


| Basic Information | |
|---|---|
| Family ID | F072876 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEMSKQSYNETLSMPVKRFYNYLKWKSDLEEEKQKMILEEVGK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.11 % |
| % of genes near scaffold ends (potentially truncated) | 15.70 % |
| % of genes from short scaffolds (< 2000 bps) | 47.93 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.298 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (14.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.661 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (23.140 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF04965 | GPW_gp25 | 45.45 |
| PF10983 | DUF2793 | 8.26 |
| PF04984 | Phage_sheath_1 | 3.31 |
| PF04055 | Radical_SAM | 3.31 |
| PF10127 | RlaP | 2.48 |
| PF07460 | NUMOD3 | 1.65 |
| PF02649 | GCHY-1 | 0.83 |
| PF13240 | zinc_ribbon_2 | 0.83 |
| PF01653 | DNA_ligase_aden | 0.83 |
| PF07963 | N_methyl | 0.83 |
| PF03237 | Terminase_6N | 0.83 |
| PF13353 | Fer4_12 | 0.83 |
| PF01743 | PolyA_pol | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 3.31 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.83 |
| COG0617 | tRNA nucleotidyltransferase/poly(A) polymerase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.74 % |
| Unclassified | root | N/A | 8.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001390|SMAR1_102086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 2026 | Open in IMG/M |
| 3300001533|MLSed_10005100 | All Organisms → cellular organisms → Bacteria | 21655 | Open in IMG/M |
| 3300001751|JGI2172J19969_10004796 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 5940 | Open in IMG/M |
| 3300002180|JGI24724J26744_10016713 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300003991|Ga0055461_10137065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 637 | Open in IMG/M |
| 3300004027|Ga0055459_10228848 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004050|Ga0055491_10000294 | All Organisms → cellular organisms → Bacteria | 5209 | Open in IMG/M |
| 3300004050|Ga0055491_10003100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 2487 | Open in IMG/M |
| 3300004073|Ga0055516_10068941 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300004146|Ga0055495_10128113 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005265|Ga0073580_100354 | Not Available | 24642 | Open in IMG/M |
| 3300005590|Ga0070727_10046636 | All Organisms → Viruses → Predicted Viral | 2626 | Open in IMG/M |
| 3300005600|Ga0070726_10068754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 1918 | Open in IMG/M |
| 3300005600|Ga0070726_10609946 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005645|Ga0077109_1028677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 2143 | Open in IMG/M |
| 3300005821|Ga0078746_1061369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 827 | Open in IMG/M |
| 3300005917|Ga0075115_10094505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 1090 | Open in IMG/M |
| 3300005918|Ga0075116_10020265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 2862 | Open in IMG/M |
| 3300007764|Ga0102950_1000091 | All Organisms → cellular organisms → Bacteria | 21222 | Open in IMG/M |
| 3300007776|Ga0105674_1291824 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
| 3300007871|Ga0111032_1087877 | All Organisms → cellular organisms → Bacteria | 7296 | Open in IMG/M |
| 3300008516|Ga0111033_1291555 | All Organisms → cellular organisms → Bacteria | 23546 | Open in IMG/M |
| 3300008517|Ga0111034_1075212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 1409 | Open in IMG/M |
| 3300008517|Ga0111034_1260177 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
| 3300009082|Ga0105099_10495291 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009149|Ga0114918_10000716 | Not Available | 29009 | Open in IMG/M |
| 3300009149|Ga0114918_10018300 | All Organisms → cellular organisms → Bacteria | 5329 | Open in IMG/M |
| 3300009149|Ga0114918_10041875 | All Organisms → cellular organisms → Bacteria | 3154 | Open in IMG/M |
| 3300009488|Ga0114925_10000061 | All Organisms → cellular organisms → Bacteria | 35279 | Open in IMG/M |
| 3300009488|Ga0114925_11317389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 533 | Open in IMG/M |
| 3300009488|Ga0114925_11449492 | Not Available | 509 | Open in IMG/M |
| 3300009788|Ga0114923_10014236 | All Organisms → cellular organisms → Bacteria | 5342 | Open in IMG/M |
| 3300010392|Ga0118731_107861219 | All Organisms → cellular organisms → Bacteria | 9247 | Open in IMG/M |
| 3300010392|Ga0118731_113492928 | All Organisms → cellular organisms → Bacteria | 16308 | Open in IMG/M |
| 3300010413|Ga0136851_11100427 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300011118|Ga0114922_10009582 | All Organisms → cellular organisms → Bacteria | 8817 | Open in IMG/M |
| 3300011118|Ga0114922_10067951 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
| 3300011118|Ga0114922_10187693 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300011118|Ga0114922_10229735 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300013099|Ga0164315_10090100 | All Organisms → Viruses → Predicted Viral | 2473 | Open in IMG/M |
| 3300013099|Ga0164315_10369650 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300013101|Ga0164313_10043242 | All Organisms → cellular organisms → Bacteria | 3797 | Open in IMG/M |
| 3300013101|Ga0164313_10109805 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
| 3300013103|Ga0164318_10675825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 874 | Open in IMG/M |
| 3300014903|Ga0164321_10001542 | All Organisms → cellular organisms → Bacteria | 5311 | Open in IMG/M |
| 3300014913|Ga0164310_10407657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 799 | Open in IMG/M |
| 3300017963|Ga0180437_10000970 | Not Available | 50843 | Open in IMG/M |
| 3300017963|Ga0180437_10243611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 1391 | Open in IMG/M |
| 3300017971|Ga0180438_11369605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 505 | Open in IMG/M |
| 3300017987|Ga0180431_10000031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 179738 | Open in IMG/M |
| 3300017987|Ga0180431_10009996 | All Organisms → cellular organisms → Bacteria | 10611 | Open in IMG/M |
| 3300017987|Ga0180431_10021446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 6546 | Open in IMG/M |
| 3300017989|Ga0180432_10057826 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
| 3300017989|Ga0180432_10143552 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300017991|Ga0180434_10166238 | All Organisms → Viruses → Predicted Viral | 1787 | Open in IMG/M |
| 3300017991|Ga0180434_10206309 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300017991|Ga0180434_10469663 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300018080|Ga0180433_10666463 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300021511|Ga0190284_1000269 | All Organisms → cellular organisms → Bacteria | 34769 | Open in IMG/M |
| 3300021511|Ga0190284_1005637 | All Organisms → cellular organisms → Bacteria | 4128 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10221611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 643 | Open in IMG/M |
| (restricted) 3300023086|Ga0233407_10012208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 918 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10042700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 794 | Open in IMG/M |
| 3300024262|Ga0210003_1003696 | All Organisms → cellular organisms → Bacteria | 12341 | Open in IMG/M |
| 3300024262|Ga0210003_1072834 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300024262|Ga0210003_1239049 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300024265|Ga0209976_10062565 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10227299 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300024432|Ga0209977_10000594 | All Organisms → cellular organisms → Bacteria | 14508 | Open in IMG/M |
| 3300024432|Ga0209977_10000596 | All Organisms → cellular organisms → Bacteria | 14498 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10179840 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10204558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 897 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10247250 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10090722 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10294736 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300025661|Ga0208905_1005634 | All Organisms → cellular organisms → Bacteria | 5548 | Open in IMG/M |
| 3300025790|Ga0210075_1000600 | Not Available | 7032 | Open in IMG/M |
| 3300025950|Ga0210134_1000979 | All Organisms → cellular organisms → Bacteria | 4233 | Open in IMG/M |
| 3300025950|Ga0210134_1004874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 1985 | Open in IMG/M |
| 3300025969|Ga0210080_1044669 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026064|Ga0208146_1035537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 517 | Open in IMG/M |
| 3300026122|Ga0209926_1025256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 1044 | Open in IMG/M |
| 3300027726|Ga0209285_10049776 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300027814|Ga0209742_10205950 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300027852|Ga0209345_10026997 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
| 3300027852|Ga0209345_10401951 | Not Available | 807 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10000328 | All Organisms → cellular organisms → Bacteria | 28365 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10347659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 705 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10381291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 673 | Open in IMG/M |
| 3300027888|Ga0209635_10000122 | All Organisms → cellular organisms → Bacteria | 45542 | Open in IMG/M |
| 3300027917|Ga0209536_100046647 | All Organisms → cellular organisms → Bacteria | 5720 | Open in IMG/M |
| 3300028169|Ga0268279_1055011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 1174 | Open in IMG/M |
| 3300028595|Ga0272440_1088244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 1142 | Open in IMG/M |
| 3300028920|Ga0272441_10151952 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300028920|Ga0272441_11095938 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300029827|Ga0134606_10001969 | All Organisms → cellular organisms → Bacteria | 8902 | Open in IMG/M |
| 3300031256|Ga0315556_1002769 | All Organisms → cellular organisms → Bacteria | 9864 | Open in IMG/M |
| 3300031280|Ga0307428_1058403 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300031379|Ga0307434_1211498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 509 | Open in IMG/M |
| 3300031539|Ga0307380_10000037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 227820 | Open in IMG/M |
| 3300031539|Ga0307380_10008040 | All Organisms → cellular organisms → Bacteria | 13592 | Open in IMG/M |
| 3300031539|Ga0307380_10008181 | All Organisms → cellular organisms → Bacteria | 13445 | Open in IMG/M |
| 3300031539|Ga0307380_10010268 | All Organisms → cellular organisms → Bacteria | 11809 | Open in IMG/M |
| 3300031539|Ga0307380_10013407 | All Organisms → cellular organisms → Bacteria | 10127 | Open in IMG/M |
| 3300031539|Ga0307380_10324929 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300031578|Ga0307376_10000826 | All Organisms → cellular organisms → Bacteria | 36378 | Open in IMG/M |
| 3300031578|Ga0307376_10039165 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
| 3300031578|Ga0307376_10233502 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300031601|Ga0307992_1002982 | All Organisms → cellular organisms → Bacteria | 9484 | Open in IMG/M |
| 3300031601|Ga0307992_1236987 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031654|Ga0315549_1000525 | All Organisms → cellular organisms → Bacteria | 44570 | Open in IMG/M |
| 3300031707|Ga0315291_10109223 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300031746|Ga0315293_10120195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 2213 | Open in IMG/M |
| 3300032053|Ga0315284_10046512 | All Organisms → cellular organisms → Bacteria | 5998 | Open in IMG/M |
| 3300032177|Ga0315276_10389344 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300032260|Ga0316192_10720631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 672 | Open in IMG/M |
| 3300032276|Ga0316188_10252208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 901 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 14.88% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 11.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 8.26% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 7.44% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 5.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.31% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 3.31% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 2.48% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.65% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.65% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.65% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.65% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 1.65% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.83% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.83% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.83% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.83% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.83% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 0.83% |
| Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.83% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.83% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001390 | SMAR1 | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
| 3300002180 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004073 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005265 | Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300007776 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007871 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf. Combined Assembly of MM2PM2 | Environmental | Open in IMG/M |
| 3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
| 3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300021511 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-1-2_MG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023086 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025661 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes) | Environmental | Open in IMG/M |
| 3300025790 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025969 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026064 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026122 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028169 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m | Environmental | Open in IMG/M |
| 3300028595 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17 | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031379 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SMAR1_1020864 | 3300001390 | Hydrothermal Vents | MELSKQSYLQILEMPIQRFYNYLKWKTELEEEKRKLMEEKTSNG* |
| MLSed_1000510024 | 3300001533 | Benthic | MEMSKQSYSDVTKMPVKKFYDYLKWKSDLEEEKRKMILEEVGK* |
| JGI2172J19969_100047963 | 3300001751 | Marine Sediment | MSGMSYSEIAAMPLKRFFDYLKWKTDLEDEKRKLVREESKKLR* |
| JGI24724J26744_100167132 | 3300002180 | Marine | MEMCKSAYTSVIEMPIKRFYNYLKWKINLEEDKKKMINEEMTKKG* |
| Ga0055461_101370652 | 3300003991 | Natural And Restored Wetlands | MELSNQSYPEVMSMPVKRLQNYLKWKGDLEEEKRKMISEEALKVRR* |
| Ga0055459_102288481 | 3300004027 | Natural And Restored Wetlands | MEMSKQSYDHVIKMPVKRFYNYLKWKSDLEEEKKTMLAEQVLSGLGKG |
| Ga0055491_100002944 | 3300004050 | Natural And Restored Wetlands | MEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIGKK* |
| Ga0055491_100031002 | 3300004050 | Natural And Restored Wetlands | MEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM* |
| Ga0055516_100689412 | 3300004073 | Natural And Restored Wetlands | MEMSKQSYSDVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKK* |
| Ga0055495_101281131 | 3300004146 | Natural And Restored Wetlands | MEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIG |
| Ga0073580_10035422 | 3300005265 | Sediment | MELSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG* |
| Ga0070727_100466363 | 3300005590 | Marine Sediment | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK* |
| Ga0070726_100687544 | 3300005600 | Marine Sediment | MSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK* |
| Ga0070726_106099462 | 3300005600 | Marine Sediment | MEMSKQSYPDTVSMPVKRLYDYLKWKTELEDEKQKL |
| Ga0077109_10286775 | 3300005645 | Brackish Water | MEMSKQSYIEVIMIPVKRFYNYLKWKSDLENEKQKQINEETSRR* |
| Ga0078746_10613691 | 3300005821 | Marine Sediment | MSYSEVAAMPVKKLFDYLKWKSDLEEEKRKIMKEEVKKLK* |
| Ga0075115_100945052 | 3300005917 | Saline Lake | MELSKQSYSETVMMPVKKFQDYLKWKSELEDSKQKQMQEQTERK* |
| Ga0075116_100202656 | 3300005918 | Saline Lake | FSCMELSKQSYFEIMFMPIKRFYDYLKWKSKLDEERAKQMEDL* |
| Ga0102950_10000914 | 3300007764 | Soil | MEMSKQGYSEVTLMPVKKFYDYLKWKTKLEEEKQKMILEHTGK* |
| Ga0105674_12918242 | 3300007776 | Diffuse Vent Fluid, Hydrothermal Vents | MEMSKQPYQNVVDMPINRFYNYLKWKTDLEEDKKKAIEEQIAQG* |
| Ga0111032_10878773 | 3300007871 | Marine Sediment | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKIMKEEVKKLK* |
| Ga0111033_129155515 | 3300008516 | Marine Sediment | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKMMKEEVKKLK* |
| Ga0111034_10752122 | 3300008517 | Marine Sediment | MEMSKQSYGDVMSMPVKRFQDYMKWKSDLEDEKQKMLVEGISKT* |
| Ga0111034_12601772 | 3300008517 | Marine Sediment | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKKLK* |
| Ga0105099_104952912 | 3300009082 | Freshwater Sediment | MEMSKQSYSEIMSMPVKRFYNYLKWKTDLEEEKRKMILEETTKK* |
| Ga0114918_1000071622 | 3300009149 | Deep Subsurface | MEMSKQSYVEVASMPVKRFFNYLKWKTDLEEERRKMMLEEVTR* |
| Ga0114918_100183008 | 3300009149 | Deep Subsurface | MELSKQPYGEVMLMPVKRFQNYMKWKNDLEDEKQKMILEEVNSK* |
| Ga0114918_100418754 | 3300009149 | Deep Subsurface | MEMSKQSYNQVMMMPIKKLKDYLKWKSNLEEEKQKLMEEQVSK* |
| Ga0114918_103646922 | 3300009149 | Deep Subsurface | MEMSKQSYVEVVNMPVKKFYDYLSWKIKLEEEKRKIMEEETGK* |
| Ga0114925_1000006144 | 3300009488 | Deep Subsurface | MEMSKQSYIETIMMPVKRFQDYLKWKSDLEDERKKMIQEETL* |
| Ga0114925_113173892 | 3300009488 | Deep Subsurface | MELSKQSYTETVLMPVKRFYDYLKWKSDLEEERRKIMEEKINQT* |
| Ga0114925_114494922 | 3300009488 | Deep Subsurface | MEMSKQSYLETTSMPVKKLQDYLKWKTDLESERKKVLEES* |
| Ga0114923_100142364 | 3300009788 | Deep Subsurface | MEMSKQSYPETMRMPVKRLYNYLQWKSDLEDEKQKLIEELGKN* |
| Ga0118731_1078612197 | 3300010392 | Marine | MEMSKSTYQGVVEMPIKRFYNYLKWKTDLEEDKKKMIEEEIGR* |
| Ga0118731_11349292817 | 3300010392 | Marine | MEMSKQSYPDTVSMPVKRLYDYLKWKTELEDEKQKLIEEVTKQ* |
| Ga0136851_111004272 | 3300010413 | Mangrove Sediment | MEMSKQSYIDTMMMPVKKFQNYLKWKNDLEEEKQKMILEEVGKRR* |
| Ga0114922_1000958210 | 3300011118 | Deep Subsurface | MEMSKQSYADVTKMPVKKFYDYLKWKSTLEEEKRKMMLEEIGKK* |
| Ga0114922_100679513 | 3300011118 | Deep Subsurface | MEMSKQSYRDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIKGG* |
| Ga0114922_101876932 | 3300011118 | Deep Subsurface | MEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG* |
| Ga0114922_102297353 | 3300011118 | Deep Subsurface | MEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIQGRK* |
| Ga0164315_100901004 | 3300013099 | Marine Sediment | MEMSNQSYIEVASMPVKRFFNYLKWKTDLEEERRKMMAEGIK* |
| Ga0164315_103696502 | 3300013099 | Marine Sediment | MEMSKQSYNEIMLMPVKRFSNYMRWKTNLEDEKQKMILEEVNIK* |
| Ga0164313_100432424 | 3300013101 | Marine Sediment | MEMSKQSYGEIVMMPVQRFYSYLKWKSDLEEEKKKMVTEEILSGLKG* |
| Ga0164313_101098054 | 3300013101 | Marine Sediment | MEMSKQGYQDVVDMPIKRFYNYLKWKSDLEEDKKKMIEEQIKGG* |
| Ga0164318_106758252 | 3300013103 | Marine Sediment | MEMSKQSYSEVMLMPVKRFQNYMRWKSDLEDEKQKMILEEVT* |
| Ga0164321_100015423 | 3300014903 | Marine Sediment | MEMSKQSYNETLSMPVKRFYNYLKWKSDLEEEKQKMILEEVGK* |
| Ga0164310_104076572 | 3300014913 | Marine Sediment | MEMSKQPYQNVVDMPVKRFYNYLKWKTDLEEDKKKAIEEQIAQG* |
| Ga0180437_1000097047 | 3300017963 | Hypersaline Lake Sediment | MEMSKQSYGETMLMPVKRFQDYLKWKTDLEDEKQKMLLEGAS |
| Ga0180437_102436111 | 3300017963 | Hypersaline Lake Sediment | SYPDVNMMPIKRFYNYLKWKTDLEEDKKKMVTEEISKRGK |
| Ga0180438_113696051 | 3300017971 | Hypersaline Lake Sediment | MSKQSYQAVVAMPVKRFYNYLKWKNDLEEEKKKMIEEEVGR |
| Ga0180431_1000003126 | 3300017987 | Hypersaline Lake Sediment | MEMSRQSYPEVMIMPIGKFHAYLKWKSDLEEEKQKMMEEEANK |
| Ga0180431_100099968 | 3300017987 | Hypersaline Lake Sediment | MEMSKQSYSDVMKMPVKKFYDYLKWKSDLEEEKRKMILEEVGKR |
| Ga0180431_100214464 | 3300017987 | Hypersaline Lake Sediment | MEMSKQSYQQVMMMPIYKFYAYIKWKSNLEEEKQKMMEEEANK |
| Ga0180432_100578264 | 3300017989 | Hypersaline Lake Sediment | MEMSKQSYNDTMLMPVKRFQDYLKWKTDLEDEKQKMLLEGSK |
| Ga0180432_101435523 | 3300017989 | Hypersaline Lake Sediment | MSRQSYSDVMKMPIKKLKDYIAWKTNLEEEKKKMMEEQGSK |
| Ga0180434_100041117 | 3300017991 | Hypersaline Lake Sediment | MEMSKTPYQSVTDMPIKRFYNYLKWKTDLEEDKKKMVAEEISKRG |
| Ga0180434_101662382 | 3300017991 | Hypersaline Lake Sediment | MSKQSYNETVLMPVNRFYNYLKWKTELEEEKRKMITEEISKKK |
| Ga0180434_102063093 | 3300017991 | Hypersaline Lake Sediment | MEFSKQGYIETVMMPVKKFYDYLKWKTTLEEERQKIMEEQTSQMKY |
| Ga0180434_104696632 | 3300017991 | Hypersaline Lake Sediment | MLESNIFACMEMSKQSYPDVNMMPIKRFYNYLKWKTDLEEDKKKM |
| Ga0180433_106664631 | 3300018080 | Hypersaline Lake Sediment | MELSRQSYNQVLSMPIQRFYDYLKWKNDLEEEKQKL |
| Ga0180433_109159411 | 3300018080 | Hypersaline Lake Sediment | MEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKTIDEEIAKR |
| Ga0190284_10002697 | 3300021511 | Hydrothermal Vent Microbial Mat | MEMSKQSYSDTMLMPVKRFQDYLKWKTDLEDEKQKMLLEGTS |
| Ga0190284_10056377 | 3300021511 | Hydrothermal Vent Microbial Mat | LEKNVFACMEMSKQSYRETMLMPVKRFYNYLKWKNDLEEEKQKMMLEEVSKK |
| (restricted) Ga0233409_102216112 | 3300022938 | Seawater | MEMSKQPYGDVMLMPVKRFQDYLKWKTDLEDEKQKMLLEGAS |
| (restricted) Ga0233407_100122083 | 3300023086 | Seawater | MELSSQSYPETMSMPVQRFYDYLKWKSDLEDEKQKLIKEKTTGDV |
| (restricted) Ga0233408_100427003 | 3300023089 | Seawater | SKQGYQDVVAMPIKRFYNYLKWKTDLEEDKKKMIEESIRGG |
| Ga0210003_100369613 | 3300024262 | Deep Subsurface | MEMSKQSYVEVASMPVKRFFNYLKWKTDLEEERRKMMLEEVTR |
| Ga0210003_10728342 | 3300024262 | Deep Subsurface | MELSKQPYGEVMLMPVKRFQNYMKWKNDLEDEKQKMILEEVNSK |
| Ga0210003_12390492 | 3300024262 | Deep Subsurface | MEMSKQSYNQVMMMPIKKLKDYLKWKSNLEEEKQKLMEEQVSK |
| Ga0209976_100625654 | 3300024265 | Deep Subsurface | MEMSKQSYPETMRMPVKRLYNYLQWKSDLEDEKQKLIEELGKN |
| (restricted) Ga0255042_102272991 | 3300024340 | Seawater | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEV |
| Ga0209977_1000059415 | 3300024432 | Deep Subsurface | KRVLTENIFGCMEMSKQSYPETMLMPVKKLQDYLKWKTDLESERKKVLEES |
| Ga0209977_1000059618 | 3300024432 | Deep Subsurface | MCMEMSKQSYIETIMMPVKRFQDYLKWKSDLEDERKKMIQEETL |
| (restricted) Ga0255046_101798402 | 3300024519 | Seawater | MSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEV |
| (restricted) Ga0255046_102045582 | 3300024519 | Seawater | MEMSKQGYQDVVAMPIKRFYNYLKWKTDLEEDKKKMIEESIRGG |
| (restricted) Ga0255046_102472502 | 3300024519 | Seawater | MEMSKQPYGDVMLMPVKRFQDYLKWKTDLEDEKQKMLLEGTS |
| (restricted) Ga0255045_100907221 | 3300024528 | Seawater | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEEEKRKLMKEEVKRLK |
| (restricted) Ga0255045_102947361 | 3300024528 | Seawater | MEMSKQSYQAVVDMPIKRFYNYLKWKTDLEDDKKKMI |
| Ga0208905_10056348 | 3300025661 | Lake Water | MELSKQSYSETVMMPVKKFQDYLKWKSELEDSKQKQMQEQTERK |
| Ga0210075_10006002 | 3300025790 | Natural And Restored Wetlands | MEMSKQSYDHVIKMPVKRFYNYLKWKSDLEEEKKTMLAEQVLSGLGKGYK |
| Ga0210134_10009792 | 3300025950 | Natural And Restored Wetlands | MEMSKQSYQEVTAMPIKKFYDYLKWKTDLEEEKQKMILEGIGKK |
| Ga0210134_10048744 | 3300025950 | Natural And Restored Wetlands | MEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM |
| Ga0210080_10446691 | 3300025969 | Natural And Restored Wetlands | MEMSKQSYSDVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKK |
| Ga0208146_10355371 | 3300026064 | Natural And Restored Wetlands | YTCMEMSKQSYDDVIQMPVQRFYNYLKWKSNLEEEKKKMLAENIISGLGGAM |
| Ga0209926_10252562 | 3300026122 | Soil | MEMSKQGYSEVTLMPVKKFYDYLKWKTKLEEEKQKMILEHTGK |
| Ga0209285_100497761 | 3300027726 | Freshwater Sediment | MMDMSHQSYPETMNMPVKAFYDYIKWKNDLEEKKQKTIQEM |
| Ga0209742_102059501 | 3300027814 | Marine Sediment | MEIGKQSYTDVMQMPIKRLYNYLKWKSDLEDEKQKLIEEVTKK |
| Ga0209345_100269974 | 3300027852 | Marine | MEMCKSAYTSVIEMPIKRFYNYLKWKINLEEDKKKMINEEMTKKG |
| Ga0209345_104019512 | 3300027852 | Marine | MSKQSYDQVIAMPIKRFYNYLRWKSDLEDEKQKMILDEVGK |
| (restricted) Ga0255054_1000032814 | 3300027856 | Seawater | MEMSGMSYSEVAAMPVKKLFDYLKWKSDLEDEKRKLMKEEVKRLK |
| (restricted) Ga0233415_103476592 | 3300027861 | Seawater | MEMSKQSWVDIVEMPVQRLYGYMKWKDKLEEEKQKLMEEEASKAG |
| (restricted) Ga0233415_103812912 | 3300027861 | Seawater | MEMSKQSYVETVMMPIKKFSDYLKWKSDLENEKNKLMHEETT |
| Ga0209635_1000012237 | 3300027888 | Marine Sediment | MSGMSYSEIAAMPLKRFFDYLKWKTDLEDEKRKLVREESKKLR |
| Ga0209536_1000466474 | 3300027917 | Marine Sediment | MGKQNYLDVISMPVKRMHNYLKWKSELEEEKQKLIEEVAK |
| Ga0268279_10550113 | 3300028169 | Saline Water | LEEDIFSCMELSKQSYIEITLMPVNRFYNYLKWKSSLEIEKEKMIEEGIKK |
| Ga0272440_10882442 | 3300028595 | Marine Sediment | MEMSKQSYPETMEMPVSRFYNYLKWKTDLEEEKRKMILEEVSGK |
| Ga0272441_101519523 | 3300028920 | Marine Sediment | MEMSKQSYKDIVSMPVQRFYSYLKWKSDLEEEKKKMMTEEILSGLK |
| Ga0272441_110959382 | 3300028920 | Marine Sediment | MEMSKQSYIDTMLMPVKRFQDYLKWKNDLEEEKQKLILEEVSKKR |
| Ga0134606_100019698 | 3300029827 | Marine Sediment | MEMSGQSYSEIAAMPIKKFYDYLKWKSDLEDEKRKLMREEVTKLKK |
| Ga0315556_10027693 | 3300031256 | Salt Marsh Sediment | MEMSKQGYSEVTLMPVNKFYDYLKWKTKLEEEKQKMILEHTGK |
| Ga0307428_10584032 | 3300031280 | Salt Marsh | MEMSKQSYHETMLMPVKRFQDYMKWKSDLEDEKQRLILEEVGKRKNG |
| Ga0307434_12114981 | 3300031379 | Salt Marsh | MEMSKQSYHETMLMPVKRFQDYMKWKSDLEDEKQRLILEEVGKRNNG |
| Ga0307380_1000003738 | 3300031539 | Soil | MEMSKQSYVDIVAMPVQRFYSYLKWKSDLEEEKKKIITEEIVSGLKS |
| Ga0307380_1000804010 | 3300031539 | Soil | MEMSKQSYDQVIQMPVKRFYSYLKWKSDLEEEKKKLVVEEILGGMGG |
| Ga0307380_100081815 | 3300031539 | Soil | MEMSRQSYIEVTSMPVKRFFNYLKWKTDLEEERRKMMLEGISK |
| Ga0307380_100102687 | 3300031539 | Soil | MEMSKQAYTEVMAMPVKRFQDYMKWKTDLEEEKQKMLLEGVGKKR |
| Ga0307380_1001340712 | 3300031539 | Soil | MEMSKQAYTDIMAMPVKRFQDYMKWKTDLEDDKQKMLLEGVNKKR |
| Ga0307380_101962652 | 3300031539 | Soil | MELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIDEQIMKRSGR |
| Ga0307380_103249293 | 3300031539 | Soil | MEMSKQSYPQIVAMPVKRFYNYLKWKTDLEDEKRKLILEEVGK |
| Ga0307376_1000082610 | 3300031578 | Soil | MELSKQSYSDIMLMPVKRFQDYLKWKTDLEEEKQKMLLEGSK |
| Ga0307376_100391652 | 3300031578 | Soil | MELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIMKGTGRR |
| Ga0307376_102335023 | 3300031578 | Soil | MELSKQGYQDVVDMPIKRFYNYLKWKTDLEDDKKKMIEEQIMKGSGRR |
| Ga0307992_10029826 | 3300031601 | Marine | MEMSKQSYSDVMLMPVKRFQNYMKWKNNLEDEKQKLILEEVKS |
| Ga0307992_12369872 | 3300031601 | Marine | MEMSKQSYSDVMLMPVKRFENYMKWKNDIEDEKEKMILEGISS |
| Ga0315549_100052518 | 3300031654 | Salt Marsh Sediment | MCMEMSRQSYIETIMMPVKRFQDYLKWKSELEEERRKMIREESSK |
| Ga0315291_101092233 | 3300031707 | Sediment | MEMSKQSYFEVSLMPVQRFHEYMKWKTRLEEEKSKMLQEVTKK |
| Ga0315293_101201952 | 3300031746 | Sediment | MEMSKQSYHDICYMPVQRFHNYMKWKTKLEEEKAKMLQEVTKK |
| Ga0315284_100465124 | 3300032053 | Sediment | MEMSKQSYHDICCMPVQRFHNYMKWKTRLEEEKAKMLKEVTKK |
| Ga0315276_103893443 | 3300032177 | Sediment | MEMSKQSYFEVSLIPVQRFHEYMKWKTRLEEEKSKMLQEVTKK |
| Ga0316192_107206311 | 3300032260 | Worm Burrow | QLEKNIFSCMEMSKQSYIEIISMPVQRFYSYLKWKSDLEDEKKKMVTEEILSGLKGA |
| Ga0316188_102522081 | 3300032276 | Worm Burrow | MEMSKQGYQDVVDMPIKRFYNYLKWKTDLEEDKKKMIEEQIKGG |
| ⦗Top⦘ |