


| Basic Information | |
|---|---|
| Family ID | F072679 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MLTKDILFGMNILTLAGFIVMGLTLTLNRMGQAGKALSIGLMT |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 90.76 % |
| % of genes near scaffold ends (potentially truncated) | 90.91 % |
| % of genes from short scaffolds (< 2000 bps) | 93.39 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.719 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.802 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.851 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 9.92 |
| PF07369 | DUF1488 | 4.13 |
| PF00211 | Guanylate_cyc | 4.13 |
| PF00106 | adh_short | 2.48 |
| PF02586 | SRAP | 2.48 |
| PF07167 | PhaC_N | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| PF12680 | SnoaL_2 | 0.83 |
| PF06945 | DUF1289 | 0.83 |
| PF01832 | Glucosaminidase | 0.83 |
| PF03692 | CxxCxxCC | 0.83 |
| PF14497 | GST_C_3 | 0.83 |
| PF12535 | Nudix_N | 0.83 |
| PF04964 | Flp_Fap | 0.83 |
| PF00296 | Bac_luciferase | 0.83 |
| PF01032 | FecCD | 0.83 |
| PF13358 | DDE_3 | 0.83 |
| PF00881 | Nitroreductase | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF01370 | Epimerase | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 9.92 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 4.13 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 2.48 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.83 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.83 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.72 % |
| All Organisms | root | All Organisms | 46.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100870436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300005434|Ga0070709_10331636 | Not Available | 1119 | Open in IMG/M |
| 3300005445|Ga0070708_100566810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1071 | Open in IMG/M |
| 3300005536|Ga0070697_101269830 | Not Available | 657 | Open in IMG/M |
| 3300005538|Ga0070731_10098319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300005576|Ga0066708_10977150 | Not Available | 526 | Open in IMG/M |
| 3300005764|Ga0066903_103772556 | Not Available | 815 | Open in IMG/M |
| 3300006173|Ga0070716_100313241 | Not Available | 1097 | Open in IMG/M |
| 3300006791|Ga0066653_10179045 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300009038|Ga0099829_11733813 | Not Available | 513 | Open in IMG/M |
| 3300009162|Ga0075423_11585088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300009792|Ga0126374_10301679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1074 | Open in IMG/M |
| 3300010046|Ga0126384_12246253 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010047|Ga0126382_11634936 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010048|Ga0126373_11688300 | Not Available | 697 | Open in IMG/M |
| 3300010048|Ga0126373_11792244 | Not Available | 677 | Open in IMG/M |
| 3300010358|Ga0126370_10333940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1217 | Open in IMG/M |
| 3300010358|Ga0126370_11256656 | Not Available | 692 | Open in IMG/M |
| 3300010358|Ga0126370_11753135 | Not Available | 599 | Open in IMG/M |
| 3300010376|Ga0126381_103038475 | Not Available | 666 | Open in IMG/M |
| 3300010376|Ga0126381_104301697 | Not Available | 551 | Open in IMG/M |
| 3300010376|Ga0126381_104882252 | Not Available | 515 | Open in IMG/M |
| 3300010398|Ga0126383_12512450 | Not Available | 599 | Open in IMG/M |
| 3300012202|Ga0137363_11286544 | Not Available | 619 | Open in IMG/M |
| 3300012363|Ga0137390_10504863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1183 | Open in IMG/M |
| 3300012971|Ga0126369_12519523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 600 | Open in IMG/M |
| 3300012971|Ga0126369_13426760 | Not Available | 519 | Open in IMG/M |
| 3300012985|Ga0164308_10807558 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300016270|Ga0182036_10846631 | Not Available | 747 | Open in IMG/M |
| 3300016270|Ga0182036_10977827 | Not Available | 697 | Open in IMG/M |
| 3300016270|Ga0182036_11466661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300016294|Ga0182041_10506452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300016319|Ga0182033_11985792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300016319|Ga0182033_12137561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300016341|Ga0182035_10076161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2380 | Open in IMG/M |
| 3300016371|Ga0182034_10358872 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300016371|Ga0182034_12035137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300016422|Ga0182039_11291820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300016422|Ga0182039_11941760 | Not Available | 541 | Open in IMG/M |
| 3300016445|Ga0182038_10136972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1847 | Open in IMG/M |
| 3300020579|Ga0210407_10979327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300020583|Ga0210401_10765791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 825 | Open in IMG/M |
| 3300020583|Ga0210401_11083550 | Not Available | 660 | Open in IMG/M |
| 3300021171|Ga0210405_10939948 | Not Available | 655 | Open in IMG/M |
| 3300021406|Ga0210386_10813529 | Not Available | 803 | Open in IMG/M |
| 3300021406|Ga0210386_11225125 | Not Available | 634 | Open in IMG/M |
| 3300021406|Ga0210386_11502449 | Not Available | 562 | Open in IMG/M |
| 3300021420|Ga0210394_10083565 | Not Available | 2757 | Open in IMG/M |
| 3300021432|Ga0210384_10971177 | Not Available | 751 | Open in IMG/M |
| 3300021560|Ga0126371_12798406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300022708|Ga0242670_1026950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300022717|Ga0242661_1070394 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300022724|Ga0242665_10082251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
| 3300022726|Ga0242654_10106635 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300025929|Ga0207664_11619958 | Not Available | 569 | Open in IMG/M |
| 3300027829|Ga0209773_10174077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300027846|Ga0209180_10700585 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028047|Ga0209526_10941372 | Not Available | 521 | Open in IMG/M |
| 3300031057|Ga0170834_106096992 | Not Available | 602 | Open in IMG/M |
| 3300031545|Ga0318541_10544979 | Not Available | 649 | Open in IMG/M |
| 3300031545|Ga0318541_10868416 | Not Available | 503 | Open in IMG/M |
| 3300031546|Ga0318538_10308254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300031561|Ga0318528_10575461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300031561|Ga0318528_10661856 | Not Available | 559 | Open in IMG/M |
| 3300031564|Ga0318573_10682512 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031572|Ga0318515_10031514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2589 | Open in IMG/M |
| 3300031572|Ga0318515_10634270 | Not Available | 567 | Open in IMG/M |
| 3300031573|Ga0310915_10038092 | Not Available | 3045 | Open in IMG/M |
| 3300031573|Ga0310915_10667309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300031640|Ga0318555_10725029 | Not Available | 537 | Open in IMG/M |
| 3300031679|Ga0318561_10487706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300031681|Ga0318572_10075679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1862 | Open in IMG/M |
| 3300031681|Ga0318572_10860722 | Not Available | 539 | Open in IMG/M |
| 3300031682|Ga0318560_10109153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1438 | Open in IMG/M |
| 3300031713|Ga0318496_10326334 | Not Available | 848 | Open in IMG/M |
| 3300031713|Ga0318496_10630227 | Not Available | 592 | Open in IMG/M |
| 3300031719|Ga0306917_10714031 | Not Available | 787 | Open in IMG/M |
| 3300031724|Ga0318500_10440457 | Not Available | 651 | Open in IMG/M |
| 3300031747|Ga0318502_10102724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300031754|Ga0307475_10276566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 1347 | Open in IMG/M |
| 3300031754|Ga0307475_11249799 | Not Available | 577 | Open in IMG/M |
| 3300031763|Ga0318537_10240848 | Not Available | 672 | Open in IMG/M |
| 3300031768|Ga0318509_10016396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3361 | Open in IMG/M |
| 3300031779|Ga0318566_10325535 | Not Available | 760 | Open in IMG/M |
| 3300031781|Ga0318547_10979116 | Not Available | 528 | Open in IMG/M |
| 3300031795|Ga0318557_10100445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1279 | Open in IMG/M |
| 3300031795|Ga0318557_10406078 | Not Available | 626 | Open in IMG/M |
| 3300031819|Ga0318568_10303064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300031859|Ga0318527_10492697 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031879|Ga0306919_10560665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300031890|Ga0306925_10020082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6656 | Open in IMG/M |
| 3300031890|Ga0306925_11040994 | Not Available | 831 | Open in IMG/M |
| 3300031890|Ga0306925_11057866 | Not Available | 823 | Open in IMG/M |
| 3300031890|Ga0306925_11335861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031910|Ga0306923_12232355 | Not Available | 548 | Open in IMG/M |
| 3300031912|Ga0306921_11651692 | Not Available | 694 | Open in IMG/M |
| 3300031912|Ga0306921_12456498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031941|Ga0310912_11203986 | Not Available | 576 | Open in IMG/M |
| 3300031941|Ga0310912_11337177 | Not Available | 542 | Open in IMG/M |
| 3300031941|Ga0310912_11339171 | Not Available | 542 | Open in IMG/M |
| 3300031945|Ga0310913_10134405 | Not Available | 1699 | Open in IMG/M |
| 3300031945|Ga0310913_10567148 | Not Available | 805 | Open in IMG/M |
| 3300031946|Ga0310910_10318362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300031947|Ga0310909_11546695 | Not Available | 527 | Open in IMG/M |
| 3300031954|Ga0306926_10370639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1769 | Open in IMG/M |
| 3300031954|Ga0306926_11584722 | Not Available | 752 | Open in IMG/M |
| 3300031954|Ga0306926_12535231 | Not Available | 561 | Open in IMG/M |
| 3300032001|Ga0306922_10671274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1093 | Open in IMG/M |
| 3300032001|Ga0306922_11671978 | Not Available | 631 | Open in IMG/M |
| 3300032001|Ga0306922_12424734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300032044|Ga0318558_10089454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1428 | Open in IMG/M |
| 3300032089|Ga0318525_10549353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300032174|Ga0307470_11426199 | Not Available | 573 | Open in IMG/M |
| 3300032261|Ga0306920_102879709 | Not Available | 653 | Open in IMG/M |
| 3300032261|Ga0306920_103024285 | Not Available | 634 | Open in IMG/M |
| 3300032261|Ga0306920_103413363 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032261|Ga0306920_104036198 | Not Available | 532 | Open in IMG/M |
| 3300033289|Ga0310914_10279441 | Not Available | 1504 | Open in IMG/M |
| 3300033289|Ga0310914_10346158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1344 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.48% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1008704362 | 3300004152 | Bog Forest Soil | MFTKDILFGMNIVSLAGFGVMELRLTLRRMAQAGAPLCIGLM |
| Ga0070709_103316361 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTKDILFGMNILTLAGFLVMGLSLTLHRTGRVGAPLSIGLMSVG |
| Ga0070708_1005668101 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTKDILFGMNILTLAGFLVMGLSLTLHRIAAAGRLLSIGLMCVG |
| Ga0070697_1012698302 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTKDILFGMNVFTLAGFVVMGISLTLRRTKNAGAPLCIGLMCAG |
| Ga0070731_100983191 | 3300005538 | Surface Soil | MLTRDILFGMNILSLAGFLLMGLTLTLSRQRRLGAPLAYSLMGVG |
| Ga0066708_109771502 | 3300005576 | Soil | VLTKDIVFGMNVLSLAGFLVMGLSLTLHRTGNAGIPLSIGLM |
| Ga0066903_1037725563 | 3300005764 | Tropical Forest Soil | VLTKDILFGMNVLTLAGFLVMGLSLTLHRTGNAGAPLSIGLMC |
| Ga0070716_1003132411 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTKDILFGMNILTLAGFLVMGLSLTLHRTGRVGAPLSIGL |
| Ga0066653_101790452 | 3300006791 | Soil | VLTKDILFGMNLLTLVGFLVMGLSLTLHRTGNASVSLSI |
| Ga0099829_117338131 | 3300009038 | Vadose Zone Soil | MFTKDIIFGMNILTLAGFVVMGLSLTLRRMAVAGGPLCIGLM |
| Ga0075423_115850881 | 3300009162 | Populus Rhizosphere | MFTKDILFGMNILTLAGFLIMGLSLTLRRMAAAGVPLSIGLMCAGT |
| Ga0126374_103016791 | 3300009792 | Tropical Forest Soil | MLTKGILFGMNILTLAGFALMGLTLTLNRMGQAGRA |
| Ga0126384_122462531 | 3300010046 | Tropical Forest Soil | VLTKDILFGMNILTLAGFVVMGLSLTLYRMGTAGAPLSIGL |
| Ga0126382_116349361 | 3300010047 | Tropical Forest Soil | VLTKDILFGMNILTLAGFVVMGLTLTLNRMGQTSTTFPK* |
| Ga0126373_116883002 | 3300010048 | Tropical Forest Soil | LTKDILFGMNLLTLAGFLVMGLSLTLHRMGNAGVRLSIGA* |
| Ga0126373_117922441 | 3300010048 | Tropical Forest Soil | MLTKDILFGMNIITLAGFVVMGLSLSLNRTGQIGAPL |
| Ga0126370_103339403 | 3300010358 | Tropical Forest Soil | MLTKGILFGMNILTLAGFVVMGLTLTLNRMGQAGKALS |
| Ga0126370_112566562 | 3300010358 | Tropical Forest Soil | VLTKDILFGMNILTLVDFLVMGLSLTLHRTGNAGVALSIGLMCAGTAL |
| Ga0126370_117531352 | 3300010358 | Tropical Forest Soil | MNLLTLAGFIVMGLTLTLNRMGRAGKGLSIGLMAAGTALVFL |
| Ga0126381_1030384752 | 3300010376 | Tropical Forest Soil | VLTKDILFGMNILTLAGFVVMGLTLTLNRMGQTRKALSVGLMVAGT |
| Ga0126381_1043016972 | 3300010376 | Tropical Forest Soil | MLTKEILFGMNILTLAGFIVMGLTLTLNRMGQTGKA |
| Ga0126381_1048822521 | 3300010376 | Tropical Forest Soil | VLTKDILFGMNILTLAGFVVMGLTLTLNRMGQAGKA* |
| Ga0126383_125124501 | 3300010398 | Tropical Forest Soil | VLTRDILFGVNILTLAGFVVMGLTLTLNRMGQAGKALSIGLMAAGTA |
| Ga0137363_112865441 | 3300012202 | Vadose Zone Soil | MFTNDILFGMNILSLAGFVVMGLSLSLRRVAQAGAPV |
| Ga0137390_105048633 | 3300012363 | Vadose Zone Soil | VLTKDILFGMNVFTLAGFVVMGISLTLRRMKNAGVPYALG* |
| Ga0126369_125195231 | 3300012971 | Tropical Forest Soil | MLTMGILFGMNILTLSGFALIGLTLTLNRMGQAGRAL |
| Ga0126369_134267601 | 3300012971 | Tropical Forest Soil | MAAFPKDILFGMNLVTLAGFVVMGLTLTLNRMGQAGKALSIGLMAAGT |
| Ga0164308_108075581 | 3300012985 | Soil | VLTKDILFGMNVLSLAGFLVMGLSLTLHRTGNAGIPLSIG* |
| Ga0182036_108466311 | 3300016270 | Soil | VLAKDILFGMNILTLAGFVVMGITLTLNRMGQAGKALCIGLMTAGTA |
| Ga0182036_109778272 | 3300016270 | Soil | MLTKDILFGMNILTVAGFVVMGLTLTLNRMGQAGKALSIGL |
| Ga0182036_114666612 | 3300016270 | Soil | MLTKDILFGMNILTLIGFVVMGLTLTLNRMGQAGKALSIG |
| Ga0182041_105064522 | 3300016294 | Soil | MLTKDILFGMNIMTLAGFALMGLSLSLNRTGQIGARLSVGLMC |
| Ga0182033_119857921 | 3300016319 | Soil | MLTKDILFGMNILTLTGFVVMGLTLTLNRMGQTGKALSIGLMAAG |
| Ga0182033_121375611 | 3300016319 | Soil | MLTKDILFGMNILTLTGIVVMGLTLTLNRMGQAGKA |
| Ga0182035_100761613 | 3300016341 | Soil | MLTRDILFGMNTLTLAGFVVMGLSLSLNRTGQIGAPLSVGLMC |
| Ga0182034_103588722 | 3300016371 | Soil | MNILTLAGFVVMGITLTLNRMGQTRKALSVGLMVAGPLWSSL |
| Ga0182034_120351371 | 3300016371 | Soil | MLTKEILFGMNILTLAGFIIMGLTLTLNRMGQAGKAL |
| Ga0182039_112918202 | 3300016422 | Soil | MLTKDILFGMNILTLAGFVVMGLSLSLNRTGQIGAPLSV |
| Ga0182039_119417601 | 3300016422 | Soil | VLTKDILFGMNVLTLAGFLVMGLSLTLRRTGNASV |
| Ga0182038_101369724 | 3300016445 | Soil | MLTKEILFGMNILTLAGFIIMGLTLTLNRMGQAGKALS |
| Ga0210407_109793272 | 3300020579 | Soil | MFTKDILFGMNILTLAGFVVMGLSLTLHRMAAAGRPLSIGLM |
| Ga0210401_107657913 | 3300020583 | Soil | MLTRDILFGMNLLTLAGFAVMGLSLTLRRMAAAGGPLSIGLMLAGT |
| Ga0210401_110835501 | 3300020583 | Soil | MFTKDILFGMNILTLTGFVVMGLSLTLHRRAAAGRPLAIGPYV |
| Ga0210405_109399481 | 3300021171 | Soil | VLTKDILFGMNVLSLAGFLVMGLSLTLHRTGNAGIPLSI |
| Ga0210385_114461251 | 3300021402 | Soil | MLTRDIAFGMNAVTLAGLLIMGFGLTLQRMARARLPLSIGVMGV |
| Ga0210386_108135291 | 3300021406 | Soil | VLTRDILFGMNLLTLAEFVVMGLTLILNRMGQTGKGLSIGLMAAGT |
| Ga0210386_112251251 | 3300021406 | Soil | VLTKDILFGMNILTLAGFVVMGLTLTLNRTGQAGKLLSIGLM |
| Ga0210386_115024492 | 3300021406 | Soil | VLTKDILFGMNLLSLGGFLVMGLSLTLHRAGNAGIPLSIGLMCAGT |
| Ga0210394_100835651 | 3300021420 | Soil | MFTKDILFGMNILTLAGFVVMGLSLTLHRMAAAGRPLSIGLMCAG |
| Ga0210384_109711772 | 3300021432 | Soil | MLTKDILFGMNILTLAGFAVMGITVALSRSGQTGKARASH |
| Ga0126371_127984062 | 3300021560 | Tropical Forest Soil | VLTKDILFGMNLLTLAGFLVMGLSLTLHRTGNVGVPL |
| Ga0242670_10269501 | 3300022708 | Soil | VLTRDILFGMNILSLAGFVVMGLTLTLNRVGQAGKGLSIGLMTAGTA |
| Ga0242661_10703942 | 3300022717 | Soil | VLTKDILFGMNVPTLVGFLVMGLSLTLRRTGNASVPLSIGLMCA |
| Ga0242665_100822511 | 3300022724 | Soil | MLTRDILFGMNLLTLAGFAVMGLSLTLRRMAAAGGPLSIGLMLAG |
| Ga0242654_101066351 | 3300022726 | Soil | MLTKDFLFGLNILSLAGFLVMGLGVSLNRTGRIGVPLSV |
| Ga0207664_116199581 | 3300025929 | Agricultural Soil | VLTRDILFGMNILTLAGFVVMGLTLTLNRMGQAGKGLSIAS |
| Ga0209773_101740773 | 3300027829 | Bog Forest Soil | MLTQDILFGMNIVTLVGFVIMGLSLTLHRMAAAGRSL |
| Ga0209180_107005851 | 3300027846 | Vadose Zone Soil | MFTKDILFGMNIVTLAGFALMGLTLTLRRMAQAGTPLSIG |
| Ga0209526_109413721 | 3300028047 | Forest Soil | LPTKDILFGMNLLSLAGFLVMGLSLTLYRTGNVGIPLSIGLMCA |
| Ga0170834_1060969922 | 3300031057 | Forest Soil | MLTKDILFGINILTLGGLIVVRLSLTLQRSQRLGGR |
| Ga0318541_105449791 | 3300031545 | Soil | MLTKDILFGMNILTLAGFIVMGLTLTLNRMGQAGKALSIGLMT |
| Ga0318541_108684162 | 3300031545 | Soil | MLTKDILFGMNILALAGFSVMGLSLTLQRMAAAGRPLSISLMC |
| Ga0318538_103082541 | 3300031546 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSIGLMTAGTALV |
| Ga0318528_105754611 | 3300031561 | Soil | MLTRDILFGMNTLTLAGFVVMGLSLSLNRTGQIGAPLSVGLMCAG |
| Ga0318528_106618561 | 3300031561 | Soil | MLTKEILFGMNILTLAGFIVMGLALTLNRMGQTGKAQSIALM |
| Ga0318573_106825121 | 3300031564 | Soil | VLTKDILFGMNILTLAGFVVMGLALTLNRMGQTRKAL |
| Ga0318515_100315141 | 3300031572 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSMS |
| Ga0318515_106342701 | 3300031572 | Soil | MLTKDILFGMNILTLAGFIIMGLSLTLQRIAAASRPLSIGLMCAGTA |
| Ga0310915_100380921 | 3300031573 | Soil | MLTKDILFGMNILTVAGFVVMGLTLTLNRMGQASKPVSIGLM |
| Ga0310915_106673092 | 3300031573 | Soil | MLTKDILFGMNIMTLAGFALMGLSLSLNRTGQIGARLSVGLMCVG |
| Ga0318555_107250291 | 3300031640 | Soil | MLTKDILFGMNILTLAGFIIMGLSLTLQRMAAASRPLSIGL |
| Ga0318561_104877062 | 3300031679 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKAL |
| Ga0318572_100756791 | 3300031681 | Soil | MLTKDILFGMNILTLAGFVVMGLSLSLNRTGQIGAPLSVGLMCA |
| Ga0318572_108607222 | 3300031681 | Soil | VLAKDILFGMNILTLAGFVVMGITLTLNRMGRAGKGRRIGLMTAG |
| Ga0318560_101091533 | 3300031682 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSMSIMSQ |
| Ga0318496_103263341 | 3300031713 | Soil | VLTKDILFGMNILTLAGFVVMGLTLTLNRMGQTGKALS |
| Ga0318496_106302271 | 3300031713 | Soil | MLTKDILLGMNILTLAGFMVMGLTLTLNRMGQAGKALSIGLMT |
| Ga0306917_107140313 | 3300031719 | Soil | KDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSI |
| Ga0318500_104404571 | 3300031724 | Soil | VLAKDILFGMNILTLAGFVVMGITLTLNRMGQAGKALCIGLMTAGT |
| Ga0318502_101027245 | 3300031747 | Soil | MLTKEILFGMNILTLAGFVVMGLTLTLNRTGQAGKALSIG |
| Ga0307475_102765663 | 3300031754 | Hardwood Forest Soil | VLTKDILFGMNILTLAGFVVMGLTLTVNRMGQAGKGLSIG |
| Ga0307475_112497991 | 3300031754 | Hardwood Forest Soil | VLTRDILFGMNILTLAGFVVMGLTLTLNRMGQAGKG |
| Ga0318537_102408481 | 3300031763 | Soil | VLTKDILFGMNILTLAGFVVMGITLTLNRMGQTRKAF |
| Ga0318509_100163967 | 3300031768 | Soil | MLTKDILFGMNILTLAGFVVMGLSLSLNRTGQIGAPLSVGLM |
| Ga0318566_103255351 | 3300031779 | Soil | VLTKDILFGMNILTLAGFVVMGITLTLNRMGQTRK |
| Ga0318547_109791161 | 3300031781 | Soil | MLTKEILFGMNILTLAGFIVMGLTLTLNRMGQISKALSIGLM |
| Ga0318557_101004452 | 3300031795 | Soil | MLTKDILFGMNILTLAGFIIMGLSLTLQRMAAASRPLSIGLMCAGTAL |
| Ga0318557_104060781 | 3300031795 | Soil | MLTKDILFGMNILALAGFSVMGLSLTLQRMAAAGRPLS |
| Ga0318568_103030641 | 3300031819 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSIGLM |
| Ga0318527_104926971 | 3300031859 | Soil | VLTKDILFGMNILTLAGFVVMGITLTLNRMGQTRKAFSVGLMVTGT |
| Ga0306919_105606652 | 3300031879 | Soil | MLTKDILFGMNILTLAGFVVMGLSLSLNRTGQIGAPLSVGLMCAGTA |
| Ga0306925_100200821 | 3300031890 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSMSIMSQTAGFYL |
| Ga0306925_110409941 | 3300031890 | Soil | MLTKDILFGMNILTLTGFVVMGITLTLNRAGQAGKALSIGLMAAG |
| Ga0306925_110578661 | 3300031890 | Soil | RTFAKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSI |
| Ga0306925_113358612 | 3300031890 | Soil | MLTKDILFGMNIMTLAGFALMGLSLSLNRTGQIGARLSVGLMCVGTA |
| Ga0306923_122323551 | 3300031910 | Soil | VLTKDILFGMNLLTLLGFLVMGLSLTLRRTGNASVPLSIGMMGAG |
| Ga0306921_116516922 | 3300031912 | Soil | MLTKDILFGMNILTLAGFIVMGLTLTLNRMGQAGKA |
| Ga0306921_124564981 | 3300031912 | Soil | MLTKEILFGMNILTLAGFIIMGLTLTLNRMGQAGKA |
| Ga0310912_112039861 | 3300031941 | Soil | MLTKEILFGMNILTLAGFIVMGLTLTLNRMGQISKA |
| Ga0310912_113371771 | 3300031941 | Soil | AGPMLTKDILFGMNILTLAGFVVMGLTLTLNRMGQAGRA |
| Ga0310912_113391712 | 3300031941 | Soil | MLTEDILLGMNILTLAGFVVMGLTLTLNRMGQAGKALSIGLMTAG |
| Ga0310913_101344054 | 3300031945 | Soil | TDRDRAMLTKDILFGMNILTLAGFVVMGLTLTLNRMG |
| Ga0310913_105671482 | 3300031945 | Soil | VLTRDILFGMNILTLAGFVVMGLTLTLNRMGQAGKVV |
| Ga0310910_103183621 | 3300031946 | Soil | MLTKEILFGMNILTLAGFIIMGLTLTLNRMGQAGK |
| Ga0310909_115466952 | 3300031947 | Soil | VLTKDILFGMNVLTLAGFIVMGLSLTLQRMAAASRAFSIGLMCAG |
| Ga0306926_103706393 | 3300031954 | Soil | MLTKDILFGMNIITLAGFVVMGLSLSLNRTGQIGAPLSVG |
| Ga0306926_115847221 | 3300031954 | Soil | VLTKDILFGINILTLAGFLVMGISLTLHRTGNAGVPLTIGLMCA |
| Ga0306926_125352311 | 3300031954 | Soil | MLTKEILFGMNILTLAGFIVMGLTLTLNRMGQTSKALSIGLMT |
| Ga0306922_106712741 | 3300032001 | Soil | MLTKEILFGMNILTLVGFIVMGLTLTLNRIGRTGKALSIGLMTAG |
| Ga0306922_116719781 | 3300032001 | Soil | MLTKEILFGMNILTLAGFIVMGLALTLNRMGQTGKALSIALMTAGTA |
| Ga0306922_124247342 | 3300032001 | Soil | MLTKGILFGTNLLTLAGFPMMGITLTLNRMGQAGKALSI |
| Ga0318558_100894543 | 3300032044 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALS |
| Ga0318506_102731091 | 3300032052 | Soil | VLTKDILFGMNIVTLAGFVLMGITLTLNRTGQAGKALSIGLMAE |
| Ga0318525_105493532 | 3300032089 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSI |
| Ga0307470_114261992 | 3300032174 | Hardwood Forest Soil | MLTKDILFGMNILTLVGFVVMGLTVALSRSGQAGKGLRIGLI |
| Ga0306920_1028797092 | 3300032261 | Soil | MLTKDILFGMNISTLAGFLVMGLSVTLHRTGNAGVLL |
| Ga0306920_1030242852 | 3300032261 | Soil | VLTRDIFYGMNVLTLAGFLVMGITLTLNRTGQTGKLLSIGLMTVGT |
| Ga0306920_1034133631 | 3300032261 | Soil | VFTKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSMSIMSQTAGFYLG |
| Ga0306920_1040361981 | 3300032261 | Soil | MLTKDILFGMNMLTLTGFAVMGITLTLNRAGQAGKALSIG |
| Ga0310914_102794414 | 3300033289 | Soil | FAKDILFGMNILTLAGFAVMGITLTLNRMGQAGKALSI |
| Ga0310914_103461585 | 3300033289 | Soil | MLTKEILLGMNILTLVGFVVMGLTLTVNRMGHAGKALSIGLMTAGT |
| ⦗Top⦘ |