


| Basic Information | |
|---|---|
| Family ID | F073196 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTNTNERATAQVLSTSEHGTAQVFGLSLTAIFVGLLILNGISF |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 70.83 % |
| % of genes near scaffold ends (potentially truncated) | 35.83 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 13.33 |
| PF13493 | DUF4118 | 1.67 |
| PF00903 | Glyoxalase | 1.67 |
| PF13467 | RHH_4 | 1.67 |
| PF04311 | DUF459 | 1.67 |
| PF01068 | DNA_ligase_A_M | 1.67 |
| PF00072 | Response_reg | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| PF13548 | DUF4126 | 0.83 |
| PF00293 | NUDIX | 0.83 |
| PF01042 | Ribonuc_L-PSP | 0.83 |
| PF13430 | DUF4112 | 0.83 |
| PF02586 | SRAP | 0.83 |
| PF03776 | MinE | 0.83 |
| PF02195 | ParBc | 0.83 |
| PF03992 | ABM | 0.83 |
| PF07995 | GSDH | 0.83 |
| PF02656 | DUF202 | 0.83 |
| PF05829 | Adeno_PX | 0.83 |
| PF11272 | DUF3072 | 0.83 |
| PF02518 | HATPase_c | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 13.33 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 13.33 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.67 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.67 |
| COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 1.67 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.83 |
| COG0851 | Septum formation topological specificity factor MinE | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.83 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.00 % |
| All Organisms | root | All Organisms | 45.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig104616 | Not Available | 565 | Open in IMG/M |
| 2228664022|INPgaii200_c1028955 | Not Available | 646 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1001763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3459 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1073886 | Not Available | 517 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1002327 | Not Available | 1907 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1002365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1898 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1014308 | Not Available | 834 | Open in IMG/M |
| 3300000956|JGI10216J12902_104917873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300000956|JGI10216J12902_114777646 | Not Available | 836 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10095428 | Not Available | 540 | Open in IMG/M |
| 3300004479|Ga0062595_100344562 | Not Available | 1034 | Open in IMG/M |
| 3300005289|Ga0065704_10562301 | Not Available | 628 | Open in IMG/M |
| 3300005294|Ga0065705_10186556 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300005332|Ga0066388_100171559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2769 | Open in IMG/M |
| 3300005332|Ga0066388_100253581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2399 | Open in IMG/M |
| 3300005332|Ga0066388_103215096 | Not Available | 835 | Open in IMG/M |
| 3300005332|Ga0066388_104221550 | Not Available | 732 | Open in IMG/M |
| 3300005332|Ga0066388_104364629 | Not Available | 721 | Open in IMG/M |
| 3300005354|Ga0070675_101028393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 757 | Open in IMG/M |
| 3300005435|Ga0070714_101654646 | Not Available | 625 | Open in IMG/M |
| 3300005455|Ga0070663_100911144 | Not Available | 760 | Open in IMG/M |
| 3300005548|Ga0070665_100340361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1505 | Open in IMG/M |
| 3300005564|Ga0070664_100803432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 879 | Open in IMG/M |
| 3300005564|Ga0070664_101700654 | Not Available | 598 | Open in IMG/M |
| 3300005618|Ga0068864_101275259 | Not Available | 735 | Open in IMG/M |
| 3300005713|Ga0066905_100004003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5951 | Open in IMG/M |
| 3300005713|Ga0066905_100023241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3354 | Open in IMG/M |
| 3300005713|Ga0066905_101017533 | Not Available | 731 | Open in IMG/M |
| 3300005713|Ga0066905_101138591 | Not Available | 695 | Open in IMG/M |
| 3300005764|Ga0066903_100811456 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300005764|Ga0066903_106066559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300005764|Ga0066903_106377867 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_107030419 | Not Available | 583 | Open in IMG/M |
| 3300005764|Ga0066903_107678596 | Not Available | 555 | Open in IMG/M |
| 3300005764|Ga0066903_108230220 | Not Available | 533 | Open in IMG/M |
| 3300005764|Ga0066903_108750550 | Not Available | 514 | Open in IMG/M |
| 3300005764|Ga0066903_109123826 | Not Available | 501 | Open in IMG/M |
| 3300005842|Ga0068858_101585549 | Not Available | 646 | Open in IMG/M |
| 3300005937|Ga0081455_10006194 | All Organisms → cellular organisms → Bacteria | 12899 | Open in IMG/M |
| 3300005937|Ga0081455_10017740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6809 | Open in IMG/M |
| 3300005937|Ga0081455_10021176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6106 | Open in IMG/M |
| 3300005937|Ga0081455_10093425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2432 | Open in IMG/M |
| 3300006049|Ga0075417_10432165 | Not Available | 655 | Open in IMG/M |
| 3300006049|Ga0075417_10756380 | Not Available | 502 | Open in IMG/M |
| 3300006050|Ga0075028_100942392 | Not Available | 534 | Open in IMG/M |
| 3300006854|Ga0075425_100104683 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300006854|Ga0075425_100200819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2291 | Open in IMG/M |
| 3300006854|Ga0075425_101389661 | Not Available | 794 | Open in IMG/M |
| 3300006881|Ga0068865_100905505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300006914|Ga0075436_100514002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 877 | Open in IMG/M |
| 3300006931|Ga0097620_101230976 | Not Available | 825 | Open in IMG/M |
| 3300006969|Ga0075419_10878267 | Not Available | 646 | Open in IMG/M |
| 3300007076|Ga0075435_100042886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3620 | Open in IMG/M |
| 3300007076|Ga0075435_100417400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33 | 1155 | Open in IMG/M |
| 3300009156|Ga0111538_11428956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 872 | Open in IMG/M |
| 3300009156|Ga0111538_12255850 | Not Available | 684 | Open in IMG/M |
| 3300009156|Ga0111538_12542237 | Not Available | 642 | Open in IMG/M |
| 3300009162|Ga0075423_10022886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6223 | Open in IMG/M |
| 3300009162|Ga0075423_10362087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1521 | Open in IMG/M |
| 3300009162|Ga0075423_12292543 | Not Available | 587 | Open in IMG/M |
| 3300009168|Ga0105104_10199542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylosarcina → Methylosarcina fibrata | 1087 | Open in IMG/M |
| 3300009176|Ga0105242_11334029 | Not Available | 742 | Open in IMG/M |
| 3300009553|Ga0105249_13387882 | Not Available | 513 | Open in IMG/M |
| 3300009792|Ga0126374_10003528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5174 | Open in IMG/M |
| 3300010043|Ga0126380_10006398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5035 | Open in IMG/M |
| 3300010047|Ga0126382_10464060 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300010047|Ga0126382_10692306 | Not Available | 854 | Open in IMG/M |
| 3300010047|Ga0126382_10895769 | Not Available | 767 | Open in IMG/M |
| 3300010047|Ga0126382_12097810 | Not Available | 541 | Open in IMG/M |
| 3300010358|Ga0126370_12348925 | Not Available | 528 | Open in IMG/M |
| 3300010360|Ga0126372_10027546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3494 | Open in IMG/M |
| 3300010361|Ga0126378_10399918 | Not Available | 1486 | Open in IMG/M |
| 3300010361|Ga0126378_10869394 | Not Available | 1009 | Open in IMG/M |
| 3300010362|Ga0126377_10075562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3010 | Open in IMG/M |
| 3300010362|Ga0126377_11115639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 858 | Open in IMG/M |
| 3300010868|Ga0124844_1260268 | Not Available | 604 | Open in IMG/M |
| 3300012495|Ga0157323_1046002 | Not Available | 516 | Open in IMG/M |
| 3300012511|Ga0157332_1090666 | Not Available | 507 | Open in IMG/M |
| 3300012948|Ga0126375_10629057 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012948|Ga0126375_11106629 | Not Available | 653 | Open in IMG/M |
| 3300012957|Ga0164303_10599095 | Not Available | 725 | Open in IMG/M |
| 3300012957|Ga0164303_10906340 | Not Available | 618 | Open in IMG/M |
| 3300012958|Ga0164299_10281823 | Not Available | 1011 | Open in IMG/M |
| 3300012971|Ga0126369_10207648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1894 | Open in IMG/M |
| 3300012984|Ga0164309_10851984 | Not Available | 738 | Open in IMG/M |
| 3300012986|Ga0164304_10229960 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300015373|Ga0132257_100242592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2149 | Open in IMG/M |
| 3300015373|Ga0132257_100607271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33 | 1352 | Open in IMG/M |
| 3300018066|Ga0184617_1071480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300018072|Ga0184635_10126089 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300020002|Ga0193730_1059342 | Not Available | 1098 | Open in IMG/M |
| 3300021560|Ga0126371_10454809 | Not Available | 1426 | Open in IMG/M |
| 3300021560|Ga0126371_11773644 | Not Available | 739 | Open in IMG/M |
| 3300022533|Ga0242662_10092710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300025900|Ga0207710_10624313 | Not Available | 564 | Open in IMG/M |
| 3300025914|Ga0207671_10934077 | Not Available | 685 | Open in IMG/M |
| 3300025926|Ga0207659_11932888 | Not Available | 500 | Open in IMG/M |
| 3300025945|Ga0207679_10536299 | Not Available | 1048 | Open in IMG/M |
| 3300027873|Ga0209814_10007268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4291 | Open in IMG/M |
| 3300027874|Ga0209465_10014967 | All Organisms → cellular organisms → Bacteria | 3506 | Open in IMG/M |
| 3300027874|Ga0209465_10617465 | Not Available | 536 | Open in IMG/M |
| 3300028828|Ga0307312_10757277 | Not Available | 643 | Open in IMG/M |
| 3300028884|Ga0307308_10095050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1418 | Open in IMG/M |
| 3300028885|Ga0307304_10276754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300031170|Ga0307498_10119997 | Not Available | 836 | Open in IMG/M |
| 3300031231|Ga0170824_120065438 | Not Available | 774 | Open in IMG/M |
| 3300031538|Ga0310888_10091284 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300031543|Ga0318516_10253422 | Not Available | 1018 | Open in IMG/M |
| 3300031545|Ga0318541_10000406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13927 | Open in IMG/M |
| 3300031545|Ga0318541_10007264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4787 | Open in IMG/M |
| 3300031545|Ga0318541_10012708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3836 | Open in IMG/M |
| 3300031547|Ga0310887_10223267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1037 | Open in IMG/M |
| 3300031720|Ga0307469_11341218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 680 | Open in IMG/M |
| 3300031736|Ga0318501_10506900 | Not Available | 658 | Open in IMG/M |
| 3300031763|Ga0318537_10333903 | Not Available | 560 | Open in IMG/M |
| 3300031945|Ga0310913_10012424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5139 | Open in IMG/M |
| 3300031959|Ga0318530_10423697 | Not Available | 552 | Open in IMG/M |
| 3300032205|Ga0307472_100361789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1196 | Open in IMG/M |
| 3300034644|Ga0370548_005274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1569 | Open in IMG/M |
| 3300034818|Ga0373950_0046557 | Not Available | 843 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0615.00006540 | 2166559005 | Simulated | MTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVGLLILNSISF |
| INPgaii200_10289553 | 2228664022 | Soil | ERVTAQVLGNTSERMTAQXFGLSLTAIFVGLLILNGISF |
| AF_2010_repII_A01DRAFT_10017636 | 3300000580 | Forest Soil | MTNTNERATAHVFSTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| AF_2010_repII_A01DRAFT_10738862 | 3300000580 | Forest Soil | MTNTSERATTQVFSTSEHRTAQMFGLSLTAIFLGLLILNGMSF* |
| AF_2010_repII_A10DRAFT_10023272 | 3300000816 | Forest Soil | MTKTNERATAQVLNTSKHGTAQVFGLSLTAIFVGLLILNGISF* |
| AF_2010_repII_A10DRAFT_10023654 | 3300000816 | Forest Soil | MTNANERVTAQVLGKNEHVTAQLFGLSLTAIFVGLLILNGISF* |
| AF_2010_repII_A10DRAFT_10143081 | 3300000816 | Forest Soil | MTNTNERATAQVSRTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| JGI10216J12902_1049178733 | 3300000956 | Soil | NRNAGDVMTNTNERATAQVLRTNEHRTAQMFGLSLTAIFVGLMILNGISF* |
| JGI10216J12902_1147776462 | 3300000956 | Soil | MTNTNERATAQVFSTSQYRTTQVFGLSLTAIFVGLLILNGISF* |
| JGIcombinedJ43975_100954282 | 3300002899 | Soil | MTNSNERATAQVLGTSDYRTAQMFGLSLTAVFVGLLILNGISF* |
| Ga0062595_1003445623 | 3300004479 | Soil | MTITNERATAQMFSTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0065704_105623011 | 3300005289 | Switchgrass Rhizosphere | MTITNERATAQVLSTSEYRTTQAFGLSLTAIFVGLLILNSISF* |
| Ga0065705_101865563 | 3300005294 | Switchgrass Rhizosphere | MTNTNERATAQVIGTSDYRTAQMFGLSLTAVFVGLLILNGISF* |
| Ga0066388_1001715593 | 3300005332 | Tropical Forest Soil | MTNTNARATAQVSRTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0066388_1002535815 | 3300005332 | Tropical Forest Soil | MTNTNERATAQVLGTGEYRTAQMFGLSLTAVFVGLLILNGISF* |
| Ga0066388_1032150961 | 3300005332 | Tropical Forest Soil | MTNTNERATAQVLRTNEHRTAQMFGLSLTAIFVGLMILNGISF* |
| Ga0066388_1042215502 | 3300005332 | Tropical Forest Soil | VGIDVMTNTNERAIAQVLRTNEHRATQMFGLSLTAIFVGLMILNGISF* |
| Ga0066388_1043646291 | 3300005332 | Tropical Forest Soil | MTNTNERATAQVFSASEYRTTQVFGLSLTAIFMGLLILNGISF* |
| Ga0070675_1010283931 | 3300005354 | Miscanthus Rhizosphere | IDVMTITNERATAQVLSTSEYRTTQAFGLSLTAIFVGLLILNSISF* |
| Ga0070714_1016546461 | 3300005435 | Agricultural Soil | MTITNERATAQVLSTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0070663_1009111442 | 3300005455 | Corn Rhizosphere | MQDHVMTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF* |
| Ga0070665_1003403611 | 3300005548 | Switchgrass Rhizosphere | MTNAGATAQVLSEHGTAQVFGLSLTAIFLGLLILNGISF* |
| Ga0070664_1008034321 | 3300005564 | Corn Rhizosphere | TAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISL* |
| Ga0070664_1017006541 | 3300005564 | Corn Rhizosphere | MTNTNERATAQVFSTSEYWTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0068864_1012752592 | 3300005618 | Switchgrass Rhizosphere | MTNAGATAQVLSEHGTAQVFGLSLTAIFLGLLILNGTSF* |
| Ga0066905_1000040038 | 3300005713 | Tropical Forest Soil | MTNTSERATAQVLRTSEHGTAQVFGLWLTAIFVGLMILNGISF* |
| Ga0066905_1000232412 | 3300005713 | Tropical Forest Soil | MTNASERVSAQALNSSERVTAQVFGLSLTAIFVGLLILNSISY* |
| Ga0066905_1010175331 | 3300005713 | Tropical Forest Soil | MTNTSERVTAQAFGNTSERVTAQVFGLSLTAIFVGLLILNGISF* |
| Ga0066905_1011385911 | 3300005713 | Tropical Forest Soil | MTNTRERVTAHTSERVTAQVFGLSLAAIFLGLMILNGISF* |
| Ga0066903_1008114562 | 3300005764 | Tropical Forest Soil | MAITNERATAQVFSTSEGLSLTAIFVGLLILNGLSF* |
| Ga0066903_1060665592 | 3300005764 | Tropical Forest Soil | MTNTNERAIAQVLRTNEHRATQMFGLSLTAIFVGLMILN |
| Ga0066903_1063778672 | 3300005764 | Tropical Forest Soil | MTNTSERATTQAFSTSEHRTAQMFGLSLTAIFLGLLILNGMSF* |
| Ga0066903_1070304192 | 3300005764 | Tropical Forest Soil | VMTNTRERATTQVFSTSEHRTAQMFGLSLTAIFLGLMILNGMSF* |
| Ga0066903_1076785961 | 3300005764 | Tropical Forest Soil | TRERATTQVFSTSEHRTAQMFGLSLTAIFLGLLILNGMSF* |
| Ga0066903_1082302201 | 3300005764 | Tropical Forest Soil | VGIDVMTNISERATAQVFSTSEHRTAQMFGLSLTAIFLGLMILNGLSF* |
| Ga0066903_1087505501 | 3300005764 | Tropical Forest Soil | MTNTNERVTAQALNTSKHGTTQVFGLSLTAIFVGLLILNGISF* |
| Ga0066903_1091238261 | 3300005764 | Tropical Forest Soil | ATAQVLNTSKHGTAQVFGLSLTAIFVGLLILNGISF* |
| Ga0068858_1015855491 | 3300005842 | Switchgrass Rhizosphere | RATAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISF* |
| Ga0081455_1000619416 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNTNERATAQVFRTSEYRTTQVFGLSLTAIFLGVLILNGISF* |
| Ga0081455_1001774012 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNTNQRATAQVFSTSEYRTTQVFGLSLTAIFVGLLILNGISF* |
| Ga0081455_100211764 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNKSERVTAQVLGNTSERVTAQVFGLSLTAIFVGLLILNGISF* |
| Ga0081455_100934252 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTNTNERATAQLLSTSEHGTAQVFGLSLTAIFVGLLILNGVSF* |
| Ga0075417_104321651 | 3300006049 | Populus Rhizosphere | MTNQSERVTAQVLENTSEHMTAQVFGLSLTAIFVGLLVLNGISF* |
| Ga0075417_107563801 | 3300006049 | Populus Rhizosphere | MTNTNERATAQVFSASEYRTTQVFGLSLTAIFAGLLILNGISF* |
| Ga0075028_1009423921 | 3300006050 | Watersheds | MTNANEGATAQMLSEHGTAQVFGLSLTAIFLGLLILNGISF* |
| Ga0075425_1001046834 | 3300006854 | Populus Rhizosphere | MTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISF* |
| Ga0075425_1002008195 | 3300006854 | Populus Rhizosphere | MTNTNERATAQVFSTSQYRTTQVFGLSLTAIFAGLLILNGISF* |
| Ga0075425_1013896612 | 3300006854 | Populus Rhizosphere | MTNTSERVTAHTSERVTAQVFGLSLAAIFLGLMILNGISF* |
| Ga0068865_1009055051 | 3300006881 | Miscanthus Rhizosphere | MTNANKGATAQMLSEHGTAQVFGLSLTAIFLGLLILNGISF |
| Ga0075436_1005140023 | 3300006914 | Populus Rhizosphere | TTKSKCRDHVMTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISF* |
| Ga0097620_1012309761 | 3300006931 | Switchgrass Rhizosphere | MTNANKGATAQMLSEHGTAQVFGLSLTAIFLGLLILNGISF* |
| Ga0075419_108782672 | 3300006969 | Populus Rhizosphere | MTNTNERATAQVFSTSEYRTTQVFGLSLTAIFLGLLILNGISF* |
| Ga0075435_1000428865 | 3300007076 | Populus Rhizosphere | DHVMTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISF* |
| Ga0075435_1004174001 | 3300007076 | Populus Rhizosphere | MTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLL |
| Ga0111538_114289561 | 3300009156 | Populus Rhizosphere | NAGIDVMTITNERATAQMFSTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0111538_122558502 | 3300009156 | Populus Rhizosphere | RPLAFPCLEQKRNAGIEVMTNASERVTADRSERVTAQVFGLSLAAIFLGLMILNGISF* |
| Ga0111538_125422371 | 3300009156 | Populus Rhizosphere | MTNTNERATAQVFSTSEYRTAQVFGLSLTAIFLGLLILNGISF* |
| Ga0075423_100228866 | 3300009162 | Populus Rhizosphere | MTNTNERATAQVLGTSEYRTAQMFGLSLTAVFVGLLVLNGISF* |
| Ga0075423_103620872 | 3300009162 | Populus Rhizosphere | MTNTNERATAQVLSTSEYWTTQAFGLSLTALFVGLLILNGISF* |
| Ga0075423_122925431 | 3300009162 | Populus Rhizosphere | MTNTNERATAQVLSTIEHRTAQMFGLSLTVIFVGLMILNGISF* |
| Ga0105104_101995421 | 3300009168 | Freshwater Sediment | MTNKSERVTAQVLGNTSERVTAQVFGLSLTAIFVGLMILNGISF* |
| Ga0105242_113340291 | 3300009176 | Miscanthus Rhizosphere | PQNRNAGNDVMTNANKGATAQMLSEHGTAQVFGLSLTAIFLGLLILNGISF* |
| Ga0105249_133878821 | 3300009553 | Switchgrass Rhizosphere | LADHKIEMQDHVMTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF* |
| Ga0126374_100035287 | 3300009792 | Tropical Forest Soil | MTNTSERATAQVFSTSEHRTAQMFGLSLTAIFLGLMILNGMSF* |
| Ga0126380_100063989 | 3300010043 | Tropical Forest Soil | MTNTNERATAHVFGTSEYRTTQAFGLSLTAIFVGLLILNGISF* |
| Ga0126382_104640603 | 3300010047 | Tropical Forest Soil | DVMTKTNQRATAQVFSTSEYRTTQVFGLSLTAIFVGLLILNGISF* |
| Ga0126382_106923061 | 3300010047 | Tropical Forest Soil | TAQVFNTSEYRTTQVFGLSLTAIFLGLLILNGISF* |
| Ga0126382_108957691 | 3300010047 | Tropical Forest Soil | DVMTNTNERATAQVLRTNEHRATQMFGLSLTAIFVGLMILNGISF* |
| Ga0126382_120978101 | 3300010047 | Tropical Forest Soil | ERATAQVLRTNEQRTAQMFGLWVTAIFVGLMILNAIS* |
| Ga0126370_123489252 | 3300010358 | Tropical Forest Soil | VGIDIMTNTNERAIAQVLRTNDHRAAQMFGLSLTAIFVGLMILNAISS* |
| Ga0126372_100275466 | 3300010360 | Tropical Forest Soil | MTNTNERATAHVFGTSEYRTTQAFGLSLTAIFVGLLILNGVSF* |
| Ga0126378_103999182 | 3300010361 | Tropical Forest Soil | ARTHFITNTNERVTAQALNTSKHGTTQVFGLSLTAIFVGLLILNGISF* |
| Ga0126378_108693942 | 3300010361 | Tropical Forest Soil | MKNTNERATAQVLNTSKHGTAQVFGLSLTAIFVGLLILNGISF* |
| Ga0126377_100755627 | 3300010362 | Tropical Forest Soil | MTNTNQRATAHVFSASEYRTTQVFGLSLTAIFVGLLILNGISF* |
| Ga0126377_111156391 | 3300010362 | Tropical Forest Soil | MTNTNERATAQVFSASEYRTTQVFGLSLTAIFVGLLI |
| Ga0124844_12602681 | 3300010868 | Tropical Forest Soil | MTNTNERATAHVFGTSEYRTTQAFGLSLTAIFVGL |
| Ga0157323_10460022 | 3300012495 | Arabidopsis Rhizosphere | MTNAGATAQVLSEHGTAQVFGLSLTAIFLGLTASF* |
| Ga0157332_10906661 | 3300012511 | Soil | MQDHVMTNTNERATAQVLSTSEYWTTQAFGLSLTAL |
| Ga0126375_106290573 | 3300012948 | Tropical Forest Soil | MTNASERVSAQALNSSERVTAQVFGLSLTAIFVGLLILNSFLTEASRV* |
| Ga0126375_111066291 | 3300012948 | Tropical Forest Soil | MTNTNQRATAQVLNTSKHGTAQVFGLSLTAIFVGLLILNGISF* |
| Ga0164303_105990951 | 3300012957 | Soil | VMTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILHGISF* |
| Ga0164303_109063401 | 3300012957 | Soil | MTNTNARAKAQVLSTSEHGTAQAFGLSLMAIFVGLLILNSISF* |
| Ga0164299_102818231 | 3300012958 | Soil | MTNTNERATAQVFSTSEYWTTQAFGLSLTAIVVGRLILNGISF* |
| Ga0126369_102076481 | 3300012971 | Tropical Forest Soil | IDVMTNTSERATAQVFSTSEHRTAQMFGLSLTAIFLGLMILNGMSF* |
| Ga0164309_108519842 | 3300012984 | Soil | MTNANEGATAQMLSEHGTAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF* |
| Ga0164304_102299603 | 3300012986 | Soil | MTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF* |
| Ga0132257_1002425921 | 3300015373 | Arabidopsis Rhizosphere | RDHVMTNTNERATAQVFSTSEYRTTQAFGLSLTALLVGLLILNGISF* |
| Ga0132257_1006072711 | 3300015373 | Arabidopsis Rhizosphere | MTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLLI |
| Ga0184617_10714802 | 3300018066 | Groundwater Sediment | MTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVGLLILNGISF |
| Ga0184635_101260891 | 3300018072 | Groundwater Sediment | MTNSNERATAQVLSTSERLTAQVFGLSLTALFVGLLILNGISF |
| Ga0193730_10593422 | 3300020002 | Soil | MTNTNERATAQVLSTSEHGTAQVFGLSLTAIFVGLLILNGISF |
| Ga0126371_104548092 | 3300021560 | Tropical Forest Soil | MTITNERATAQVFSTSEGLSLTAIFVGLLILNGISF |
| Ga0126371_117736442 | 3300021560 | Tropical Forest Soil | MKNTNERATAQVLNTSKHGTAQVFGLSLTAIFVGLLILNGISF |
| Ga0242662_100927101 | 3300022533 | Soil | KIEMQDHVMTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF |
| Ga0207710_106243132 | 3300025900 | Switchgrass Rhizosphere | MTNAGATAQVLSEHGTAQVFGLSLTAIFLGLLILNGISF |
| Ga0207671_109340772 | 3300025914 | Corn Rhizosphere | MTNANKGATAQMLSEHGTAQVFGLSLTAVFVGLLILNGISY |
| Ga0207659_119328881 | 3300025926 | Miscanthus Rhizosphere | NERATPQMFSTSEYRTTQAFGLSLTAIFVGLLILNGISF |
| Ga0207679_105362992 | 3300025945 | Corn Rhizosphere | MTNTNERATAQVFSTSEYRTTQAFGLSLTALFVGLLILNGISL |
| Ga0209814_100072686 | 3300027873 | Populus Rhizosphere | MTNTNERATAQVLGTSEYRTAQMFGLSLTAVFVGLLILNGISF |
| Ga0209465_100149676 | 3300027874 | Tropical Forest Soil | MTNTSERAAAQVISTSEYRTTQAFGLSLTAIFVGLLILNGISF |
| Ga0209465_106174651 | 3300027874 | Tropical Forest Soil | MTNTNERVTAQALNTSKHGTTQVFGLSLTAIFVGLLILNGISF |
| Ga0307312_107572772 | 3300028828 | Soil | VMTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVGLLILNSISF |
| Ga0307308_100950503 | 3300028884 | Soil | MTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVNLLILNGISF |
| Ga0307304_102767542 | 3300028885 | Soil | MTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVGLLILNRISF |
| Ga0307498_101199971 | 3300031170 | Soil | MTNANEGAIAHMLSEHGTAQVFGLSLTAIFLGLLILNG |
| Ga0170824_1200654381 | 3300031231 | Forest Soil | MTNTNERATAQVLSTSERGTAQAFGLSLMAIFVGLLILNSISF |
| Ga0310888_100912843 | 3300031538 | Soil | MTNTNERATAQVFSTSEYWTTQAFGLSLTALFVGLLILNGISF |
| Ga0318516_102534222 | 3300031543 | Soil | MTNTNERATAQVLNTSKHGTTQVFGLSLTAIFVGLLILN |
| Ga0318541_100004069 | 3300031545 | Soil | MTNTRERATTQVFSTSEHRTAQMFGLSLTTIFLGLLILNGMSF |
| Ga0318541_100072645 | 3300031545 | Soil | MTNTNERATAQVLNTSKHGTTQVFGLSLTAIFVGLLILNGISF |
| Ga0318541_100127081 | 3300031545 | Soil | MTNTSERAAAQVISTSEYRTTQAFGLSLTAIFVGLLILNSVSF |
| Ga0310887_102232673 | 3300031547 | Soil | TAQVLSTSEYWTTQAFGLSLTALFVGLLILNGISF |
| Ga0307469_113412182 | 3300031720 | Hardwood Forest Soil | ERATAQVLSTSEYRTTQAFGLSLTAIFVGLLILNSISF |
| Ga0318501_105069001 | 3300031736 | Soil | TTQVFSTSEHRTAQMFGLSLTTIFLGLLILNGMSF |
| Ga0318537_103339031 | 3300031763 | Soil | MTNTNDRATAQVLNTSKHGTTQVFGLSLTAIFVGLLILNGISF |
| Ga0310913_100124245 | 3300031945 | Soil | MTNTSQRATAQVFSTSEYRTTQAFGLSLTAIFVGLLILNSVSF |
| Ga0318530_104236971 | 3300031959 | Soil | DRATAQVLNTSKHGTTQVFGLSLTAIFVGLLILNGISF |
| Ga0307472_1003617893 | 3300032205 | Hardwood Forest Soil | MTITNERATAQVLSTSEYRTTQAFGLSLTAIFVGLLILNSISF |
| Ga0370548_005274_1415_1567 | 3300034644 | Soil | RNAGIDVLTNTNERATAQVLSTSEHGTAQAFGLSLMAIFVGLLILNSISF |
| Ga0373950_0046557_720_842 | 3300034818 | Rhizosphere Soil | MTITNERATAQMFSTSEYRTTQAFGLSLTAIFVGLLILNSI |
| ⦗Top⦘ |