


| Basic Information | |
|---|---|
| Family ID | F073219 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.67 % |
| % of genes near scaffold ends (potentially truncated) | 91.67 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02201 | SWIB | 27.50 |
| PF08546 | ApbA_C | 10.00 |
| PF13185 | GAF_2 | 5.00 |
| PF02538 | Hydantoinase_B | 4.17 |
| PF12773 | DZR | 3.33 |
| PF04909 | Amidohydro_2 | 3.33 |
| PF16123 | HAGH_C | 3.33 |
| PF00211 | Guanylate_cyc | 1.67 |
| PF13191 | AAA_16 | 0.83 |
| PF09084 | NMT1 | 0.83 |
| PF01977 | UbiD | 0.83 |
| PF09720 | Unstab_antitox | 0.83 |
| PF09844 | DUF2071 | 0.83 |
| PF02954 | HTH_8 | 0.83 |
| PF01527 | HTH_Tnp_1 | 0.83 |
| PF01850 | PIN | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 27.50 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 10.00 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 8.33 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.67 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1335309 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_10771936 | Not Available | 911 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_4260725 | Not Available | 911 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_8647264 | Not Available | 940 | Open in IMG/M |
| 2228664021|ICCgaii200_c1095571 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 2228664022|INPgaii200_c0672465 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1062800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10028358 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10129333 | Not Available | 614 | Open in IMG/M |
| 3300000787|JGI11643J11755_11469660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300000789|JGI1027J11758_12543797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300000858|JGI10213J12805_10392238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300000956|JGI10216J12902_100101261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1892 | Open in IMG/M |
| 3300002407|C687J29651_10202016 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004114|Ga0062593_101413078 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300004808|Ga0062381_10241128 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005093|Ga0062594_102010828 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005167|Ga0066672_10200063 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300005183|Ga0068993_10086285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300005294|Ga0065705_10382737 | Not Available | 907 | Open in IMG/M |
| 3300005294|Ga0065705_10771183 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005332|Ga0066388_105199903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005340|Ga0070689_100840042 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005440|Ga0070705_100734760 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005450|Ga0066682_10507986 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005713|Ga0066905_100444468 | Not Available | 1064 | Open in IMG/M |
| 3300005764|Ga0066903_107875435 | Not Available | 547 | Open in IMG/M |
| 3300005842|Ga0068858_102565623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005844|Ga0068862_102201976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300006844|Ga0075428_100928146 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 923 | Open in IMG/M |
| 3300006844|Ga0075428_101262177 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006847|Ga0075431_100748686 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300006853|Ga0075420_101005953 | Not Available | 717 | Open in IMG/M |
| 3300006871|Ga0075434_100389536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1414 | Open in IMG/M |
| 3300006876|Ga0079217_10005112 | All Organisms → cellular organisms → Bacteria | 3870 | Open in IMG/M |
| 3300006918|Ga0079216_10045045 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300006969|Ga0075419_11025015 | Not Available | 601 | Open in IMG/M |
| 3300009137|Ga0066709_102681872 | Not Available | 665 | Open in IMG/M |
| 3300009147|Ga0114129_10213539 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300009147|Ga0114129_12303904 | Not Available | 646 | Open in IMG/M |
| 3300009609|Ga0105347_1356614 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009792|Ga0126374_10660878 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300010037|Ga0126304_11168312 | Not Available | 527 | Open in IMG/M |
| 3300010046|Ga0126384_10834904 | Not Available | 827 | Open in IMG/M |
| 3300010047|Ga0126382_11565888 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010047|Ga0126382_11701633 | Not Available | 589 | Open in IMG/M |
| 3300010358|Ga0126370_12517083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300010359|Ga0126376_11169816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 782 | Open in IMG/M |
| 3300010361|Ga0126378_10359244 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300010362|Ga0126377_10968709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300010366|Ga0126379_12294054 | Not Available | 640 | Open in IMG/M |
| 3300010371|Ga0134125_10199208 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300010376|Ga0126381_100785362 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010397|Ga0134124_11638781 | Not Available | 674 | Open in IMG/M |
| 3300010398|Ga0126383_11002055 | Not Available | 924 | Open in IMG/M |
| 3300010398|Ga0126383_11166327 | Not Available | 860 | Open in IMG/M |
| 3300010401|Ga0134121_10981796 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300011443|Ga0137457_1279901 | Not Available | 570 | Open in IMG/M |
| 3300012200|Ga0137382_10055436 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300012204|Ga0137374_10116622 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300012207|Ga0137381_11804232 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012349|Ga0137387_10401330 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300012353|Ga0137367_10600247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300012354|Ga0137366_10939691 | Not Available | 606 | Open in IMG/M |
| 3300012486|Ga0157331_1003426 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012503|Ga0157313_1020986 | Not Available | 667 | Open in IMG/M |
| 3300012913|Ga0157298_10061607 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012930|Ga0137407_11703272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300012957|Ga0164303_10929134 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300014305|Ga0075349_1042163 | Not Available | 915 | Open in IMG/M |
| 3300014871|Ga0180095_1075080 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300015264|Ga0137403_10953331 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300015373|Ga0132257_103249039 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300015373|Ga0132257_103898740 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300015374|Ga0132255_101444245 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300015374|Ga0132255_104405001 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018031|Ga0184634_10495170 | Not Available | 546 | Open in IMG/M |
| 3300018052|Ga0184638_1039421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1714 | Open in IMG/M |
| 3300018074|Ga0184640_10219134 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300018078|Ga0184612_10309789 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300018081|Ga0184625_10071027 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300018082|Ga0184639_10051123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2137 | Open in IMG/M |
| 3300018481|Ga0190271_10219520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1910 | Open in IMG/M |
| 3300021082|Ga0210380_10083295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1404 | Open in IMG/M |
| 3300021332|Ga0210339_1023204 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300025160|Ga0209109_10359272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300025165|Ga0209108_10129301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1344 | Open in IMG/M |
| 3300025312|Ga0209321_10308940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300025324|Ga0209640_10910849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300025915|Ga0207693_11465726 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026051|Ga0208911_1012596 | Not Available | 788 | Open in IMG/M |
| 3300026066|Ga0208290_1005010 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300027360|Ga0209969_1035038 | Not Available | 773 | Open in IMG/M |
| 3300027471|Ga0209995_1046188 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300027527|Ga0209684_1012888 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300027577|Ga0209874_1108327 | Not Available | 656 | Open in IMG/M |
| 3300027778|Ga0209464_10303793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300027787|Ga0209074_10499435 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027815|Ga0209726_10034085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3875 | Open in IMG/M |
| 3300027831|Ga0209797_10098038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1280 | Open in IMG/M |
| 3300027907|Ga0207428_11131233 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027909|Ga0209382_10237315 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300027909|Ga0209382_10773839 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300030620|Ga0302046_10737681 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031562|Ga0310886_10112505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
| 3300031720|Ga0307469_10317211 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300031720|Ga0307469_11143903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300031820|Ga0307473_10368171 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300031824|Ga0307413_10410795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1063 | Open in IMG/M |
| 3300031854|Ga0310904_10171435 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300031854|Ga0310904_11135182 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031903|Ga0307407_11046914 | Not Available | 632 | Open in IMG/M |
| 3300031949|Ga0214473_11708248 | Not Available | 626 | Open in IMG/M |
| 3300031965|Ga0326597_11456216 | Not Available | 660 | Open in IMG/M |
| 3300032000|Ga0310903_10237201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300032180|Ga0307471_100608315 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300032205|Ga0307472_100518060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300032205|Ga0307472_101907063 | Not Available | 593 | Open in IMG/M |
| 3300032828|Ga0335080_10486979 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300033434|Ga0316613_10842252 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.33% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.83% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_03539130 | 2124908045 | Soil | MHMNEAAYRGFRQDELEYQFNPRVSVPEYPELAKVRAAQARKVRESAKS |
| SwBSRL2_0853.00007720 | 2162886013 | Switchgrass Rhizosphere | MRDLTYKSYQQDQLEFQYNPRESVPDYPELAKRRA |
| SwBSRL2_0712.00002480 | 2162886013 | Switchgrass Rhizosphere | MRDLTYKSYQQDQLEFQYNPRESVPEYPELAKRRA |
| SwBSRL2_0784.00004940 | 2162886013 | Switchgrass Rhizosphere | MRDLTYKSYQQDQLEFQYNPRESVPDYPELAKRRADASRKARSTL |
| ICCgaii200_10955712 | 2228664021 | Soil | MNETVYKGFGPDEMEFQYNPRVSVPEYPELARVRAAQ |
| INPgaii200_06724652 | 2228664022 | Soil | MNEPAYKGFRLDEMEYQYNPRVSVPEYPELAKMRAA |
| AF_2010_repII_A01DRAFT_10628002 | 3300000580 | Forest Soil | MNETIYKGFRKDELEYQYNPRESVPEYPALSKRKAEQARKVRETAK |
| AF_2010_repII_A1DRAFT_100283581 | 3300000597 | Forest Soil | MNETIYKGFRKDELEYQYNPRESVPEYPALSKRKAEQARK |
| AF_2010_repII_A1DRAFT_101293332 | 3300000597 | Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEA |
| JGI11643J11755_114696601 | 3300000787 | Soil | MTETGYRGFRLEEMEYQYNPRESVPEYPQLAKKRAEEA |
| JGI1027J11758_125437972 | 3300000789 | Soil | MTGIGYKSFRQDELEYQYNPRESVPEYPAISKRKAEQAR |
| JGI10213J12805_103922383 | 3300000858 | Soil | MIDTGYRGFRLEEMEYQYNPRESVPEYPQLAQKRAEE |
| JGI10216J12902_1001012611 | 3300000956 | Soil | MSDQLYRGFRPDEMEYQYNPRESVPEYPELAKERAAQAKKVRDS |
| C687J29651_102020161 | 3300002407 | Soil | MNEVGYKGFRADELEYQFNPRVSVPEFPELSKVRAALSRKVRESAKSW |
| Ga0062593_1014130781 | 3300004114 | Soil | MNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVR |
| Ga0062381_102411281 | 3300004808 | Wetland Sediment | MSELYKGFRPDEMEYQYQPRESVPEFPELSKIRAAQAKKVRETAKSWLNIAYGSSGRESLDIYAADKPGG |
| Ga0062594_1020108281 | 3300005093 | Soil | MNEAVYRGFRQDQLEYQYNPRSSVPEYPELAKIRATQARKVRESAKSWLNIAYGA |
| Ga0066672_102000632 | 3300005167 | Soil | MSDLGYKNFHRDEIEYQYNPRVSVPEFPQLAKKRSEESRK |
| Ga0068993_100862852 | 3300005183 | Natural And Restored Wetlands | LSDISYKGFRADEMEFQYNPRESVPEYPELAKIRAAQARKVRETAQSWLNV |
| Ga0065705_103827372 | 3300005294 | Switchgrass Rhizosphere | MRDLTYKSYQQDQLEFQYNPRESVPEYPELAKRRAEASRKARSTLKSW |
| Ga0065705_107711831 | 3300005294 | Switchgrass Rhizosphere | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYG |
| Ga0066388_1051999032 | 3300005332 | Tropical Forest Soil | MNEIIYKGFRKDELEYQYNPRESVPEYLQLSKRKAEQARARDG* |
| Ga0070689_1008400423 | 3300005340 | Switchgrass Rhizosphere | MNEAVYRGFRQDQLEYQYNPRISVPEYPELAKIRATQARKVRESAKSWLNIAYGASPRERLD |
| Ga0070705_1007347602 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASPRER |
| Ga0066682_105079861 | 3300005450 | Soil | MHEKAYKEFRQDEMEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLDI |
| Ga0066905_1004444682 | 3300005713 | Tropical Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAE |
| Ga0066903_1078754352 | 3300005764 | Tropical Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLK |
| Ga0068858_1025656232 | 3300005842 | Switchgrass Rhizosphere | MEAIAYKGFRHDEMEYQYNPRESVPEYPELAKKRAAESKKVRETAK |
| Ga0068862_1022019762 | 3300005844 | Switchgrass Rhizosphere | MNETEYKGFRPDEMEYQYNPRVSVPEYPELAKVRAAQA |
| Ga0075428_1009281461 | 3300006844 | Populus Rhizosphere | MPEIVYKGFRSDELEYQYNPRESVPEYPELAKLRAEASRK |
| Ga0075428_1012621771 | 3300006844 | Populus Rhizosphere | MNEPAYKGFRQVEMEYQYNPRVSVPEYPELAKMRAAQARKVRDSAKSWLN |
| Ga0075431_1007486863 | 3300006847 | Populus Rhizosphere | MNEPAYKGFGQDEMEYQYNPRVSVPEYPELAKMRAAQARK |
| Ga0075420_1010059531 | 3300006853 | Populus Rhizosphere | MSDQLYKGFRPDELEYQYNPRESVPEYPELAKVRAA |
| Ga0075434_1003895361 | 3300006871 | Populus Rhizosphere | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASPRERLD |
| Ga0079217_100051125 | 3300006876 | Agricultural Soil | MIETYKRFRPDEMEYQYNPRVSAPEYPELAKVRAA |
| Ga0079216_100450451 | 3300006918 | Agricultural Soil | MSVIPYKGFRPDEMEYQYNPRVSVPEYPELAKVRAAQAKKVRESAK |
| Ga0075419_110250152 | 3300006969 | Populus Rhizosphere | MSDQLYKGFRPDELEYQYNPRESVPEYPELAKVRAAQAKKVRD |
| Ga0066709_1026818721 | 3300009137 | Grasslands Soil | MNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSW |
| Ga0114129_102135394 | 3300009147 | Populus Rhizosphere | MKGERILIMSEPAYKGFRQDEMEFQYNPRVSVPEFPELAKVRSA |
| Ga0114129_123039042 | 3300009147 | Populus Rhizosphere | MSDSGYKGFRPEEMEYQYNPRESVPEYPQLAKRRAEQARRVRESA |
| Ga0105347_13566141 | 3300009609 | Soil | MSDRAYKSFQQDELEYQYNPRVSVPEFPELAKVRSARSRRVRESAKSWLDIAYGASPRET |
| Ga0126374_106608781 | 3300009792 | Tropical Forest Soil | MTEITYKGFRQDELEYQYNPRESVPEFPEISKRKAEQARK |
| Ga0126304_111683122 | 3300010037 | Serpentine Soil | MSDLYKGFRPDEMEYQYNPRESVPEYPELAKVRAA |
| Ga0126384_108349041 | 3300010046 | Tropical Forest Soil | MNEIGYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSN |
| Ga0126382_115658882 | 3300010047 | Tropical Forest Soil | MSEIVYKGFRKDELEYQYNPRESVAEYPQLSKRKADQ |
| Ga0126382_117016332 | 3300010047 | Tropical Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRK |
| Ga0126370_125170831 | 3300010358 | Tropical Forest Soil | MDEIIYKGFRQDELEYQYNPRESVVEYPQLSKRKAEQARKVRETAKSWLN |
| Ga0126376_111698162 | 3300010359 | Tropical Forest Soil | MAMNDVVYKCFRKNELEYQYNPRESVPEYPQLSKRKAEQARARDG* |
| Ga0126378_103592443 | 3300010361 | Tropical Forest Soil | MNDAAYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRERAKSWLNIAYGASPRE |
| Ga0126377_109687091 | 3300010362 | Tropical Forest Soil | MSEVTYKNYRADELEYQYNPRKSVPEYPQLSKRKAEQARARDG* |
| Ga0126379_122940541 | 3300010366 | Tropical Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLKS |
| Ga0134125_101992081 | 3300010371 | Terrestrial Soil | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAK |
| Ga0126381_1007853621 | 3300010376 | Tropical Forest Soil | MTEITYKGFRQDELEYQYNPRESVPEFPEISKRKAEQARKVRETVK |
| Ga0134124_116387812 | 3300010397 | Terrestrial Soil | MNEAVYRGFRQDQLEYQYNPRSSVPEYPELAKIRATQARKVRESAKSWLNI |
| Ga0126383_110020551 | 3300010398 | Tropical Forest Soil | MNEIVYEGFSKHELEYQYNPRESVPEYPELAKKRAEASRKARSNLKSW |
| Ga0126383_111663271 | 3300010398 | Tropical Forest Soil | MNEAAYKDFRQDELEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSWLNIAYGASPRER |
| Ga0134121_109817962 | 3300010401 | Terrestrial Soil | MEAIAYKGFRHDEMKYQYNPRESVPEYPELAKKRAAESKKVRETA |
| Ga0137457_12799011 | 3300011443 | Soil | MSELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQAKKVRETAKFWLTISYGSSPREMLDI |
| Ga0137382_100554363 | 3300012200 | Vadose Zone Soil | MNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRSAQARKVRESAKSWLN |
| Ga0137374_101166221 | 3300012204 | Vadose Zone Soil | MSEPAYRGFRQDEMEFQYNPRVSVPEFPELARIRSAQARKV |
| Ga0137381_118042321 | 3300012207 | Vadose Zone Soil | MNETAYKGFRQDEMEYQYNPRVSVPEYPELAKVRS |
| Ga0137387_104013301 | 3300012349 | Vadose Zone Soil | MSELAYKNFRGDELEYQYNPRKSVREYPGLAKKRAE |
| Ga0137367_106002472 | 3300012353 | Vadose Zone Soil | MNEPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSA |
| Ga0137366_109396911 | 3300012354 | Vadose Zone Soil | MSGTKYKGFSKDELEYQYNPRESVPEYPELAKRRAEQSRKARSTL |
| Ga0157331_10034263 | 3300012486 | Soil | MNEAVYRGFRQDELECQYNPRISVPEYPELAKVRAAQARKVR |
| Ga0157313_10209861 | 3300012503 | Arabidopsis Rhizosphere | MNEAVYRGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRESAKSWLNIA |
| Ga0157298_100616071 | 3300012913 | Soil | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNI |
| Ga0137407_117032721 | 3300012930 | Vadose Zone Soil | MSEPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSAQARKVRDSA |
| Ga0164303_109291341 | 3300012957 | Soil | MNETAYKGFRLGEMEYQYNPRVSVPEYPELAKMRAAQARKVRASAKS |
| Ga0075349_10421632 | 3300014305 | Natural And Restored Wetlands | MSELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQANRRSPG* |
| Ga0180095_10750802 | 3300014871 | Soil | MSESAYRNLRPDELEFQYNPRVSVPEFPELAEVRSAKSRKVRDSAKSWLNIA* |
| Ga0137403_109533313 | 3300015264 | Vadose Zone Soil | MNETAYKGFRLDEMEYQYNPRVSVPEYPELAKMRA |
| Ga0132257_1032490392 | 3300015373 | Arabidopsis Rhizosphere | MNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSWLNIAY |
| Ga0132257_1038987402 | 3300015373 | Arabidopsis Rhizosphere | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRA |
| Ga0132255_1014442451 | 3300015374 | Arabidopsis Rhizosphere | MNETAYKGFREDEMEYQYNPRVSVPEYPELAKVRAAQARK |
| Ga0132255_1044050012 | 3300015374 | Arabidopsis Rhizosphere | MNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSWLNIAYGASP |
| Ga0184634_104951701 | 3300018031 | Groundwater Sediment | MSEIAYKGFSKGEMEYQYNPRESVPEYPELAKLRA |
| Ga0184638_10394211 | 3300018052 | Groundwater Sediment | MSELSYKAYPQDELEFQYNPRVSVPEYPQLAEVRSAKSRRVRDSAKSWLNI |
| Ga0184640_102191341 | 3300018074 | Groundwater Sediment | MSDNLYKGFRQDEMEYQYNPRVSVPEFPELAKVRSAQARKVRESAKSW |
| Ga0184612_103097892 | 3300018078 | Groundwater Sediment | MSDNLYKGFRQDQMEYQYNPRVSVPEFPELAKIRSAQARK |
| Ga0184625_100710271 | 3300018081 | Groundwater Sediment | MNEIRPNGFPKDELEYQYNPRESVPEYPELAKRRAE |
| Ga0184639_100511231 | 3300018082 | Groundwater Sediment | MSDQLYKGFRPDEMEFQYNPRVSVPEFPELAKVRAAQARKV |
| Ga0190271_102195201 | 3300018481 | Soil | MSDQLYKGFRPDEMEYQYNPRESVPEYSELAKVRAAQANKVRETAKSWLNISYGSSP |
| Ga0210380_100832952 | 3300021082 | Groundwater Sediment | MSDQLYKGFRPHEMEYQYNPRESVPEYPELAKVRAAQAKKVRD |
| Ga0210339_10232041 | 3300021332 | Estuarine | MSDQLYKGFRQDEMEYQYNPRESVPEFPELAKIRAAQAKKVRETAKS |
| Ga0209109_103592722 | 3300025160 | Soil | MNDLGYKGFHQDELEYQYNPRVSVPEFPELSKLRSAQSRKVRESAKSW |
| Ga0209108_101293012 | 3300025165 | Soil | MSEVVYKGFHQDELEYQFNPRVSVPEFPELSKVRA |
| Ga0209321_103089401 | 3300025312 | Soil | MSDVGYKGFRQDELEYQYNPRVSVPEFPELAKVRAALS |
| Ga0209640_109108491 | 3300025324 | Soil | MSEIGYRGFRQDELEYQFNPRVSVPEFPELSKVRAA |
| Ga0207693_114657262 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRGEASRKVRSTL |
| Ga0208911_10125961 | 3300026051 | Natural And Restored Wetlands | MSEFAYRNFRQDELEFQYNPRVSVPEFPELAKARSAQARKVRES |
| Ga0208290_10050101 | 3300026066 | Natural And Restored Wetlands | MNENGYKGFRQDELEYQYNPRVSVPDYPELAKVRAAQSRKVR |
| Ga0209969_10350383 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MNENAYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQSRKVRERAK |
| Ga0209995_10461883 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MNESGYKGFRQDELEYQYNPRVSVPEYPELAKVRAAQSRKVRESARS |
| Ga0209684_10128881 | 3300027527 | Tropical Forest Soil | MNEIIYKGFRKDELEYQYNPRESVPEYLQLSKRKAEQARARDG |
| Ga0209874_11083271 | 3300027577 | Groundwater Sand | MSGTAYKGFSKDELEYQYNPRVSVPEYPELAKRRAEASRKAR |
| Ga0209464_103037931 | 3300027778 | Wetland Sediment | MSELYKGFRPDEMEYQYQPRESVPEFPELSKIRAAQAKKVRETAKSWLN |
| Ga0209074_104994351 | 3300027787 | Agricultural Soil | MNEAIHRGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKSWLNIAYGASP |
| Ga0209726_100340851 | 3300027815 | Groundwater | MSDQLYKGFRPDEMEYQYNPRESVPEFPELAKVRSAQAKK |
| Ga0209797_100980381 | 3300027831 | Wetland Sediment | MSDQLYKGFRPDEMEYQFNPRASVPEFPELAKIRAAQAKKVRETA |
| Ga0207428_111312332 | 3300027907 | Populus Rhizosphere | MNEAIHSGFHQDELEYQYNPRVSVPEYPELAKIRAAQARKVRESAKS |
| Ga0209382_102373153 | 3300027909 | Populus Rhizosphere | MNEIRPNGFPKDELEYQYNPRESVPEYPELAERRAEESRKAR |
| Ga0209382_107738393 | 3300027909 | Populus Rhizosphere | MNEAAYRGFRQDELEYQYNPRVSVPEYPELAKVRAAQARKVRESAKSWLNI |
| Ga0302046_107376812 | 3300030620 | Soil | MNESAYEGFRQDDLEYQYNPRVSVPEYPELAKLRAAQARKVRQ |
| Ga0310886_101125053 | 3300031562 | Soil | MTQLYKGFRPDEMEYQYNPRESVPEYPELAKVRAA |
| Ga0307469_103172112 | 3300031720 | Hardwood Forest Soil | MTEISYKDFRKDELEYQYNPRESVPEYPELAKKRAEPAGRR |
| Ga0307469_111439031 | 3300031720 | Hardwood Forest Soil | MSKPAYKGFRQDEMEFQYNPRVSVPEFPELARIRSAQARK |
| Ga0307473_103681711 | 3300031820 | Hardwood Forest Soil | MSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRAEASRK |
| Ga0307413_104107951 | 3300031824 | Rhizosphere | MIDAGYRGFRQDELEYQYNPRESVPEYPQLAKKRAEQARRVRRSAKSWLGVPYGSSPREKLD |
| Ga0310904_101714353 | 3300031854 | Soil | MNETAYKGFRLDEMEYQYNPRVSVPEYPELAKMRAAQARKVR |
| Ga0310904_111351821 | 3300031854 | Soil | MNEAVYRRFRQDELEYQYNPRISVPEYPELAKVRAAQARKVRESAKSW |
| Ga0307407_110469141 | 3300031903 | Rhizosphere | MIDAGYRGFRQDELEYQYNPRESVPEYPQLAKKRAEQARR |
| Ga0214473_117082481 | 3300031949 | Soil | MSESAYRNFRQDELEFQYNPRVSVPEYPQLAEVRSAKSRTVRDSAKSWLNIAYGTSAREA |
| Ga0326597_114562161 | 3300031965 | Soil | MSDQLHKGFRPDEMEYQYNPRESAPEYPELAKVRAAQAKKVRDSARSWLNVA |
| Ga0310903_102372011 | 3300032000 | Soil | MNEPAYKGFGQDEMEYQYNPRVSVPEYPELAKMRAAQARKVRDSAKS |
| Ga0307471_1006083151 | 3300032180 | Hardwood Forest Soil | MNEMIYKGFRQDELEYQYNPRESVPEYPELAKKRG |
| Ga0307472_1005180602 | 3300032205 | Hardwood Forest Soil | MSEIIYKGFRQDELEYQYNPRESVPEYPALAKKRGEASRKVR |
| Ga0307472_1019070632 | 3300032205 | Hardwood Forest Soil | MNEMIYKGFRQDELEYQYNPRESVPEYPELAKKRAEPAGRR |
| Ga0335080_104869792 | 3300032828 | Soil | MNEKIYKTFRQDELEYQYNPRASVADYPQLSKRKAEQARKVRE |
| Ga0316613_108422522 | 3300033434 | Soil | MTELYKGFRPDEMEYQYNPRESVPEYPELAKVRAAQAKKVR |
| ⦗Top⦘ |