


| Basic Information | |
|---|---|
| Family ID | F073218 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.33 % |
| % of genes near scaffold ends (potentially truncated) | 31.67 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (31.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02909 | TetR_C_1 | 14.17 |
| PF00440 | TetR_N | 10.83 |
| PF01145 | Band_7 | 10.00 |
| PF00487 | FA_desaturase | 8.33 |
| PF13453 | zf-TFIIB | 4.17 |
| PF00011 | HSP20 | 2.50 |
| PF01569 | PAP2 | 1.67 |
| PF06305 | LapA_dom | 0.83 |
| PF01155 | HypA | 0.83 |
| PF03861 | ANTAR | 0.83 |
| PF00270 | DEAD | 0.83 |
| PF03006 | HlyIII | 0.83 |
| PF01613 | Flavin_Reduct | 0.83 |
| PF01872 | RibD_C | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 14.17 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 8.33 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 8.33 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 2.50 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.83 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0375 | Hydrogenase maturation factor HypA/HybF, metallochaperone involved in Ni insertion | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.83 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.67 % |
| Unclassified | root | N/A | 28.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10355389 | Not Available | 724 | Open in IMG/M |
| 3300000858|JGI10213J12805_10268131 | Not Available | 1251 | Open in IMG/M |
| 3300000956|JGI10216J12902_122071944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300005562|Ga0058697_10011504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2938 | Open in IMG/M |
| 3300005562|Ga0058697_10299420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486 | 766 | Open in IMG/M |
| 3300005719|Ga0068861_100050168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3163 | Open in IMG/M |
| 3300006049|Ga0075417_10096045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
| 3300006049|Ga0075417_10252527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 846 | Open in IMG/M |
| 3300006049|Ga0075417_10302036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300006058|Ga0075432_10011226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3045 | Open in IMG/M |
| 3300006844|Ga0075428_101003662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
| 3300006844|Ga0075428_101989174 | Not Available | 602 | Open in IMG/M |
| 3300006845|Ga0075421_101364654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300006845|Ga0075421_101879635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300006847|Ga0075431_100501829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1204 | Open in IMG/M |
| 3300006852|Ga0075433_10007926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8452 | Open in IMG/M |
| 3300006871|Ga0075434_100149170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2358 | Open in IMG/M |
| 3300007790|Ga0105679_10397363 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300009147|Ga0114129_12065795 | Not Available | 688 | Open in IMG/M |
| 3300009789|Ga0126307_10004035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10128 | Open in IMG/M |
| 3300009789|Ga0126307_10012657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6189 | Open in IMG/M |
| 3300009789|Ga0126307_10236575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1468 | Open in IMG/M |
| 3300009789|Ga0126307_10246384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
| 3300009789|Ga0126307_10248421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1430 | Open in IMG/M |
| 3300009789|Ga0126307_10313999 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300009840|Ga0126313_10069449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2529 | Open in IMG/M |
| 3300009840|Ga0126313_10190250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300009840|Ga0126313_10560602 | Not Available | 918 | Open in IMG/M |
| 3300009840|Ga0126313_10888040 | Not Available | 727 | Open in IMG/M |
| 3300009840|Ga0126313_11213861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300010037|Ga0126304_11205099 | Not Available | 519 | Open in IMG/M |
| 3300010038|Ga0126315_10898609 | Not Available | 588 | Open in IMG/M |
| 3300010038|Ga0126315_11203782 | Not Available | 515 | Open in IMG/M |
| 3300010039|Ga0126309_10044612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2091 | Open in IMG/M |
| 3300010041|Ga0126312_10152006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1607 | Open in IMG/M |
| 3300010041|Ga0126312_10286331 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300010041|Ga0126312_10307477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300010042|Ga0126314_10102541 | Not Available | 1945 | Open in IMG/M |
| 3300010044|Ga0126310_10016450 | All Organisms → cellular organisms → Bacteria | 3598 | Open in IMG/M |
| 3300010044|Ga0126310_10160371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium | 1442 | Open in IMG/M |
| 3300010085|Ga0127445_1040017 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010166|Ga0126306_10163155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1663 | Open in IMG/M |
| 3300010167|Ga0123353_11676466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 798 | Open in IMG/M |
| 3300011003|Ga0138514_100069596 | Not Available | 735 | Open in IMG/M |
| 3300012021|Ga0120192_10009211 | Not Available | 1423 | Open in IMG/M |
| 3300012356|Ga0137371_10298370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1255 | Open in IMG/M |
| 3300012373|Ga0134042_1209838 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012380|Ga0134047_1212643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1515 | Open in IMG/M |
| 3300012501|Ga0157351_1061470 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012515|Ga0157338_1074581 | Not Available | 537 | Open in IMG/M |
| 3300012937|Ga0162653_100039728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 705 | Open in IMG/M |
| 3300012938|Ga0162651_100066453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300014487|Ga0182000_10000669 | All Organisms → cellular organisms → Bacteria | 6042 | Open in IMG/M |
| 3300014487|Ga0182000_10031063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300014487|Ga0182000_10104948 | Not Available | 955 | Open in IMG/M |
| 3300014488|Ga0182001_10044880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1166 | Open in IMG/M |
| 3300014497|Ga0182008_10536433 | Not Available | 648 | Open in IMG/M |
| 3300014497|Ga0182008_10908101 | Not Available | 519 | Open in IMG/M |
| 3300018073|Ga0184624_10163520 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300018429|Ga0190272_12071681 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018432|Ga0190275_11692646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 711 | Open in IMG/M |
| 3300018465|Ga0190269_11195822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gardneri | 597 | Open in IMG/M |
| 3300018476|Ga0190274_10075494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2567 | Open in IMG/M |
| 3300018476|Ga0190274_11282308 | Not Available | 819 | Open in IMG/M |
| 3300019254|Ga0184641_1066194 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300019254|Ga0184641_1184902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300019254|Ga0184641_1222169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 694 | Open in IMG/M |
| 3300019269|Ga0184644_1150224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 708 | Open in IMG/M |
| 3300021951|Ga0222624_1175461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300022534|Ga0224452_1164058 | Not Available | 684 | Open in IMG/M |
| 3300025972|Ga0207668_12086451 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027809|Ga0209574_10132301 | Not Available | 744 | Open in IMG/M |
| 3300027907|Ga0207428_10108322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2140 | Open in IMG/M |
| 3300027909|Ga0209382_11473269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300028587|Ga0247828_10603170 | Not Available | 670 | Open in IMG/M |
| 3300028608|Ga0247819_10615265 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300028708|Ga0307295_10018829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1679 | Open in IMG/M |
| 3300028719|Ga0307301_10154380 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300028744|Ga0307318_10065133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300028744|Ga0307318_10068278 | Not Available | 1186 | Open in IMG/M |
| 3300028771|Ga0307320_10217806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
| 3300028787|Ga0307323_10256365 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300028814|Ga0307302_10400895 | Not Available | 678 | Open in IMG/M |
| 3300030510|Ga0268243_1000458 | All Organisms → cellular organisms → Bacteria | 6280 | Open in IMG/M |
| 3300030571|Ga0247652_1046783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 752 | Open in IMG/M |
| 3300030592|Ga0247612_1150444 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300030592|Ga0247612_1180644 | Not Available | 536 | Open in IMG/M |
| 3300030634|Ga0247636_10123579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 749 | Open in IMG/M |
| 3300030634|Ga0247636_10250245 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300030831|Ga0308152_101997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300030831|Ga0308152_104700 | Not Available | 738 | Open in IMG/M |
| 3300030831|Ga0308152_113706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300030902|Ga0308202_1029682 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300030903|Ga0308206_1096094 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300030987|Ga0308155_1003510 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300031092|Ga0308204_10249243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300031095|Ga0308184_1010530 | Not Available | 871 | Open in IMG/M |
| 3300031099|Ga0308181_1095491 | Not Available | 635 | Open in IMG/M |
| 3300031114|Ga0308187_10124245 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031124|Ga0308151_1011762 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031421|Ga0308194_10055025 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031421|Ga0308194_10354038 | Not Available | 523 | Open in IMG/M |
| 3300031424|Ga0308179_1006516 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031424|Ga0308179_1039539 | Not Available | 584 | Open in IMG/M |
| 3300031505|Ga0308150_1040446 | Not Available | 546 | Open in IMG/M |
| 3300031548|Ga0307408_101827542 | Not Available | 581 | Open in IMG/M |
| 3300031731|Ga0307405_10383219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| 3300031824|Ga0307413_10986151 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031852|Ga0307410_10122109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1901 | Open in IMG/M |
| 3300031852|Ga0307410_10382782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300031852|Ga0307410_10844842 | Not Available | 781 | Open in IMG/M |
| 3300031901|Ga0307406_11101087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300031911|Ga0307412_10462661 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300031995|Ga0307409_100121870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2210 | Open in IMG/M |
| 3300031995|Ga0307409_101960476 | Not Available | 615 | Open in IMG/M |
| 3300032002|Ga0307416_100042030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3565 | Open in IMG/M |
| 3300032126|Ga0307415_101570045 | Not Available | 631 | Open in IMG/M |
| 3300034448|Ga0370540_00428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
| 3300034448|Ga0370540_09778 | Not Available | 599 | Open in IMG/M |
| 3300034680|Ga0370541_004913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1195 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 18.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 10.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 2.50% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.83% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031124 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_103553892 | 3300000443 | Soil | MKILLLVAAAVGLGAIMAGNVVLDISRYVRIRRM* |
| JGI10213J12805_102681312 | 3300000858 | Soil | MTRSLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| JGI10216J12902_1220719442 | 3300000956 | Soil | MKIVLLLAAAVGFGAIVAGSVMPDVARYLRIRRM* |
| Ga0058697_100115043 | 3300005562 | Agave | MKILLLAAAVVGLGAILAGNVLLDVTRYLRMRRM* |
| Ga0058697_102994202 | 3300005562 | Agave | MTRLLLLVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0068861_1000501682 | 3300005719 | Switchgrass Rhizosphere | MKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM* |
| Ga0075417_100960453 | 3300006049 | Populus Rhizosphere | MKILLLAAAAVGLGGILAGNLLPDVTRYLRIRRM* |
| Ga0075417_102525271 | 3300006049 | Populus Rhizosphere | MKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM* |
| Ga0075417_103020361 | 3300006049 | Populus Rhizosphere | MKILLLVAAAVGLGAIVAGKVVPDVTQYLRIRRM* |
| Ga0075432_100112263 | 3300006058 | Populus Rhizosphere | MKILLLAAAAVGLGDILAGKLLPDVTRYLRIRRM* |
| Ga0075428_1010036621 | 3300006844 | Populus Rhizosphere | MTRLVFVVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0075428_1019891742 | 3300006844 | Populus Rhizosphere | MARLVFVVAAAVGLGALLARSVVPDVTRYLRIRRM* |
| Ga0075421_1013646542 | 3300006845 | Populus Rhizosphere | MKILLLVAAAVGLGAIMAANVVPDVTRYLRIRRM* |
| Ga0075421_1018796352 | 3300006845 | Populus Rhizosphere | MKILLLVAAAVGLGAIMAGNVLPDVTRYLRIRRM* |
| Ga0075431_1005018293 | 3300006847 | Populus Rhizosphere | MKILLLAAAAVGLGAILAGNLLPDVTRYLRIRRM* |
| Ga0075433_100079269 | 3300006852 | Populus Rhizosphere | MKILLLAAAAVGLGAIVAGKVVPDVTRYLRIRRM* |
| Ga0075434_1001491702 | 3300006871 | Populus Rhizosphere | MKILLLAAAAVGLGGILAGKLLPDVTRYLRIRRM* |
| Ga0105679_103973635 | 3300007790 | Soil | MTRSLLVLAAAVGLGAVLARGVGPDGTRYLRIRRM* |
| Ga0114129_120657951 | 3300009147 | Populus Rhizosphere | MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0126307_100040356 | 3300009789 | Serpentine Soil | MKILLLVAAAVGLGAILAGNVMPDIARYMRIRRM* |
| Ga0126307_100126572 | 3300009789 | Serpentine Soil | MKILLLAAAAVGLGAIMAGNVVPDVTRYLRIRRM* |
| Ga0126307_102365751 | 3300009789 | Serpentine Soil | MKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM* |
| Ga0126307_102463842 | 3300009789 | Serpentine Soil | MKILLLVAAAVGLGAVFAGNVLPDVTRYLRIRRM* |
| Ga0126307_102484213 | 3300009789 | Serpentine Soil | MGQEETCQMKILLLVAAAVGLGALLAGGVLPDVTRYLRIRRM* |
| Ga0126307_103139993 | 3300009789 | Serpentine Soil | MKILLLLAAAVGLGAIMAGRVVPDVTRYLRIRRM* |
| Ga0126313_100694491 | 3300009840 | Serpentine Soil | MGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYL |
| Ga0126313_101902501 | 3300009840 | Serpentine Soil | MKIGVLVAAVVGLGAILAGNVLPDVIRYLRIRRM* |
| Ga0126313_105606021 | 3300009840 | Serpentine Soil | MKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM* |
| Ga0126313_108880402 | 3300009840 | Serpentine Soil | MARLLIVVAAAVGLGALARSVVPDVTRYLRIRRM* |
| Ga0126313_112138612 | 3300009840 | Serpentine Soil | MKFLLLAAAIVGLGAIVAGNVLPDITRYLRIRRM* |
| Ga0126304_112050992 | 3300010037 | Serpentine Soil | MKILLLLAAAVGLGAIMAGRRVVPDVTRYLRIRRM* |
| Ga0126315_108986091 | 3300010038 | Serpentine Soil | MTRLLVVVAAAVGLGVVLARSVVPDVTRYLRIRRM* |
| Ga0126315_112037821 | 3300010038 | Serpentine Soil | MKILLLLAGVVGLGAIMASKVVPDVTRYLRIRRM* |
| Ga0126309_100446124 | 3300010039 | Serpentine Soil | MTRLLIVVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0126312_101520063 | 3300010041 | Serpentine Soil | MKILLLAAAAVGLGAILAGNVMPDVARYMRIRRM* |
| Ga0126312_102863311 | 3300010041 | Serpentine Soil | VMGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM* |
| Ga0126312_103074772 | 3300010041 | Serpentine Soil | MKILLLVAAAVGLGAIVAGNVMPDVTRYLRIRRM* |
| Ga0126314_101025414 | 3300010042 | Serpentine Soil | MKISLLVAAAVGLGAILAGNVMPDVARYLRIRRM* |
| Ga0126310_100164507 | 3300010044 | Serpentine Soil | MKLLLLVAAAVGLGAILAGNVMPDVARYMRIRRM* |
| Ga0126310_101603711 | 3300010044 | Serpentine Soil | RGQMKILLLVAAAVGLGAILAGNVMPDVARYMRIRRM* |
| Ga0127445_10400172 | 3300010085 | Grasslands Soil | MKIVLLVAAAVGLGAIMAGKVVPDVTRYLRIRRM* |
| Ga0126306_101631551 | 3300010166 | Serpentine Soil | MTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM* |
| Ga0123353_116764662 | 3300010167 | Termite Gut | MRKTVVVGLVAAALAALVAQVLPDIMRYLRIRRM* |
| Ga0138514_1000695962 | 3300011003 | Soil | MKFLLLVGAAVGLGAILVGNVLPDVTRYLRIRRM* |
| Ga0120192_100092112 | 3300012021 | Terrestrial | MKILLLVAAAVGLGAIMAGNVILDVARYMRIRRM* |
| Ga0137371_102983702 | 3300012356 | Vadose Zone Soil | MARTVSLLLLAVAVGLGALDVFAAGQVLPDVARHLRIRRM* |
| Ga0134042_12098382 | 3300012373 | Grasslands Soil | MKIVLLVAAAVGLGAIMAGNVVPDITRYLRIRRM* |
| Ga0134047_12126433 | 3300012380 | Grasslands Soil | ETWQMKILLLVAAAVGLGAIMAGNLVPDITRYLRIRRM* |
| Ga0157351_10614701 | 3300012501 | Unplanted Soil | MKILLLVAAALGLGAVLAGKVLPDVTRYLRIRRM* |
| Ga0157338_10745812 | 3300012515 | Arabidopsis Rhizosphere | MKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM* |
| Ga0162653_1000397282 | 3300012937 | Soil | VMGQEETWQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM* |
| Ga0162651_1000664532 | 3300012938 | Soil | MKILLLVAAAVGLGAVLAGNVLPDVTRYMRMRRM* |
| Ga0182000_100006695 | 3300014487 | Soil | MTRSLFVVAAVVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0182000_100310633 | 3300014487 | Soil | MKILLLAAAVVGLGAILAGNVLPDVTRYLRIRRM* |
| Ga0182000_101049481 | 3300014487 | Soil | LKILLLAAAVVGLGAILAGNVLLDVTRYLRMRRM* |
| Ga0182001_100448801 | 3300014488 | Soil | MKILLLVGAAVGLGAVLAGNVLPDVTRYLRIRRM* |
| Ga0182008_105364332 | 3300014497 | Rhizosphere | MKILLLVAAAVGLGAIMAGKVVPDVTRYLRIRRM* |
| Ga0182008_109081011 | 3300014497 | Rhizosphere | MTRLLFVVAAAVGLGAVLARSVVPDVTRYLRIRRM* |
| Ga0184624_101635201 | 3300018073 | Groundwater Sediment | GDKRETWQMKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM |
| Ga0190272_120716812 | 3300018429 | Soil | QEETCQMKILLLVAAAVGLGALLAGGVVPDVTRYLRIRRM |
| Ga0190275_116926461 | 3300018432 | Soil | EDGAGGADMTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM |
| Ga0190269_111958222 | 3300018465 | Soil | MTRLLFVVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0190274_100754942 | 3300018476 | Soil | MTRLLLAVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0190274_112823082 | 3300018476 | Soil | MTRLVLVVAAVIGLGVVLARSVVPDVTRYLRIRRM |
| Ga0184641_10661941 | 3300019254 | Groundwater Sediment | ETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM |
| Ga0184641_11849022 | 3300019254 | Groundwater Sediment | CQMKILLLVAAAVGLGAVLAGNVLPDVTRYMRMRRM |
| Ga0184641_12221692 | 3300019254 | Groundwater Sediment | MGQEETWQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM |
| Ga0184644_11502242 | 3300019269 | Groundwater Sediment | ETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM |
| Ga0222624_11754611 | 3300021951 | Groundwater Sediment | CQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM |
| Ga0224452_11640582 | 3300022534 | Groundwater Sediment | MTRLLFVGAAAVGLAAVLARSVVPDVTRYLRIRRM |
| Ga0207668_120864512 | 3300025972 | Switchgrass Rhizosphere | ETCQMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0209574_101323012 | 3300027809 | Agave | MTRLLLVAAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0207428_101083223 | 3300027907 | Populus Rhizosphere | MARLVFVVAAAVGLGALLARSVVPDVTRYLRIRRM |
| Ga0209382_114732692 | 3300027909 | Populus Rhizosphere | MTRLVFVVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0247828_106031702 | 3300028587 | Soil | MARSVLLLLLAVAVGLGALGVLAAGNVLPDVARYLRIRRM |
| Ga0247819_106152652 | 3300028608 | Soil | EEETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM |
| Ga0307295_100188293 | 3300028708 | Soil | ETWQMKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM |
| Ga0307301_101543802 | 3300028719 | Soil | MGLEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0307318_100651332 | 3300028744 | Soil | MARLLVMVAVAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0307318_100682782 | 3300028744 | Soil | TCQMKIVLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0307320_102178061 | 3300028771 | Soil | MGQEETWQMKLLLLVAAAVGLGALLAGSVLPDVTRYLRIRRM |
| Ga0307323_102563651 | 3300028787 | Soil | DKRESWQMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0307302_104008952 | 3300028814 | Soil | ESWHMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0268243_10004588 | 3300030510 | Soil | MTRSLFVVAAVVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0247652_10467831 | 3300030571 | Soil | GQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM |
| Ga0247612_11504441 | 3300030592 | Soil | QMKILLLVAAAVGLGALLAGNVLPDVTRYLRIRRM |
| Ga0247612_11806441 | 3300030592 | Soil | PVMGQEETCQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM |
| Ga0247636_101235791 | 3300030634 | Soil | GETCQMKILLLVAAAVGLGALLAGSVLPDVTRYLRIRRM |
| Ga0247636_102502452 | 3300030634 | Soil | QMKILLLVAAAVGLGAIMAGNVVPDVTRYLRIRRM |
| Ga0308152_1019972 | 3300030831 | Soil | MTRLMLLAAAVVGLGALAVAGNVLPDVARYMRIRRM |
| Ga0308152_1047003 | 3300030831 | Soil | MTRLLLVVATVVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0308152_1137061 | 3300030831 | Soil | HRSLTAREKEELEMKILVLVAATVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0308202_10296822 | 3300030902 | Soil | EETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM |
| Ga0308206_10960943 | 3300030903 | Soil | WGQRETWQMKILLLAAAAVGLGAILAGNVLPDVTRYLRIRRM |
| Ga0308155_10035101 | 3300030987 | Soil | RGQEELEMKILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0308204_102492431 | 3300031092 | Soil | QMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM |
| Ga0308184_10105301 | 3300031095 | Soil | SLTAREKEELEMKILVLVAATVGLGAVLASNVLPDVTRYLRMRRM |
| Ga0308181_10954912 | 3300031099 | Soil | DGYKRETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRMRRM |
| Ga0308187_101242452 | 3300031114 | Soil | DGGEEETCQMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0308151_10117621 | 3300031124 | Soil | QMKILLLVAAALGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0308194_100550251 | 3300031421 | Soil | SWQMRILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRT |
| Ga0308194_103540381 | 3300031421 | Soil | MGRSVLLLLLAVAVGLGALGAVAAGNVLPDVARHLRIRRM |
| Ga0308179_10065161 | 3300031424 | Soil | GGEEETCQMKILLLVAAALGLGALLAGNVLPDVTRYLRIRRM |
| Ga0308179_10395392 | 3300031424 | Soil | MARSVLLLLVVAVGLGTLGAVAAGNVLPDVAPRIRRM |
| Ga0308150_10404461 | 3300031505 | Soil | PRLMLLVAAVVGLGALAVRGGVLPDMARYLRIRRM |
| Ga0307408_1018275422 | 3300031548 | Rhizosphere | MTRLLLVVAAAVGLGVVLARSVVPDVTRYLRIRRM |
| Ga0307405_103832191 | 3300031731 | Rhizosphere | MTRLLIVVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0307413_109861512 | 3300031824 | Rhizosphere | MGQEETCQMKILLLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0307410_101221091 | 3300031852 | Rhizosphere | MTRLWLVLAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0307410_103827821 | 3300031852 | Rhizosphere | ETWQMKILLLAAAAVGLGAILAGNLLPDVTRYLRIRRM |
| Ga0307410_108448422 | 3300031852 | Rhizosphere | MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRRRM |
| Ga0307406_111010872 | 3300031901 | Rhizosphere | MTRLLLVLAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0307412_104626611 | 3300031911 | Rhizosphere | WQMKILLLAGAVGLGAIMASKVVPDVTRYLRIRRM |
| Ga0307409_1001218702 | 3300031995 | Rhizosphere | MSRLVLVVAAAVGLGVVLARSVVPDVTRYLRIRRM |
| Ga0307409_1019604761 | 3300031995 | Rhizosphere | MTRLLLVVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| Ga0307416_1000420303 | 3300032002 | Rhizosphere | MTRSLLVAAAAVVGLGAVLARSVMPDVPRYLRIRRM |
| Ga0307415_1015700451 | 3300032126 | Rhizosphere | MGQEETCQMKILLLVAAAVGLGAVLAGQVLPDVTR |
| Ga0370540_00428_870_1001 | 3300034448 | Soil | MKRGQEELEMKILVLVAAAVGLGAVLAGNVLPDVTRYLRIRRM |
| Ga0370540_09778_225_344 | 3300034448 | Soil | MARSVLLLLAVAVGLGALGVLAAGNVLPDVARYLRIRRM |
| Ga0370541_004913_1010_1117 | 3300034680 | Soil | MTRLLVVVAAAVGLGAVLARSVVPDVTRYLRIRRM |
| ⦗Top⦘ |