


| Basic Information | |
|---|---|
| Family ID | F073168 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKKPYQIEAQRAVKQLEAMAADGNPAVQMMLPMAEMVGWLRKG |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.50 % |
| % of genes near scaffold ends (potentially truncated) | 83.33 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (9.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00872 | Transposase_mut | 4.17 |
| PF03050 | DDE_Tnp_IS66 | 1.67 |
| PF02371 | Transposase_20 | 1.67 |
| PF13360 | PQQ_2 | 1.67 |
| PF00756 | Esterase | 0.83 |
| PF04255 | DUF433 | 0.83 |
| PF04471 | Mrr_cat | 0.83 |
| PF00196 | GerE | 0.83 |
| PF13418 | Kelch_4 | 0.83 |
| PF05593 | RHS_repeat | 0.83 |
| PF08264 | Anticodon_1 | 0.83 |
| PF02679 | ComA | 0.83 |
| PF14417 | MEDS | 0.83 |
| PF00078 | RVT_1 | 0.83 |
| PF05598 | DUF772 | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF01041 | DegT_DnrJ_EryC1 | 0.83 |
| PF00080 | Sod_Cu | 0.83 |
| PF15919 | HicB_lk_antitox | 0.83 |
| PF14659 | Phage_int_SAM_3 | 0.83 |
| PF13545 | HTH_Crp_2 | 0.83 |
| PF06296 | RelE | 0.83 |
| PF13565 | HTH_32 | 0.83 |
| PF07007 | LprI | 0.83 |
| PF13620 | CarboxypepD_reg | 0.83 |
| PF01609 | DDE_Tnp_1 | 0.83 |
| PF13177 | DNA_pol3_delta2 | 0.83 |
| PF01029 | NusB | 0.83 |
| PF01477 | PLAT | 0.83 |
| PF13401 | AAA_22 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF03069 | FmdA_AmdA | 0.83 |
| PF08706 | D5_N | 0.83 |
| PF13614 | AAA_31 | 0.83 |
| PF12543 | DUF3738 | 0.83 |
| PF13546 | DDE_5 | 0.83 |
| PF02796 | HTH_7 | 0.83 |
| PF03070 | TENA_THI-4 | 0.83 |
| PF13358 | DDE_3 | 0.83 |
| PF04679 | DNA_ligase_A_C | 0.83 |
| PF01610 | DDE_Tnp_ISL3 | 0.83 |
| PF07638 | Sigma70_ECF | 0.83 |
| PF13683 | rve_3 | 0.83 |
| PF13442 | Cytochrome_CBB3 | 0.83 |
| PF00884 | Sulfatase | 0.83 |
| PF13378 | MR_MLE_C | 0.83 |
| PF07366 | SnoaL | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 4.17 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.67 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.83 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.83 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.83 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.83 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.83 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.83 |
| COG1809 | Phosphosulfolactate synthase, CoM biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.83 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.83 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.83 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.83 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.83 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.83 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.83 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.83 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.83 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.83 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.00 % |
| Unclassified | root | N/A | 10.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100495644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1129 | Open in IMG/M |
| 3300001305|C688J14111_10307840 | Not Available | 503 | Open in IMG/M |
| 3300005181|Ga0066678_10738855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 654 | Open in IMG/M |
| 3300005338|Ga0068868_102333399 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005451|Ga0066681_10979718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005539|Ga0068853_100050538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3577 | Open in IMG/M |
| 3300005546|Ga0070696_101140959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300005547|Ga0070693_101580806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005554|Ga0066661_10461594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300005560|Ga0066670_10188475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300005587|Ga0066654_10923114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005650|Ga0075038_10037858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 869 | Open in IMG/M |
| 3300006028|Ga0070717_10022241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5008 | Open in IMG/M |
| 3300006052|Ga0075029_100161761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1381 | Open in IMG/M |
| 3300006102|Ga0075015_100076688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300006893|Ga0073928_10097314 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300006893|Ga0073928_10608129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300006893|Ga0073928_11014613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009053|Ga0105095_10615131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300009089|Ga0099828_11426648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009098|Ga0105245_13196220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. FACHB-SPT15 | 508 | Open in IMG/M |
| 3300009156|Ga0111538_10409228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1718 | Open in IMG/M |
| 3300009156|Ga0111538_13240541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010045|Ga0126311_11316179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300010361|Ga0126378_10645473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1172 | Open in IMG/M |
| 3300010361|Ga0126378_12243469 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010376|Ga0126381_102061990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300010376|Ga0126381_103283630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300010398|Ga0126383_10214004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1862 | Open in IMG/M |
| 3300010398|Ga0126383_10924724 | Not Available | 959 | Open in IMG/M |
| 3300010401|Ga0134121_11981361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012209|Ga0137379_11512266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012353|Ga0137367_11154001 | Not Available | 520 | Open in IMG/M |
| 3300012358|Ga0137368_10543341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 744 | Open in IMG/M |
| 3300012532|Ga0137373_10876708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012904|Ga0157282_10231127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012917|Ga0137395_10022850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3671 | Open in IMG/M |
| 3300012917|Ga0137395_10808064 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012929|Ga0137404_11967569 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012960|Ga0164301_11134709 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012960|Ga0164301_11657471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300013088|Ga0163200_1101726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 875 | Open in IMG/M |
| 3300013307|Ga0157372_11707050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 724 | Open in IMG/M |
| 3300014159|Ga0181530_10013058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6976 | Open in IMG/M |
| 3300014499|Ga0182012_10110947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300014501|Ga0182024_10004627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 31461 | Open in IMG/M |
| 3300014501|Ga0182024_10369484 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300014501|Ga0182024_10962415 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300014657|Ga0181522_10056450 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300015051|Ga0137414_1165011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1788 | Open in IMG/M |
| 3300015360|Ga0163144_11206030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300015374|Ga0132255_104976193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300016700|Ga0181513_1138764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 673 | Open in IMG/M |
| 3300016730|Ga0181515_1147672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 583 | Open in IMG/M |
| 3300017823|Ga0187818_10543908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300017938|Ga0187854_10202820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300017947|Ga0187785_10626418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300017966|Ga0187776_10463060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300017970|Ga0187783_10919751 | Not Available | 630 | Open in IMG/M |
| 3300017972|Ga0187781_10480446 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300018022|Ga0187864_10473115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300018025|Ga0187885_10113281 | Not Available | 1308 | Open in IMG/M |
| 3300018026|Ga0187857_10333245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → Acidiferrobacter thiooxydans | 689 | Open in IMG/M |
| 3300018033|Ga0187867_10493213 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300018468|Ga0066662_11240187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300018482|Ga0066669_10513698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300019788|Ga0182028_1289934 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300021388|Ga0213875_10150576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300021388|Ga0213875_10415331 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021420|Ga0210394_11745585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300021560|Ga0126371_12636675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300025912|Ga0207707_11442757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025920|Ga0207649_10444490 | Not Available | 977 | Open in IMG/M |
| 3300025936|Ga0207670_11636552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300025944|Ga0207661_10641549 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300025960|Ga0207651_11048994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300025961|Ga0207712_11249763 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300026324|Ga0209470_1335276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300026326|Ga0209801_1273613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300026489|Ga0257160_1036321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 827 | Open in IMG/M |
| 3300027039|Ga0207855_1005152 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300027388|Ga0208995_1082537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300027575|Ga0209525_1122835 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027766|Ga0209796_10061322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300027775|Ga0209177_10332686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300027846|Ga0209180_10475727 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300027854|Ga0209517_10085327 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300027854|Ga0209517_10257332 | Not Available | 1041 | Open in IMG/M |
| 3300027894|Ga0209068_10750457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ES1 | 573 | Open in IMG/M |
| 3300027911|Ga0209698_11245559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300028798|Ga0302222_10013721 | All Organisms → cellular organisms → Bacteria | 3329 | Open in IMG/M |
| 3300029882|Ga0311368_10496928 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300029894|Ga0247028_1068851 | Not Available | 756 | Open in IMG/M |
| 3300029944|Ga0311352_10339883 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300029944|Ga0311352_10982683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300029951|Ga0311371_10308960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2223 | Open in IMG/M |
| 3300029999|Ga0311339_10036384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 6898 | Open in IMG/M |
| 3300029999|Ga0311339_11953282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300030007|Ga0311338_10006244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18311 | Open in IMG/M |
| 3300030606|Ga0299906_10973220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300031057|Ga0170834_100294408 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031236|Ga0302324_101697694 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031236|Ga0302324_102613552 | Not Available | 613 | Open in IMG/M |
| 3300031469|Ga0170819_13497097 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031474|Ga0170818_109485605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300031521|Ga0311364_11864371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300031525|Ga0302326_10099443 | All Organisms → cellular organisms → Bacteria | 5218 | Open in IMG/M |
| 3300031576|Ga0247727_10580053 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Bythopirellula → Bythopirellula goksoeyrii | 848 | Open in IMG/M |
| 3300031708|Ga0310686_109323408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1688 | Open in IMG/M |
| 3300031708|Ga0310686_119392144 | Not Available | 544 | Open in IMG/M |
| 3300031718|Ga0307474_10144109 | Not Available | 1795 | Open in IMG/M |
| 3300032205|Ga0307472_100477417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300032782|Ga0335082_10297823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1486 | Open in IMG/M |
| 3300032783|Ga0335079_12284290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300032805|Ga0335078_11442889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300032805|Ga0335078_12460480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300032892|Ga0335081_10253568 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300032954|Ga0335083_11396307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300033134|Ga0335073_10364942 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300033179|Ga0307507_10705130 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.67% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029894 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1004956443 | 3300000559 | Soil | MKKPYQIEAQRAVKQLEAMATDGNPAVQMVLPMAEMVGWL |
| C688J14111_103078402 | 3300001305 | Soil | MKKPYQIESQRAVKRLEEMVADGNPAVQMVLPMAEMVGGCAKGWEN* |
| Ga0066678_107388552 | 3300005181 | Soil | MKKPYQIESQRAVKQLEAMAADGNPAVQMVLPMAEMVGWLRKGVGELIR* |
| Ga0068868_1023333991 | 3300005338 | Miscanthus Rhizosphere | MRKPYQIEAQRAVKQFEAMAADGNPAVQMMLPVAEMVGWLRKGVG |
| Ga0066681_109797183 | 3300005451 | Soil | MKKPYQIEAQRAVKQLEEMATDGNAAVQLVLPIAEMVGWL |
| Ga0068853_1000505381 | 3300005539 | Corn Rhizosphere | MRKPYQIESQRAVKRLEEMVADGNPAVQMVLPMAEMVGWLREGVGELIRRAG |
| Ga0070696_1011409592 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPYQIESQRAVKQLEAMAADGNPAVQMVLPLAEMVGWLRKGVGEL |
| Ga0070693_1015808062 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPYQIEAQRAVRQLEEMAANGNPAVQMVLPMAEMVGWLRQGVGAL |
| Ga0066661_104615941 | 3300005554 | Soil | MKKPYQIEAQRAVKRLEEMAGEGNPAVQMVLPMAEMVGWLRKGVGELVRQAGL |
| Ga0066670_101884751 | 3300005560 | Soil | MKKPYQIESQRAVKRLEGMAAEGNPAVQMILPMAEMVGWLRQGVG |
| Ga0066654_109231141 | 3300005587 | Soil | MKKPYQIESQRAVKQFEEMAADGNPAVQMLLPMAEMVGWLRKGVGELIR |
| Ga0075038_100378582 | 3300005650 | Permafrost Soil | MKKPYQIEAQRAVKQLEAMAAGGNPAVQMVLPMAEMVGWLRKGVGELIRQAG |
| Ga0070717_100222416 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPYQIEAQRAVNRLEEMAAEGNPAVQMVLPMAEMVGWLR |
| Ga0075029_1001617613 | 3300006052 | Watersheds | MKKPYQIAAQRAVKQLEAMAGDGNPAVQMVLPMAEMMSWLRKGVGELIRQAG |
| Ga0075015_1000766881 | 3300006102 | Watersheds | MKKPYQIEAQRAVKQLEAMAADDGNPAVQMVLPMAE |
| Ga0073928_100973141 | 3300006893 | Iron-Sulfur Acid Spring | MKKPYQIETQRAVNRLEEMAAEGNPAVQMVLPMAEMVGWLRKGVGELVR |
| Ga0073928_106081292 | 3300006893 | Iron-Sulfur Acid Spring | MKKPYQIESQRAVKRLEEMVAEGNPTVQMMLPLAEMVG* |
| Ga0073928_110146132 | 3300006893 | Iron-Sulfur Acid Spring | MKKPYQIESQRAVKELEAMAADGNPAVQMLLPMAEMVGWLR* |
| Ga0105095_106151311 | 3300009053 | Freshwater Sediment | MKKSYQIEAQRAVRQLEAMAAEGNPAVQMVLPMAEMVGWLREGVGAL |
| Ga0099828_114266481 | 3300009089 | Vadose Zone Soil | MKKPYQIESQRAVKRLEEMAAEGNPAVQLVLPMAEMVGWLREG |
| Ga0105245_131962202 | 3300009098 | Miscanthus Rhizosphere | MNKPYQIEAQRAVKQFEAMATAGNPAVQMMLPLAEMV |
| Ga0111538_104092281 | 3300009156 | Populus Rhizosphere | MKKPYQIESQRAVKQLERMAAEGNPAVQMVLPLAEMVGWLRKGVGD* |
| Ga0111538_132405411 | 3300009156 | Populus Rhizosphere | MKKPYQIESQRAVKQLEQMAEDGNPAVQMVLPMAEMIGWLRQGVAN* |
| Ga0126311_113161792 | 3300010045 | Serpentine Soil | MKKPYQIEAQRAVKQFEAMAAEGNPAVQMMLPMAEMVVWLRKGVG |
| Ga0126378_106454733 | 3300010361 | Tropical Forest Soil | MKKPYQIEAQRAIKQLDAMAAEGSLAVQMVLPMAEMMGWLR |
| Ga0126378_122434691 | 3300010361 | Tropical Forest Soil | MKKPSQIEAQRAVRQLEEMAADENPAVQMVLPMAEMVGWLRQ |
| Ga0126381_1020619901 | 3300010376 | Tropical Forest Soil | MKKPYQIEAQRAVKQLEAIANDGNPAVQMVLPMAEMV |
| Ga0126381_1032836301 | 3300010376 | Tropical Forest Soil | MKKTYQIDAQRAVKQFEAMAAEGNPAVQMMLPMAEMVGWLRK |
| Ga0126383_102140041 | 3300010398 | Tropical Forest Soil | MKKPYQIESLRAVKQFEAMAAAGNPAVQMMLPMAEMV |
| Ga0126383_109247242 | 3300010398 | Tropical Forest Soil | MKKPYQIEAQRAVKQLEAMANDGNPAVQMMLPMAEMV |
| Ga0134121_119813612 | 3300010401 | Terrestrial Soil | MKKPYQIESQRAVKQLEMMAADGNPAVQMVLPLAEMVGWLRK |
| Ga0137379_115122661 | 3300012209 | Vadose Zone Soil | MKKPYQIEAQRAVKQLEAMATDGNPAVQMMLPMAEMMGWLRKGVGEL |
| Ga0137367_111540012 | 3300012353 | Vadose Zone Soil | MKKPYQIESQHAVKRLERMAAEGNPAVQMILPMTEM |
| Ga0137368_105433411 | 3300012358 | Vadose Zone Soil | MKKPYQIESQRAVKQLAEMAADGNPSVQMVLPLAEMVGWLRKGVGELIRQ |
| Ga0137373_108767081 | 3300012532 | Vadose Zone Soil | MKKPYQIEAQRAVRQLEEMATDGNPAVQMVLPMAEMVGWLRQGVGALIRQA |
| Ga0157282_102311272 | 3300012904 | Soil | MKKPYQIEAQRAVKQLEAMATDGNPAVQMMLPMAEMVSWLRKGVGELVRQAG |
| Ga0137395_100228505 | 3300012917 | Vadose Zone Soil | MKKPYQIESQRAVKRLEEMAAEGNPAVQLVLPMAEMVGWLRQAWEN* |
| Ga0137395_108080641 | 3300012917 | Vadose Zone Soil | MKKPYQIESQRAVRRLEEMAADGNPAVQMVLPLAEM |
| Ga0137404_119675692 | 3300012929 | Vadose Zone Soil | MKKPYQIEAQRAVKRLEEMAADGNPAVQMMLPMAEMVGWLRKGVGELIRQAG |
| Ga0164301_111347091 | 3300012960 | Soil | MNKPYQIDAQRAVRQFEAMAAEGNPAVQMVLPMAET |
| Ga0164301_116574711 | 3300012960 | Soil | MKKPYQIESQRAVKQLEAMAAKGNPAVQMVLPMAEMVGWLRKGVGELIRQA |
| Ga0163200_11017261 | 3300013088 | Freshwater | MKKPYQIEAQRAVKQLEEMAADGNPAVQMMLLMAEMLGGCIRA* |
| Ga0157372_117070501 | 3300013307 | Corn Rhizosphere | MKKPYQIEAQRAIKQLDAMAANGDPAVQMMLPMAEMVGWLRKGVGELIR |
| Ga0181530_100130584 | 3300014159 | Bog | MKKPYHIEAQRAVKQLEAMAAEGNPAVQMVLPMAEMVGWLRKGVGEL |
| Ga0182012_101109473 | 3300014499 | Bog | MKKPYQIESQRAVKQLAEMAADGNPAVQMMLPLAEMIGWLRKVSEN* |
| Ga0182024_100046272 | 3300014501 | Permafrost | MKKPYQIESQRAVKQFEAMAADGNPAVQMVLPMAEMVGWLRKGVGVLHGL* |
| Ga0182024_103694841 | 3300014501 | Permafrost | MKKPYQIESQRAVKELEAMAADGNPAVQMVLPMAEM |
| Ga0182024_109624152 | 3300014501 | Permafrost | MKKPYQIEAQRAIKQLDAMAADGNPAVQMMLPLAEMVGWLRKGV |
| Ga0181522_100564501 | 3300014657 | Bog | MKKPYQIEAQRAVKQLEGMAAEGNPAVQMVLPMAEMVGWLRKGVGE |
| Ga0137414_11650114 | 3300015051 | Vadose Zone Soil | MKKPYQIESLRAVKRLEEMAADGNPAVQMMLPMAEMIGWLHEGVGN* |
| Ga0163144_112060301 | 3300015360 | Freshwater Microbial Mat | MKKPYQIESQRAVKRLEELAGEGRSVQMELPLAEMVGWLRQGVGE |
| Ga0132255_1049761931 | 3300015374 | Arabidopsis Rhizosphere | MKKPYQIEAQRAVKQLEAMAADGNPAVQMMLPMAEMVGWLRKG |
| Ga0181513_11387641 | 3300016700 | Peatland | MKKPYQIEAQRAVKQLAEMSADGNLAVQMVLPMAEMI |
| Ga0181515_11476721 | 3300016730 | Peatland | MKKPYQKESQRAVQQFDAMAAEGNPAVQMVPPMAEMVGLVA |
| Ga0187818_105439081 | 3300017823 | Freshwater Sediment | MKKPYQIEAQRAVKRFEAMAAEGNPAVQMMLPMAEMVGWLR |
| Ga0187854_102028201 | 3300017938 | Peatland | MKKPYQIEAQRAVRQLEEMAADGNPAVQMVLPMAE |
| Ga0187785_106264181 | 3300017947 | Tropical Peatland | MKKPYQIESQRAVKQFAEMAADGNPSVQMVLPLAARG |
| Ga0187776_104630601 | 3300017966 | Tropical Peatland | MKKPYQIEAQRAVKQFEAMAADGNPAVHMVLPLAEMVGWLRKGVGE |
| Ga0187783_109197511 | 3300017970 | Tropical Peatland | MKKPYQIESQRAVKRLERMAAEGNPAVQLVLPLAETLGWLRRVWVSFKRA |
| Ga0187781_104804461 | 3300017972 | Tropical Peatland | MQKPYRIESQRAVRRLERMAAEGNRAVQLVLPLAETLGWLRWGG |
| Ga0187864_104731152 | 3300018022 | Peatland | MKKPYQIEAQRAVRQFEAMAADGNPAVQMVLPMAEMVGWLRKGVGELIRQA |
| Ga0187885_101132811 | 3300018025 | Peatland | MKKPYQIEAQRAVRQLEEMAADGNPAVQMVLPMAEMVGWLHKGVGELIR |
| Ga0187857_103332453 | 3300018026 | Peatland | MKKPYQIEAQRAVKQFEAMAADGNPAVQMVLPMAEMIGWLRKGVGELIRQAG |
| Ga0187867_104932131 | 3300018033 | Peatland | MKKPYQIEAQRAVKQLEAMAAEGNPAVQMVLPMAEMVGGLRK |
| Ga0066662_112401872 | 3300018468 | Grasslands Soil | MKKPYQIDAERAVQQLEQMAADGNPAVQMMLPMAEMVGWL |
| Ga0066669_105136983 | 3300018482 | Grasslands Soil | MKKPYQIETQRAVKQFEAMAAEGNPAVQMVLPMAEM |
| Ga0182028_12899342 | 3300019788 | Fen | MKKPYQIEAQRAVKQFEAMAAEGYPAVQMVLPMAEMGGLVCGRAWAS |
| Ga0213875_101505763 | 3300021388 | Plant Roots | MKKPYQIEAQRAVKQFEAMTADGNPAVQMVLPRAEMLAWLKAWAN |
| Ga0213875_104153312 | 3300021388 | Plant Roots | MKKPYQIESQRAVKRVEGMAAEGNPVVQMVLPMAEMLGWLREGVGELVRQ |
| Ga0210394_117455851 | 3300021420 | Soil | MKKPYQIESQRAVKRLEEMAADGNPAVQLVLPMAEALGWLKQGVGELIRQA |
| Ga0126371_126366752 | 3300021560 | Tropical Forest Soil | MKKPYQIESQRAVKQLEAMAAEGSPAVQMVLPLAEMIGWL |
| Ga0207707_114427571 | 3300025912 | Corn Rhizosphere | MKKPYQIEAQRAVKQFEAMAADGNPAVQMMLPVAEMV |
| Ga0207649_104444902 | 3300025920 | Corn Rhizosphere | MRKPYQIESQRAVKRLEEMVADGNPAVQMVLPMAEMVGWLREGVGE |
| Ga0207670_116365522 | 3300025936 | Switchgrass Rhizosphere | MKKPYQIESQRAVKQLEMMAADGNPAVQMVLPLAEMVGWL |
| Ga0207661_106415491 | 3300025944 | Corn Rhizosphere | MKKPYQIQSQRAVKQLETMAADGNAAVQMVLPLAE |
| Ga0207651_110489942 | 3300025960 | Switchgrass Rhizosphere | MRKPYQIEAQRAVKQFEAMAADGNPAVQMMLPVAEMVGWLRKG |
| Ga0207712_112497631 | 3300025961 | Switchgrass Rhizosphere | MKKPYQIESQRAVKQLEAMAADGNPVVQMVLPLAEMVGWLRKGVGELICQA |
| Ga0209470_13352761 | 3300026324 | Soil | MKKPYQIESQRAVKRLEEMVADGSPAVQMVLPMAEMVGWLREGVGELIRRAGL |
| Ga0209801_12736131 | 3300026326 | Soil | MKKPYQIEAQRAVKELAEMAADGNPSVQMVLPMAEMIG |
| Ga0257160_10363211 | 3300026489 | Soil | MKKPYQIEAQRAVKQLEAMAADGNPAVQMVLPMAEMMGWLR |
| Ga0207855_10051521 | 3300027039 | Tropical Forest Soil | MKKPYQIQAQRAVNQLEGMAAEGNPAVQMVLPMAEL |
| Ga0208995_10825372 | 3300027388 | Forest Soil | MKKPYQIEAQRAVKQFEAMAADGNPAVQMLLPMAEMVGWLRSVRGRKGKR |
| Ga0209525_11228351 | 3300027575 | Forest Soil | MKKPYQIEAQRAIKQLDAMAADGNPAVQMMLPLAEMVGWLRKGVGELIRQA |
| Ga0209796_100613222 | 3300027766 | Agave | MKKPYQIESQRAVKRLEEMVADGNPAVQMVLPMAEMVGWLREGVGELI |
| Ga0209177_103326862 | 3300027775 | Agricultural Soil | MKKPYQIEAQRAVRQLEAMAADENPAVQMVLPMAEMVGWL |
| Ga0209180_104757272 | 3300027846 | Vadose Zone Soil | MKKPYQIEAQRAVRQLEEMAADGNPAVQMVLPMAEMVGWLRQGVGA |
| Ga0209517_100853273 | 3300027854 | Peatlands Soil | MKKTYQIEAQRAVKQFEAMAANGNPAVQLALPLAEAMGWLRKSVGELI |
| Ga0209517_102573323 | 3300027854 | Peatlands Soil | MKKPYQIESQQAVKRLERMAAEGNPCVQLVLPMAETLG |
| Ga0209068_107504572 | 3300027894 | Watersheds | MKKRYQIESSRAVKRMEEMAADGNPVVQIVLPMAEMIGLLHK |
| Ga0209698_112455591 | 3300027911 | Watersheds | MKKPYQIESQRAVKQLAEMAADGNPAVQMMLPMAEMIGWLRKGV |
| Ga0302222_100137211 | 3300028798 | Palsa | MKKPYQIESQRAVKELEAMAADGNPAVQMVLPMAE |
| Ga0311368_104969281 | 3300029882 | Palsa | MRKPYQIETQRAVKQLEAMAADGDPAVQMVLPMAEMVGWLRKG |
| Ga0247028_10688511 | 3300029894 | Cryconite | MKKTYQIESLRAVKRLEETAAAGNPSVQMLLLQVR |
| Ga0311352_103398831 | 3300029944 | Palsa | MKKPYQIETQRAVKQLEAMAADGNPAVQMVLPMAEMVGWLRKGVGELIRQAG |
| Ga0311352_109826831 | 3300029944 | Palsa | MKKPYQIGSQRAVKELEAMAADGNPAVQMALPMAEMVGW |
| Ga0311371_103089605 | 3300029951 | Palsa | MKKPYQIESQRAVKELEAMAADGNPAVQMVLPMAEMVGWLR |
| Ga0311339_100363843 | 3300029999 | Palsa | EKRRVAMKKPYQIEAQRAVKQLEGMAAEGNPAVQMVLPMADR |
| Ga0311339_119532822 | 3300029999 | Palsa | MKKPYQIESQRAVKRLEEMAAEGNPTVQMVLPMAEMIGWLRKGVGELIRQA |
| Ga0311338_1000624420 | 3300030007 | Palsa | MKKPYQIEAQRAVKQLEGMAAEGNPAVQMVLPMAEMVGWLRK |
| Ga0299906_109732201 | 3300030606 | Soil | MKKPYQIEAQRAVRQLEAMAAEGNPAVQMVLPMAEMVGWLREGVG |
| Ga0170834_1002944081 | 3300031057 | Forest Soil | MKKPYQIEAQRAVRQLEEMAADGDPAVQMVLPMAEMVGWLRQGVGALIRQA |
| Ga0302324_1016976942 | 3300031236 | Palsa | MKKPYQIETQRAVKQLEAMAADGDPAVQMVLPMAEMVGWLRKGVGELIRQ |
| Ga0302324_1026135522 | 3300031236 | Palsa | MKRPYQIESQRAVRQLEKMAADGSPAEQMVLPLAE |
| Ga0170819_134970971 | 3300031469 | Forest Soil | MKKPYQIEAQRAVKQLEAMANDGNPVVQMMLPMAEMVGWLRKGV |
| Ga0170818_1094856051 | 3300031474 | Forest Soil | MKKPYQIVSQRAVKQLAEMAADGNPAVQMMLPMAEMIGWLRK |
| Ga0311364_118643712 | 3300031521 | Fen | MKKPYQIEAQRAVKQFEAMAAEGNPAVQMVLPMAEMVGWLRK |
| Ga0302326_100994438 | 3300031525 | Palsa | MKKPYQIEAQRAVKQLEGMAAEGNPAVQMVLPMAEMV |
| Ga0247727_105800532 | 3300031576 | Biofilm | MKKLYQIESHRAVKRLERMAADGNRAVQLVLPMAEMVG |
| Ga0310686_1093234081 | 3300031708 | Soil | MKKPYQIESLRAVKRLEEMAVDGNPAVQMVLPLAEM |
| Ga0310686_1193921441 | 3300031708 | Soil | MKKPYQIESQRAVKRLEEMAAEGNPTVQMVLPMAEMIGWLRQGVG |
| Ga0307474_101441091 | 3300031718 | Hardwood Forest Soil | MKKPYQIEAQRAVKQLEAMAADGNPAVQMVLPMAEMMGW |
| Ga0307472_1004774172 | 3300032205 | Hardwood Forest Soil | SPNRTATCPLKKPYQIESQRAVKRLEEMAGEGNPAVQLVLPMAEALGWLKQDAG |
| Ga0335082_102978233 | 3300032782 | Soil | MKKPYQIEAQRAVKRLEEKTTDGSSAVQMILPKAEMLGWLRK |
| Ga0335079_122842902 | 3300032783 | Soil | MKKPYQIEAQRAVKQFEAMATDGNPAVQLVLPLAEMVGWLRKGVGELVRQAG |
| Ga0335078_114428891 | 3300032805 | Soil | MKKPYQIEAQRAVSKLEAMAADGNPAVQMVLPMAEMVGW |
| Ga0335078_124604802 | 3300032805 | Soil | MRKPYQIEAQRAVRQLEEMAADGNPAVQMVLPMAEMVGWLRQGVGCRPQKETRR |
| Ga0335081_102535681 | 3300032892 | Soil | MKKPYQIVSQRAVKRLERMAAEGNPAVQLVLPLAETLGWL |
| Ga0335083_113963071 | 3300032954 | Soil | MKKPHQIDSQRAVKQLETMAADGNPAVQMVLPMAEMLGWLHKGVGELSRLTL |
| Ga0335073_103649423 | 3300033134 | Soil | MKKPYQIESQRAVKQFQAMAAEGNPAVQMMLPMAGIIRWLRT |
| Ga0307507_107051301 | 3300033179 | Ectomycorrhiza | MKKPYQIEAQRAVKRLEEMAAEGNPAVQMVLPMAEMVG |
| ⦗Top⦘ |