


| Basic Information | |
|---|---|
| Family ID | F072860 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSAQARKIVHEAIPQWAEGLYYNKGLFSEALVYYDDEAI |
| Number of Associated Samples | 37 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.44 % |
| % of genes near scaffold ends (potentially truncated) | 67.77 % |
| % of genes from short scaffolds (< 2000 bps) | 89.26 % |
| Associated GOLD sequencing projects | 35 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.198 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (66.116 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.116 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (68.595 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01966 | HD | 10.74 |
| PF00990 | GGDEF | 9.09 |
| PF00436 | SSB | 3.31 |
| PF00353 | HemolysinCabind | 2.48 |
| PF07676 | PD40 | 1.65 |
| PF11387 | DUF2795 | 1.65 |
| PF09954 | DUF2188 | 1.65 |
| PF00989 | PAS | 0.83 |
| PF05532 | CsbD | 0.83 |
| PF06441 | EHN | 0.83 |
| PF03816 | LytR_cpsA_psr | 0.83 |
| PF12680 | SnoaL_2 | 0.83 |
| PF16472 | DUF5050 | 0.83 |
| PF07228 | SpoIIE | 0.83 |
| PF00571 | CBS | 0.83 |
| PF13612 | DDE_Tnp_1_3 | 0.83 |
| PF01609 | DDE_Tnp_1 | 0.83 |
| PF00589 | Phage_integrase | 0.83 |
| PF01565 | FAD_binding_4 | 0.83 |
| PF07995 | GSDH | 0.83 |
| PF13508 | Acetyltransf_7 | 0.83 |
| PF08734 | GYD | 0.83 |
| PF13231 | PMT_2 | 0.83 |
| PF14224 | DUF4331 | 0.83 |
| PF07366 | SnoaL | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 3.31 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 3.31 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.83 |
| COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.83 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.83 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.83 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.83 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.02 % |
| Unclassified | root | N/A | 42.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_105018107 | Not Available | 741 | Open in IMG/M |
| 3300004016|Ga0058689_10185584 | Not Available | 501 | Open in IMG/M |
| 3300005562|Ga0058697_10254689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 819 | Open in IMG/M |
| 3300005562|Ga0058697_10616039 | Not Available | 569 | Open in IMG/M |
| 3300005562|Ga0058697_10804009 | Not Available | 509 | Open in IMG/M |
| 3300006918|Ga0079216_11461958 | Not Available | 569 | Open in IMG/M |
| 3300007790|Ga0105679_10243711 | Not Available | 1052 | Open in IMG/M |
| 3300007790|Ga0105679_10731054 | All Organisms → cellular organisms → Bacteria → Dictyoglomi → Dictyoglomia → Dictyoglomales → Dictyoglomaceae → Dictyoglomus | 1041 | Open in IMG/M |
| 3300007790|Ga0105679_10735408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2187 | Open in IMG/M |
| 3300009789|Ga0126307_10045409 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
| 3300009789|Ga0126307_10150578 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300009789|Ga0126307_10204752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1583 | Open in IMG/M |
| 3300009789|Ga0126307_10218977 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300009789|Ga0126307_10231460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1485 | Open in IMG/M |
| 3300009789|Ga0126307_10244481 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300009789|Ga0126307_10251056 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300009789|Ga0126307_10533982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 947 | Open in IMG/M |
| 3300009789|Ga0126307_10548158 | Not Available | 933 | Open in IMG/M |
| 3300009789|Ga0126307_10840577 | Not Available | 741 | Open in IMG/M |
| 3300009789|Ga0126307_11142806 | Not Available | 630 | Open in IMG/M |
| 3300009789|Ga0126307_11230346 | Not Available | 606 | Open in IMG/M |
| 3300009789|Ga0126307_11319568 | Not Available | 584 | Open in IMG/M |
| 3300009840|Ga0126313_10132600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1865 | Open in IMG/M |
| 3300009840|Ga0126313_11004149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 683 | Open in IMG/M |
| 3300009840|Ga0126313_11029689 | Not Available | 675 | Open in IMG/M |
| 3300009840|Ga0126313_11375814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 584 | Open in IMG/M |
| 3300009840|Ga0126313_11812725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 510 | Open in IMG/M |
| 3300010036|Ga0126305_10060780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
| 3300010036|Ga0126305_10078550 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300010036|Ga0126305_10108994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1675 | Open in IMG/M |
| 3300010036|Ga0126305_10374354 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300010036|Ga0126305_10421006 | Not Available | 883 | Open in IMG/M |
| 3300010036|Ga0126305_10841613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 625 | Open in IMG/M |
| 3300010036|Ga0126305_11216829 | Not Available | 520 | Open in IMG/M |
| 3300010037|Ga0126304_10025465 | All Organisms → cellular organisms → Bacteria | 3429 | Open in IMG/M |
| 3300010037|Ga0126304_10093896 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300010037|Ga0126304_10231976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1211 | Open in IMG/M |
| 3300010037|Ga0126304_10238742 | Not Available | 1194 | Open in IMG/M |
| 3300010037|Ga0126304_10291908 | Not Available | 1079 | Open in IMG/M |
| 3300010037|Ga0126304_10482162 | Not Available | 832 | Open in IMG/M |
| 3300010037|Ga0126304_10544346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 781 | Open in IMG/M |
| 3300010037|Ga0126304_10690967 | Not Available | 689 | Open in IMG/M |
| 3300010037|Ga0126304_11239335 | Not Available | 512 | Open in IMG/M |
| 3300010038|Ga0126315_10140015 | Not Available | 1424 | Open in IMG/M |
| 3300010038|Ga0126315_10171118 | Not Available | 1296 | Open in IMG/M |
| 3300010038|Ga0126315_10607180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 707 | Open in IMG/M |
| 3300010039|Ga0126309_10044641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2091 | Open in IMG/M |
| 3300010039|Ga0126309_10063867 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300010039|Ga0126309_10153963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 1238 | Open in IMG/M |
| 3300010039|Ga0126309_10362541 | Not Available | 857 | Open in IMG/M |
| 3300010039|Ga0126309_10709478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 647 | Open in IMG/M |
| 3300010040|Ga0126308_10037289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2756 | Open in IMG/M |
| 3300010040|Ga0126308_10103444 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300010040|Ga0126308_10111050 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300010040|Ga0126308_10308845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1041 | Open in IMG/M |
| 3300010040|Ga0126308_10415768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 899 | Open in IMG/M |
| 3300010040|Ga0126308_10558978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 777 | Open in IMG/M |
| 3300010040|Ga0126308_10698722 | Not Available | 697 | Open in IMG/M |
| 3300010040|Ga0126308_10711679 | Not Available | 691 | Open in IMG/M |
| 3300010040|Ga0126308_11077181 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010040|Ga0126308_11193676 | Not Available | 538 | Open in IMG/M |
| 3300010041|Ga0126312_10222043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1323 | Open in IMG/M |
| 3300010041|Ga0126312_10237433 | Not Available | 1279 | Open in IMG/M |
| 3300010041|Ga0126312_10360350 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300010041|Ga0126312_10690883 | Not Available | 736 | Open in IMG/M |
| 3300010041|Ga0126312_10884123 | Not Available | 651 | Open in IMG/M |
| 3300010041|Ga0126312_11209290 | Not Available | 557 | Open in IMG/M |
| 3300010042|Ga0126314_10109778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1884 | Open in IMG/M |
| 3300010042|Ga0126314_10616400 | Not Available | 792 | Open in IMG/M |
| 3300010042|Ga0126314_10667888 | Not Available | 760 | Open in IMG/M |
| 3300010044|Ga0126310_10232556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1233 | Open in IMG/M |
| 3300010044|Ga0126310_10278940 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300010044|Ga0126310_10349820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1036 | Open in IMG/M |
| 3300010045|Ga0126311_10021482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3838 | Open in IMG/M |
| 3300010045|Ga0126311_10185562 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300010045|Ga0126311_11019867 | Not Available | 677 | Open in IMG/M |
| 3300010166|Ga0126306_10084749 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300010166|Ga0126306_10122499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
| 3300010166|Ga0126306_10186381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1560 | Open in IMG/M |
| 3300010166|Ga0126306_10254220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1342 | Open in IMG/M |
| 3300010166|Ga0126306_10397293 | Not Available | 1078 | Open in IMG/M |
| 3300010166|Ga0126306_10443405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans | 1020 | Open in IMG/M |
| 3300010166|Ga0126306_10460054 | Not Available | 1002 | Open in IMG/M |
| 3300010166|Ga0126306_10780160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300010166|Ga0126306_11680417 | Not Available | 530 | Open in IMG/M |
| 3300014487|Ga0182000_10139800 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300018465|Ga0190269_10320245 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018465|Ga0190269_11920672 | Not Available | 511 | Open in IMG/M |
| 3300018466|Ga0190268_10297641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 966 | Open in IMG/M |
| 3300018466|Ga0190268_11212367 | Not Available | 627 | Open in IMG/M |
| 3300018466|Ga0190268_11718355 | Not Available | 560 | Open in IMG/M |
| 3300018469|Ga0190270_13023889 | Not Available | 532 | Open in IMG/M |
| 3300018920|Ga0190273_11695782 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300019377|Ga0190264_10343259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 933 | Open in IMG/M |
| 3300019377|Ga0190264_11045053 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300019767|Ga0190267_11513700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 518 | Open in IMG/M |
| 3300028578|Ga0272482_10014728 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300030510|Ga0268243_1074740 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300030511|Ga0268241_10184061 | Not Available | 524 | Open in IMG/M |
| 3300031548|Ga0307408_100166736 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300031548|Ga0307408_101680004 | Not Available | 605 | Open in IMG/M |
| 3300031548|Ga0307408_102141012 | Not Available | 540 | Open in IMG/M |
| 3300031731|Ga0307405_10364305 | Not Available | 1120 | Open in IMG/M |
| 3300031824|Ga0307413_11646835 | Not Available | 571 | Open in IMG/M |
| 3300031852|Ga0307410_11694640 | Not Available | 560 | Open in IMG/M |
| 3300031901|Ga0307406_10995336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300031901|Ga0307406_11064319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 697 | Open in IMG/M |
| 3300031995|Ga0307409_100886369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300031995|Ga0307409_101078606 | Not Available | 824 | Open in IMG/M |
| 3300031995|Ga0307409_101268558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter | 761 | Open in IMG/M |
| 3300032002|Ga0307416_100099096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2530 | Open in IMG/M |
| 3300032005|Ga0307411_10396620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. VF16 | 1139 | Open in IMG/M |
| 3300032005|Ga0307411_11391217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter | 642 | Open in IMG/M |
| 3300032126|Ga0307415_100169540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1701 | Open in IMG/M |
| 3300032126|Ga0307415_100675445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 929 | Open in IMG/M |
| 3300032126|Ga0307415_100774838 | Not Available | 873 | Open in IMG/M |
| 3300032159|Ga0268251_10470443 | Not Available | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 66.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 14.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.26% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1050181071 | 3300001431 | Soil | LSEQPQKVKKGAIPEWAEGLYYNKGIFSEVLVYYDDES |
| Ga0058689_101855841 | 3300004016 | Agave | MSEQARKVKNKAIPEWAEGFYYDSGMFSEILVYHDDESIYIE |
| Ga0058697_102546891 | 3300005562 | Agave | MSAQARKIEHEAIPQLAEGLYYNKGLTSEALVYYDDEAI |
| Ga0058697_106160392 | 3300005562 | Agave | MSAQARKIVHEAIPQWAEGLYYNKGLFSEALVYYDDEAI* |
| Ga0058697_108040091 | 3300005562 | Agave | MSEQARGIKHEAIPQWAQGLYYDAGMFTEVLIYYDDEALFLEHRGRE |
| Ga0079216_114619582 | 3300006918 | Agricultural Soil | MMAEQARKIKHKAIPEWAEGLYYNQGIFSEALVYHDDESIYFEC |
| Ga0105679_102437112 | 3300007790 | Soil | MSEQARKIEHEAVPQRAEGLYYNKGLSSEALLYYDDEVS* |
| Ga0105679_107310542 | 3300007790 | Soil | MSEQARKIEHEAIPQRAEGLYYNNKGLSSEALVYYEAI* |
| Ga0105679_107354082 | 3300007790 | Soil | MSTQVSKVKNKAIPEWGEGLYYNKGLFSEVHLYHDDLA* |
| Ga0126307_100454095 | 3300009789 | Serpentine Soil | MITEQARKIKHKAIPEWAEGLYYNKGIFSEILVYHDDESVY |
| Ga0126307_101505782 | 3300009789 | Serpentine Soil | MSAQARKIEHEAIPQLAEGLYYHKELSSVALVYYDDEAI* |
| Ga0126307_102047522 | 3300009789 | Serpentine Soil | MSEQAQKVRNRAIPEWAEGLYYNKGLFSEALVYYDDEALYFEVRGKDSG |
| Ga0126307_102189773 | 3300009789 | Serpentine Soil | MSEQARRVRNEAIPQWAEGLYYNKGLFDEALVYYDDEALYFE |
| Ga0126307_102314601 | 3300009789 | Serpentine Soil | MTTTEQARKIKHKAIPEWAEGLYYNKGIFSEALVYHDDESIYFECRGKDDGVVRYTFEMM |
| Ga0126307_102444812 | 3300009789 | Serpentine Soil | MSAQARKIEHEAIPQLAEGLYYNKGLSSEALVYYDDEAS* |
| Ga0126307_102510561 | 3300009789 | Serpentine Soil | MSAQARKIEHEAIPQRAEGLYYNKGLSSEALIYYDDEAS* |
| Ga0126307_105339823 | 3300009789 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLYYNKGLFDEAVIYYDDE |
| Ga0126307_105481581 | 3300009789 | Serpentine Soil | MSEQARKIEHEAIPQGAQGLYYNKGLFSEVLAYYDD |
| Ga0126307_108405771 | 3300009789 | Serpentine Soil | MSEQARRVKHAAMQQWAEGLYYNKGIFSEALVYYDDEALYFEVR |
| Ga0126307_111428061 | 3300009789 | Serpentine Soil | MMTEQAQKIKHKAVPEWAEGLYYNKGIFSEALVYHDDE |
| Ga0126307_112303461 | 3300009789 | Serpentine Soil | MSEQARKIEHEAIPQGAQGLYYNKGLFSEVLAYYDDE |
| Ga0126307_113195682 | 3300009789 | Serpentine Soil | VQLSEQAEQPKKVKKGAIPEWAEGLYYNKGIFSEVLVYYDDESIYFECRGK |
| Ga0126313_101326004 | 3300009840 | Serpentine Soil | MSEQARKVKNENIPEWAEGLYYNKGIFNEILVYHDDESVYIEHKGK |
| Ga0126313_104117451 | 3300009840 | Serpentine Soil | VKNEAIPEWAEGLYYNKGLFSEVLVYHDDESIYFEHRGKESG |
| Ga0126313_110041492 | 3300009840 | Serpentine Soil | MRAQAHKIEHEAIPRWAEGLYYNKGLSSEALVYYNDEAS* |
| Ga0126313_110296891 | 3300009840 | Serpentine Soil | MSEQAREVKQSAIPQWAEGLYYNKGLFSEALVYHDDSAVYFEVR |
| Ga0126313_113758142 | 3300009840 | Serpentine Soil | MSAQARKIEHEAIPQLAEGLYYNKGLSSEALVYYDDKAI* |
| Ga0126313_118127252 | 3300009840 | Serpentine Soil | MSEQARRVKAEAIPQWAEGLYYNKGLFDEAIVYYNDEAVYFETRG |
| Ga0126305_100607803 | 3300010036 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLFYNKGLFSEALIYYDDEALYFEVRG |
| Ga0126305_100785503 | 3300010036 | Serpentine Soil | MITEQARKIKHKAIPEWAEGRYYNKGIFSEILGYHDDESVYI |
| Ga0126305_101089945 | 3300010036 | Serpentine Soil | MSEQARKVRSEAVPQWAEGLYYNKGLFDEAVVYYDEEAVYFECRGKD |
| Ga0126305_103743541 | 3300010036 | Serpentine Soil | MSEQAVRVKNKAIPEWAEGLYYNSGLFAEVLVYHDEESIYFEHK |
| Ga0126305_104210062 | 3300010036 | Serpentine Soil | MSEQAQKVRNRAIPEWAEGLYYNKGLFSEALVYYDDEALYFEVRGK |
| Ga0126305_108416132 | 3300010036 | Serpentine Soil | MSGQARKIVHEAIPQRAEGLYYSKGLSSEALAYYDDEAI* |
| Ga0126305_112168292 | 3300010036 | Serpentine Soil | MSEQARRVKNKAVPQWAEGLYYNSGMFSEVLVYHDDEAIYFECRGRD |
| Ga0126304_100254655 | 3300010037 | Serpentine Soil | MITEQARKIKHKAIPEWAEGLYYNKGIFSEILVYHDD |
| Ga0126304_100938962 | 3300010037 | Serpentine Soil | MSEQARKVRSEAIPQWAEGLYYNKGLFDEAVIYYDDE |
| Ga0126304_102319762 | 3300010037 | Serpentine Soil | MSEQARKVKKHIPEWAEGLYYNSGLISEVLVYYDDE |
| Ga0126304_102387423 | 3300010037 | Serpentine Soil | MSEQARKVKHAAIPQWAEGLYYNKGLFNEALIYYDDEALY* |
| Ga0126304_102919082 | 3300010037 | Serpentine Soil | MSEQTRRIRHEAIPEGAEGLYYNKGLFSEVLLYHD |
| Ga0126304_104821622 | 3300010037 | Serpentine Soil | VGDRWVEASEQARKVKHEAIPQWAEGLYYNKGIFDEAVLYYDDE |
| Ga0126304_105443462 | 3300010037 | Serpentine Soil | MSAQARKIEHEAIPQLAEGLYYNKELSSVALVYYDDEAI* |
| Ga0126304_106909671 | 3300010037 | Serpentine Soil | MSEQAQKVRNRAIPEWAEGLYYNKGLFSEALVYYDD |
| Ga0126304_112393352 | 3300010037 | Serpentine Soil | MSEQARKIEHEAIPQWAEGLYYNKGGIAEILVYYDDEALYV |
| Ga0126315_101400151 | 3300010038 | Serpentine Soil | MSEQARRISHRAIPEWAEGLYYNSGMFSEILVYHDD |
| Ga0126315_101711182 | 3300010038 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLYYNKGIFDEAVLYYDD |
| Ga0126315_106071802 | 3300010038 | Serpentine Soil | MSAQARKIEHEAIPQLAEGLYYNKGLSSEALVYYDDEAI* |
| Ga0126309_100446413 | 3300010039 | Serpentine Soil | MMTEQARNIKHKAIPEWAEGLYYNKGIFSEILVYHEDESVYIEHK |
| Ga0126309_100638672 | 3300010039 | Serpentine Soil | MRAQAHKIEHEAIPQWAEGLYYNKGLSSEALVYYDDEAS* |
| Ga0126309_101539631 | 3300010039 | Serpentine Soil | MSEQARKIRHKAMPEWAEGLYYNSGMFHEVLVYHDDESIYIEHR |
| Ga0126309_103625411 | 3300010039 | Serpentine Soil | MSEQARKIEHEAIPQGAQGLYYNKGLFSEVLAYYDDEALYFECRG |
| Ga0126309_107094781 | 3300010039 | Serpentine Soil | MSAQARKIEHEAIPQWAEGLYYSKGLSCEALDYYGDEAS* |
| Ga0126308_100372893 | 3300010040 | Serpentine Soil | MSEQARKIEHEAIPQWAEGLYYNNKGLSSEALVYYDDEAS* |
| Ga0126308_101034442 | 3300010040 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLYYNKGLFSEALVYYDDEALYFEVKGQDS |
| Ga0126308_101110502 | 3300010040 | Serpentine Soil | MSEQARKIEHEAVPQPAEGLYYDNKGLSSEALVYYDDEAS* |
| Ga0126308_103088452 | 3300010040 | Serpentine Soil | MSAQAREIEHEAIPEWAEGLYYSKGLSSEALLYYDDEAI* |
| Ga0126308_104157681 | 3300010040 | Serpentine Soil | MSEQARKIEHEAIPQWAEGLYYNKGLFSEVLVYYDDNAL |
| Ga0126308_105589781 | 3300010040 | Serpentine Soil | MSEQTRRIRHKAIPEGAEGLYYNKGLFSEALLYHDDEALYFE |
| Ga0126308_106987221 | 3300010040 | Serpentine Soil | MSEQARKVKKEAIPQWAEGLYYNKGLFSEVLVYYDDEAVYFECRGKDGGI |
| Ga0126308_107116793 | 3300010040 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLYYNKGIFDEALVYYDDEALYFEV |
| Ga0126308_110771811 | 3300010040 | Serpentine Soil | MSAQARKREHEAIPQLAEGLYYNKGLSSEALVYYDDEAS* |
| Ga0126308_111936761 | 3300010040 | Serpentine Soil | MTTTEQAHKIKHKAVPEWAEGLYYNEGLYSEVLVYHDDEAIYLEHRGRNGGVVRF |
| Ga0126312_102220431 | 3300010041 | Serpentine Soil | MMTEQARKIKHKAIPEWAEGLYYNKGIFSEALVYHDDESIYFECRGKDDGV |
| Ga0126312_102374331 | 3300010041 | Serpentine Soil | MSEQVRKVKHEAIPWWAEGLYYNKGLFDEAVLYYDDDADFF* |
| Ga0126312_103603503 | 3300010041 | Serpentine Soil | VQVSEQPDQPRKVRNEAIPDWAEGLYYNKGLFTEVLVY |
| Ga0126312_106908831 | 3300010041 | Serpentine Soil | MSEQARKIEHEAIPQEAQGLYYNKGLFSEVLAYYDDEALYFECR |
| Ga0126312_108841231 | 3300010041 | Serpentine Soil | MSAQARKIEHEAIPEWAEGLYYNNKGLSSEALVYYADEAI* |
| Ga0126312_112092901 | 3300010041 | Serpentine Soil | MSEQAQKIEHEAIPQWAQGLYYNKGLYNEALIYHDDE |
| Ga0126314_101097781 | 3300010042 | Serpentine Soil | MSEQARKIKHQAIPQWAEGLYYNKGLFNEALVYYDDEAL |
| Ga0126314_106164002 | 3300010042 | Serpentine Soil | MSEQARKVRSEAIPQWAEGLYYNKGLFDEAVIYYDDEAL |
| Ga0126314_106678882 | 3300010042 | Serpentine Soil | VEVRVGEMSEQARKVKYEAIPQWAEGLFYNKGLFKEALVYYDDDA |
| Ga0126314_112517032 | 3300010042 | Serpentine Soil | MSEQPRKVKNEAIPEWAEGLYYNKGLFSEVLVYHDDESIYFE |
| Ga0126310_102325563 | 3300010044 | Serpentine Soil | MSEQARKIRRHIPEWAEGLYYNAGIFSEALVYYDDEAIYF |
| Ga0126310_102789402 | 3300010044 | Serpentine Soil | MSAQARKIVHEAIPQLAEGLYYNKGLSSEALVYYDDEAL* |
| Ga0126310_103498203 | 3300010044 | Serpentine Soil | MTTEQARKIKHKAIPEWAEGLYYNKGIFNEILLYHD |
| Ga0126311_100214828 | 3300010045 | Serpentine Soil | MSEQARKVRNEAIPQWAEGLYYNKGLFDEAVIYYDDE |
| Ga0126311_101855621 | 3300010045 | Serpentine Soil | MSEQARKVKNKAIPEWAEGLYYNSGMFSEILVYHDDESIY |
| Ga0126311_110198672 | 3300010045 | Serpentine Soil | MSEQARKISHRAIPEWAEGLYYNSGMFSEILVYHDDES |
| Ga0126306_100847491 | 3300010166 | Serpentine Soil | MSEQARKVKKEAIPQWAEGLYYNKGLFTEVLVYYDDEAVYFECKGKD |
| Ga0126306_101224991 | 3300010166 | Serpentine Soil | MMTEQAQKIKHKAVPEWAEGLYYNKGLFSEALVYHDDESIYFECRGKDSGVVRYTFQMI |
| Ga0126306_101863814 | 3300010166 | Serpentine Soil | MITEQARKIKHRAIPEWAEGPYYNAGLYSGVLVYHHDEEAIYLEHKGRD |
| Ga0126306_102542201 | 3300010166 | Serpentine Soil | MMTEQARKIKHKAIPEWAEGLYYNKGIFSEALVYHDDESI |
| Ga0126306_103662131 | 3300010166 | Serpentine Soil | MMMTEQARKIKHKAIPEWAEGLYYNKGIFSEALVYHDEEAIYFECRGKEDGVVRYTF |
| Ga0126306_103972932 | 3300010166 | Serpentine Soil | MMMTEQARKIKHKAIPEWAEGLYYNKGIFSEALVYHDDESI |
| Ga0126306_104434052 | 3300010166 | Serpentine Soil | MSEQARKISHRAIPEWAEGLYYNSGMFSEILVYHDDESIYIE |
| Ga0126306_104600541 | 3300010166 | Serpentine Soil | MSEQARKVRNEAIPQWAEGLYYNKGIFDEAVIYYDDEALYFE |
| Ga0126306_107494902 | 3300010166 | Serpentine Soil | MITEQARKTKHKAIPEWAEGLYYNEGLYSEVLVYHDEEAIYLEHKGRENGVVRFTFDQ |
| Ga0126306_107801601 | 3300010166 | Serpentine Soil | MSEQARKVKHEAIPQWAEGLYYNKGLFSEALIYYDDEALYFE |
| Ga0126306_116804171 | 3300010166 | Serpentine Soil | LSDQAHNVKHEVVPQWAEGLYYKRGLFSEAMVYHNEDAIYFEVRTAA* |
| Ga0182000_101398002 | 3300014487 | Soil | MSTQARKIEHEATPQLAEGLYYNKGLSSEALVYYDDEAI* |
| Ga0190269_103202452 | 3300018465 | Soil | MSAQARKIAHEAIPQRAEGLYYNKGLSYEALVYYDDKAS |
| Ga0190269_119206722 | 3300018465 | Soil | LSEQPGKVKKGAIPEWAEGLYYNKGIFSEVLVYYDDES |
| Ga0190268_102976413 | 3300018466 | Soil | MSEQARKISHKAIPEWAQGLYYNSGLIKEVLVYHDDEAIY |
| Ga0190268_112123672 | 3300018466 | Soil | MSEQARKISHKAIPGWAEGLYYNSGMFSEILVYHDDESIYIE |
| Ga0190268_117183551 | 3300018466 | Soil | VRKEAIPQWAEGLYYNKGLFSEVRVYYDDEALLFREQG |
| Ga0190270_130238891 | 3300018469 | Soil | MMTTEQAHKIKHKAVPEWAEGLYYNAGIFSEALVYHDDEAIYFECRGKED |
| Ga0190273_116957822 | 3300018920 | Soil | RRGGPVEMSAQARKIVHEAIPQWAEGLYYSKGLSSEALAYYDDEAI |
| Ga0190264_103432592 | 3300019377 | Soil | LSEQPGKVKKGAIPEWAEGLYYNKGIFSEVLVYYDDESIYFECRGK |
| Ga0190264_110450532 | 3300019377 | Soil | MGAQAHKIEHEAIPQWAEGLYYNKGLSSEALVYYDDEAS |
| Ga0190267_115137001 | 3300019767 | Soil | MSAQARKIVHEAIPQLAEGLYYNNRGLSSEALVYYDDEAI |
| Ga0272482_100147283 | 3300028578 | Soil | MSAQARKIVHEAIPQCAEGLYYSKGLSSEALAYYDDEAS |
| Ga0268243_10747402 | 3300030510 | Soil | MSTQARKIEHEATPQLAEGLYYNKGLSSEALVYYDDEAI |
| Ga0268241_101840611 | 3300030511 | Soil | MNSMSEQAQGLRDEAIPESAEGIYFAKGVFEEALVYHDDEALYFEHK |
| Ga0307408_1001667363 | 3300031548 | Rhizosphere | MSEQARKIEHEAIPQWAEGLYYNNKGLSSEALVYYDDEAS |
| Ga0307408_1016800042 | 3300031548 | Rhizosphere | MSEQTRRIRHEAIPEGAEGLYYNKGLFSEVLLYHDD |
| Ga0307408_1021410122 | 3300031548 | Rhizosphere | MSEQARKVKKEAIPQWAEGLYYNKGLFSEVLVYYDDEAVYFE |
| Ga0307405_103643051 | 3300031731 | Rhizosphere | MSEQARKVRNEAIPQWAEGVYYNKSIFDEAVLYYDDEALYFEGQG |
| Ga0307413_116468352 | 3300031824 | Rhizosphere | MSEQARKVKKEAIPQWAEGLYYNKGLFSEVLVYYDDEAVYFEC |
| Ga0307410_116946401 | 3300031852 | Rhizosphere | MSEQARKVKHEAIPQWAEGLYYNKGLFNEAVVYYD |
| Ga0307406_109953361 | 3300031901 | Rhizosphere | VEMSEQARKIEHEAIPQWAEGLYYNNKGLSSEALVYYDDEAS |
| Ga0307406_110643191 | 3300031901 | Rhizosphere | MSEQAQKVRNEAIPPWAEGLFYNKGLFSEALIYHNDDALYFELR |
| Ga0307409_1008863693 | 3300031995 | Rhizosphere | MSDQAHKAKHEAVPQWAEGLYYNNKGLFSEAMVYHTDNAIPFEVRG |
| Ga0307409_1010786061 | 3300031995 | Rhizosphere | MSEQTRRIRHKAIPEGAEGLYYNKGLFSEALLYHDDEAL |
| Ga0307409_1012685582 | 3300031995 | Rhizosphere | MSEQARKIEHEAIPQWADGLYYNNKGLSSEALVYYDDEAI |
| Ga0307416_1000990962 | 3300032002 | Rhizosphere | MSDQAHKAKHEAVSQWAEGLYYNNKGLFSEAMVYHTDNAIPFEVRG |
| Ga0307411_103966201 | 3300032005 | Rhizosphere | MSEQARKISHRAIPEWAEGLYYNSGMFSEILVYHDDE |
| Ga0307411_113912172 | 3300032005 | Rhizosphere | MSEQARKIEHEAIPQWAEGLYYNNKGLSSEALVYYDDE |
| Ga0307415_1001695401 | 3300032126 | Rhizosphere | YMSDQAHKAKHEAVSQWAEGLYYNNKGLFSEAMVYHTDNAIPFEVRG |
| Ga0307415_1006754451 | 3300032126 | Rhizosphere | MGEQARKIKHKAIPEWAEGLYYNKGIFSEVLVYHDESLYREHKGK |
| Ga0307415_1007748381 | 3300032126 | Rhizosphere | VSEQARQIKHEAIPQWAEGLYYNKGLFNEAVIYYDDE |
| Ga0268251_104704432 | 3300032159 | Agave | MSEQARRVRHEAVPQWAEGIYYNKGLFDEALVYYDDEALY |
| ⦗Top⦘ |