKWPHRAVRADPALDPLRSDPRFAELSVRIEREMGIR |
| Ga0209382_114817351 | 3300027909 | Populus Rhizosphere | HVALGEPDSAFAWFDRAEWRWPHRGNRFDPALDPVRADPRFARLSERIDREMGLR |
| Ga0268266_106452722 | 3300028379 | Switchgrass Rhizosphere | FEPFNIGRAYVALGEPDSAFAWLERSSWQWPDRAARIDPGLVPLHGDPRFARLSARVNRDMGMR |
| Ga0268265_100098321 | 3300028380 | Switchgrass Rhizosphere | YVALQEPDSAFVWLDRSSWLWPHRAAVIDPALDPLRSDPRFARLSDRIEREMGLR |
| Ga0268265_106957701 | 3300028380 | Switchgrass Rhizosphere | NIGRAHVGLNEPDSAFAWFERTSWEWPHRASLDDPALDPVRADPRFPQLAARIQRDMGMR |
| Ga0247821_112641241 | 3300028596 | Soil | YAWFDRADWRWPHRGNRYDPALDPVRSDPRFARLSARVDREMGLR |
| Ga0307282_101998441 | 3300028784 | Soil | SAFAWLERSTWQFPHRAVLSDPALDPIRGDPRFARLRARIARDMGIR |
| Ga0247824_105393561 | 3300028809 | Soil | EPDSAFAWLERSSWQWPHRANRGDLGLDPLRSDPRFARLVVRIEREMGMQ |
| Ga0247827_110723082 | 3300028889 | Soil | AVGDLDSAFAWLDRADWRWPHRGNRYDPALASVRADPRFVRLSERVDREMGMR |
| Ga0247826_112396851 | 3300030336 | Soil | IGRARMALGDLDSAFAWLDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR |
| Ga0268240_101035981 | 3300030496 | Soil | WLDRADWRWPHRGNRFDPALDPLRADPRFARLSERVDREMGIR |
| Ga0302046_102962821 | 3300030620 | Soil | ALRQPDSAFTWLERGSWQWPHRAVLSDPGLDPLRTDARFARLSARVEGEMGIR |
| Ga0310887_105240061 | 3300031547 | Soil | ALGDLDSAFVWFDRADWRWPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR |
| Ga0307408_1011034652 | 3300031548 | Rhizosphere | NIARAHVALQEPDSAFAWLDRSGWLWPHRAALIDPALDPIRSDPRFGLLSSRIRREMGLR |
| Ga0307405_109676742 | 3300031731 | Rhizosphere | FGNNRAPFEPFNVARAYVALREPDSAFAWLDRSNWLWPHRAALIDPALDPIPSDPRFARLSDRIQREMGLR |
| Ga0307413_103248981 | 3300031824 | Rhizosphere | SNWLWPHRAALIDPALDPIPSDPRFARLSDRIQREMGLR |
| Ga0307413_105627401 | 3300031824 | Rhizosphere | NIGRAYVALGEPDSAFAWLDRARWQWPHRAMLDDPALDPLRADPRFPRLRARITREMGLR |
| Ga0307410_103942502 | 3300031852 | Rhizosphere | DWTWPLYALRADPSLDPIRGDPRFAALSERVEREMGLR |
| Ga0307410_111008982 | 3300031852 | Rhizosphere | WPHRGNRYDPTLDPVRADPRFVRLSERVDREMGLR |
| Ga0307406_109089511 | 3300031901 | Rhizosphere | PDSAFAWLERSNWNWSHRADRRDPALDAVRSDPRFARLSARIDKQMGLRQ |
| Ga0307406_114705812 | 3300031901 | Rhizosphere | AYVALRQPDSAFKWLERSNWQWTHRADRRDPALDPVRADPRFARLSARVDREMGVRQ |
| Ga0310891_100380951 | 3300031913 | Soil | SSWLWPHRAAVIDPALDPLRSDPRFARLSDRIEREMGLR |
| Ga0307409_1003412501 | 3300031995 | Rhizosphere | DSAFAWLERSAWQWPHRAVRGDPALDPLRADPRFSRISERVDREMGVR |
| Ga0307409_1007814541 | 3300031995 | Rhizosphere | ADWRWPHRGNRFDPALDPVRADPRFARLSQRIDREMGVR |
| Ga0307416_1003380593 | 3300032002 | Rhizosphere | VALGEADSAFAWFERADWRWPHRGNRYDPALDPVRADLRFARLSERIDREMGMR |
| Ga0307416_1009383012 | 3300032002 | Rhizosphere | PDSAFAWLDRADWRWPHRGNRYDPTLDPVRADPRFARLSQRIDQEMGLR |
| Ga0307414_103965901 | 3300032004 | Rhizosphere | DSAFAWLERSAWQWPHRAVRGDPALDPLRADPRFTRISERVDREMGVQ |
| Ga0307414_117076451 | 3300032004 | Rhizosphere | VALGEADSAFAWFERADWRWPHRGNRYDPTLDPVRADLRFARLSERIDR |
| Ga0307414_122327661 | 3300032004 | Rhizosphere | PDSAFAWLERSSWKWPHRAIRADPALDPLRSDPRFARLSLRVEREMGIR |
| Ga0307411_108437701 | 3300032005 | Rhizosphere | WPHRGNRFDPALDPVRADPRFARLSQRIDREMGVR |
| Ga0310899_104736541 | 3300032017 | Soil | SSWLWPHRAALVDPALDPIRSDPRFTRLSERIDREMGLR |
| Ga0310890_113169941 | 3300032075 | Soil | RAYVALQEPDSAFAWLERSSWQWPHRAVRMDPALDPIRSDPRFARLSERIEREMGLR |
| Ga0307415_1002573221 | 3300032126 | Rhizosphere | WLERSSWKWPHRAMRADPALDPLRSDPRFARLSARVEREMGIR |
| Ga0307415_1006158932 | 3300032126 | Rhizosphere | RSAWQWPHRAVRGDPALDPLRADPRFSRISERVDREMGVR |
| Ga0315910_104799611 | 3300032144 | Soil | AQPKEPFTIARALVALHELDSAFVWLDRSSWLWPHRAALVDPALDPIRSDPRFAQLQVRINREMGLR |
| Ga0247830_116432332 | 3300033551 | Soil | GRAHIALGEPDSAFAWFDRADWRWPHRGNRYDPTLDPVRADPRFARLSQRIDREMGLR |
| ⦗Top⦘ |