


| Basic Information | |
|---|---|
| Family ID | F072623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 93.39 % |
| % of genes from short scaffolds (< 2000 bps) | 92.56 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.562 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.578 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.537 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.017 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF08570 | DUF1761 | 33.06 |
| PF01180 | DHO_dh | 23.97 |
| PF13474 | SnoaL_3 | 14.05 |
| PF01738 | DLH | 1.65 |
| PF16491 | Peptidase_M48_N | 1.65 |
| PF00561 | Abhydrolase_1 | 1.65 |
| PF10978 | DUF2785 | 0.83 |
| PF09900 | DUF2127 | 0.83 |
| PF14559 | TPR_19 | 0.83 |
| PF13643 | DUF4145 | 0.83 |
| PF05163 | DinB | 0.83 |
| PF04389 | Peptidase_M28 | 0.83 |
| PF00930 | DPPIV_N | 0.83 |
| PF07676 | PD40 | 0.83 |
| PF14534 | DUF4440 | 0.83 |
| PF04551 | GcpE | 0.83 |
| PF00480 | ROK | 0.83 |
| PF01625 | PMSR | 0.83 |
| PF02810 | SEC-C | 0.83 |
| PF13505 | OMP_b-brl | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF01663 | Phosphodiest | 0.83 |
| PF04237 | YjbR | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 23.97 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 23.97 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 23.97 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 23.97 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 23.97 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.65 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.83 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.83 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.83 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.56 % |
| Unclassified | root | N/A | 7.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005171|Ga0066677_10831845 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005332|Ga0066388_102245493 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005332|Ga0066388_105404757 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005434|Ga0070709_10865747 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005542|Ga0070732_10207459 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300005552|Ga0066701_10657597 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005568|Ga0066703_10714315 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005921|Ga0070766_10214442 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300006059|Ga0075017_100018413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4522 | Open in IMG/M |
| 3300006162|Ga0075030_101333814 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006174|Ga0075014_100892364 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006176|Ga0070765_100674758 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300007076|Ga0075435_101996846 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300007258|Ga0099793_10113150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
| 3300009029|Ga0066793_10745360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009038|Ga0099829_10191485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1651 | Open in IMG/M |
| 3300009038|Ga0099829_10903406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300009088|Ga0099830_10611313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300009088|Ga0099830_11209125 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009089|Ga0099828_10102756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2475 | Open in IMG/M |
| 3300009089|Ga0099828_10438543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300009089|Ga0099828_10824796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300009174|Ga0105241_10050929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3157 | Open in IMG/M |
| 3300010048|Ga0126373_10271473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
| 3300010159|Ga0099796_10205533 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300010329|Ga0134111_10489680 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010333|Ga0134080_10015188 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300010335|Ga0134063_10536140 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010358|Ga0126370_10159499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1655 | Open in IMG/M |
| 3300010379|Ga0136449_100601147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1875 | Open in IMG/M |
| 3300010398|Ga0126383_11439098 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300011269|Ga0137392_10807601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300011270|Ga0137391_10256561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1514 | Open in IMG/M |
| 3300011270|Ga0137391_11549687 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300011271|Ga0137393_10684445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300011271|Ga0137393_11575404 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012096|Ga0137389_10635334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300012199|Ga0137383_10936556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300012203|Ga0137399_11076900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012209|Ga0137379_11134430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300012212|Ga0150985_117459248 | Not Available | 666 | Open in IMG/M |
| 3300012357|Ga0137384_11596312 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012361|Ga0137360_11535562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300012582|Ga0137358_10314018 | Not Available | 1063 | Open in IMG/M |
| 3300012683|Ga0137398_10470631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 861 | Open in IMG/M |
| 3300012917|Ga0137395_11273401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012918|Ga0137396_11289288 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012923|Ga0137359_10596820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300012925|Ga0137419_10094580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2054 | Open in IMG/M |
| 3300012925|Ga0137419_11208306 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012930|Ga0137407_10824064 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300012944|Ga0137410_11007823 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012944|Ga0137410_11901254 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012948|Ga0126375_10888862 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012960|Ga0164301_10907074 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012960|Ga0164301_11156565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012975|Ga0134110_10448515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012987|Ga0164307_11697122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300013105|Ga0157369_12223813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300014168|Ga0181534_10285558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300014325|Ga0163163_11301944 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300015053|Ga0137405_1327942 | All Organisms → cellular organisms → Bacteria | 5767 | Open in IMG/M |
| 3300015054|Ga0137420_1196071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300015054|Ga0137420_1300896 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300015245|Ga0137409_10863962 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300015264|Ga0137403_10018159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7586 | Open in IMG/M |
| 3300017943|Ga0187819_10764639 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018034|Ga0187863_10871754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018038|Ga0187855_10223544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300018090|Ga0187770_10742326 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018468|Ga0066662_10170723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1676 | Open in IMG/M |
| 3300020580|Ga0210403_10179298 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300021168|Ga0210406_11349194 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021178|Ga0210408_11488584 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021181|Ga0210388_10205325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1724 | Open in IMG/M |
| 3300021401|Ga0210393_10230295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1501 | Open in IMG/M |
| 3300021474|Ga0210390_10137518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2054 | Open in IMG/M |
| 3300021478|Ga0210402_10822977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300021478|Ga0210402_10986360 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300021478|Ga0210402_11816801 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021559|Ga0210409_11349427 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300022521|Ga0224541_1024787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300022531|Ga0242660_1009860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1605 | Open in IMG/M |
| 3300024331|Ga0247668_1059633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300025460|Ga0208562_1073594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300025906|Ga0207699_10666995 | Not Available | 760 | Open in IMG/M |
| 3300026277|Ga0209350_1096915 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026551|Ga0209648_10770879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300027567|Ga0209115_1027905 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300027633|Ga0208988_1031595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300027635|Ga0209625_1107572 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300027660|Ga0209736_1143767 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027846|Ga0209180_10478031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300027889|Ga0209380_10302297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300027898|Ga0209067_10372300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300027911|Ga0209698_10602144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300027911|Ga0209698_10719887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300028536|Ga0137415_10491805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300028792|Ga0307504_10073927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1030 | Open in IMG/M |
| 3300030741|Ga0265459_14058775 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031236|Ga0302324_100066090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6361 | Open in IMG/M |
| 3300031247|Ga0265340_10343466 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031708|Ga0310686_108717580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300031718|Ga0307474_11436217 | Not Available | 543 | Open in IMG/M |
| 3300031719|Ga0306917_10866492 | Not Available | 707 | Open in IMG/M |
| 3300031720|Ga0307469_12140230 | Not Available | 544 | Open in IMG/M |
| 3300031740|Ga0307468_101798500 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031754|Ga0307475_10862163 | Not Available | 716 | Open in IMG/M |
| 3300031768|Ga0318509_10687109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031820|Ga0307473_11242340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300031823|Ga0307478_10869598 | Not Available | 754 | Open in IMG/M |
| 3300031833|Ga0310917_10628217 | Not Available | 729 | Open in IMG/M |
| 3300031897|Ga0318520_11044873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031962|Ga0307479_10654086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300031962|Ga0307479_10661993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300032180|Ga0307471_100354401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1579 | Open in IMG/M |
| 3300032205|Ga0307472_100115440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1884 | Open in IMG/M |
| 3300032828|Ga0335080_10395748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1483 | Open in IMG/M |
| 3300032829|Ga0335070_11360237 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032892|Ga0335081_10660593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300032954|Ga0335083_10287852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1449 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066677_108318452 | 3300005171 | Soil | QLTDKLFSNRPLKLFLINTGYQFVCYLVMGAIVGKWAGY* |
| Ga0066388_1022454932 | 3300005332 | Tropical Forest Soil | TVQFTDMLFGRRPSRLYLINTGYQLVCYLAMGAILAVWQ* |
| Ga0066388_1054047572 | 3300005332 | Tropical Forest Soil | ATVQFSGALFAKQSMKLLAINTGYQLACCVLGAILGAWK* |
| Ga0070709_108657471 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ATVQFTGALFQKQSRKLFAINTGYQLVCYLAMGAILAAWT* |
| Ga0070732_102074592 | 3300005542 | Surface Soil | VTTVQFTNALFSRQPFRLYMINTGYQFVCYAAMGAILGAWR* |
| Ga0066701_106575971 | 3300005552 | Soil | GTLFSKQPTKLFLINTGYQLVCYLAMGAILAKWPHP* |
| Ga0066703_107143151 | 3300005568 | Soil | VTTVQLTSTLFKKRPIKLYLIDTGYQLVCYLVMGAILARWPK* |
| Ga0070766_102144422 | 3300005921 | Soil | QLTNSLFSRQPARLYAINTGYQLVCYVVMGAILTVWR* |
| Ga0075017_1000184135 | 3300006059 | Watersheds | FVTTVQLTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAVWPR* |
| Ga0075030_1013338141 | 3300006162 | Watersheds | TNALFSRQPFRLYMINTGYQFVCYAVMGAILGAWR* |
| Ga0075014_1008923641 | 3300006174 | Watersheds | FTSALFMKQSMKLFAINTGYQLVCYLIMGTILTLWK* |
| Ga0070765_1006747581 | 3300006176 | Soil | GALFSRQPFKLYLINTGYQAVCYVAMGAILGGWR* |
| Ga0075435_1019968461 | 3300007076 | Populus Rhizosphere | NALFSRQPFKLYMINTGYQFVCYAVMGAILGLWR* |
| Ga0099793_101131501 | 3300007258 | Vadose Zone Soil | VQLTSTLFKKRPIKLYLIDTGYQLVCYLVMGAILARWPK* |
| Ga0066793_107453602 | 3300009029 | Prmafrost Soil | GFVTTVQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH* |
| Ga0099829_101914851 | 3300009038 | Vadose Zone Soil | LTGALFMKSSMKLFAINTGYQLVCYLVMGAILAVWK* |
| Ga0099829_109034061 | 3300009038 | Vadose Zone Soil | VQLTAALFMKNSMKLFAINTGYQLACYLILGAILAVWK* |
| Ga0099830_106113132 | 3300009088 | Vadose Zone Soil | VQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH* |
| Ga0099830_112091252 | 3300009088 | Vadose Zone Soil | FVTTVQLTAKLFGNQPTKLYLINTGYQLVCYLAMGAILAVWPK* |
| Ga0099828_101027564 | 3300009089 | Vadose Zone Soil | QLTGTLFSKQPTKLFLINTGYQLVCYLTMGAILAKWPHP* |
| Ga0099828_104385431 | 3300009089 | Vadose Zone Soil | TTVQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH* |
| Ga0099828_108247962 | 3300009089 | Vadose Zone Soil | TTVQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPR* |
| Ga0105241_100509291 | 3300009174 | Corn Rhizosphere | TTVQLTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAVWPQR* |
| Ga0126373_102714731 | 3300010048 | Tropical Forest Soil | VQFTGALFARQSMKLFAINTGYQLACYLVMGAILVLWK* |
| Ga0099796_102055331 | 3300010159 | Vadose Zone Soil | VQLTNSLFSRQPAKLYAINTGYQLVCYLAMGAIMGAWR* |
| Ga0134111_104896801 | 3300010329 | Grasslands Soil | QLTDALFSKKPFKLYKPYAINTGYQLVCYLVMGTILAAWAS* |
| Ga0134080_100151881 | 3300010333 | Grasslands Soil | VSTVQLTDALFSKKPFKLYKPYAINTGYQLVCYLVMGTILAAWAS* |
| Ga0134063_105361402 | 3300010335 | Grasslands Soil | GALFSKQTMKLFGINTGYQLVCYLLMGVILTLWR* |
| Ga0126370_101594993 | 3300010358 | Tropical Forest Soil | VTTVQFTDMLFGRRPSRLYLINTGYQLVCYLAMGAILAVWQ* |
| Ga0136449_1006011471 | 3300010379 | Peatlands Soil | VTTVQFTGALFSRQPFKLYLINTGYQAVCYLAMGAILGGWR* |
| Ga0126383_114390981 | 3300010398 | Tropical Forest Soil | TVQFTGALFMKQSMKLFAINTGYQLVCYLVMGAILTAWR* |
| Ga0137392_108076012 | 3300011269 | Vadose Zone Soil | GALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPQ* |
| Ga0137391_102565613 | 3300011270 | Vadose Zone Soil | VQLTAKLFGNQSTRLYLINTGYQLVCYLAMGAILAVWPR* |
| Ga0137391_115496871 | 3300011270 | Vadose Zone Soil | FVATVQLTGVLFMKQSMKLFAINTGYQLACYLAMGAILTVWR* |
| Ga0137393_106844452 | 3300011271 | Vadose Zone Soil | GALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH* |
| Ga0137393_115754042 | 3300011271 | Vadose Zone Soil | GFVATVQLTGALFMKQSMKLFGINTGYQLVCYLVMAAILVAWK* |
| Ga0137389_106353341 | 3300012096 | Vadose Zone Soil | KLFGNQPTKLYLINNGYQLMCYLAMGAILAVWPR* |
| Ga0137383_109365562 | 3300012199 | Vadose Zone Soil | VSTVQLTDGLFSKKPFKLYKLYAINTGYQLVCYLVMGTILAAWAS* |
| Ga0137399_110769002 | 3300012203 | Vadose Zone Soil | QLTGALFMKQSMKLFAINTGYQLACYLVMSAILTLWR* |
| Ga0137379_111344302 | 3300012209 | Vadose Zone Soil | VATVQLTGALFMKSSMKLFAINTGYQLVCYLVMGAILAVWK* |
| Ga0150985_1174592481 | 3300012212 | Avena Fatua Rhizosphere | NALFSQQRNRLYMINTGYQLVCYVVMGAILGAWR* |
| Ga0137384_115963121 | 3300012357 | Vadose Zone Soil | TVQLTGALFMKQSMKLFAMNTGFQLVCYLAMSAIMAKWQ* |
| Ga0137360_115355621 | 3300012361 | Vadose Zone Soil | ALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPQ* |
| Ga0137358_103140182 | 3300012582 | Vadose Zone Soil | LTGALFTKQSMKLFAINTGYQLVCYLVMSAILTVWP* |
| Ga0137398_104706313 | 3300012683 | Vadose Zone Soil | LFTKQPMKLFLINTGYQLVCYMVMGAILAKWPHP* |
| Ga0137395_112734012 | 3300012917 | Vadose Zone Soil | VQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPQ* |
| Ga0137396_112892881 | 3300012918 | Vadose Zone Soil | ATVQFTSALFTKQSMKLFAINTGYQLVCYLAMAAILTVWT* |
| Ga0137359_105968202 | 3300012923 | Vadose Zone Soil | QLTGALFTKQSMKLFAINTGYQLVCYLFMSAILTVWR* |
| Ga0137419_100945801 | 3300012925 | Vadose Zone Soil | TGALFAKQSMKLFAINTGYQLFCYLVMGAILTVWS* |
| Ga0137419_112083061 | 3300012925 | Vadose Zone Soil | FTGALFTKQSMKLFGINTGYQLVCYLVMGVILTLWR* |
| Ga0137407_108240641 | 3300012930 | Vadose Zone Soil | TSALFTKQSMKLFGINTGYQLVCYLAMAAILTGWT* |
| Ga0137410_110078231 | 3300012944 | Vadose Zone Soil | TSELFTKQSMKLFGINTGYQLVCYLAMGAILTVWH* |
| Ga0137410_119012541 | 3300012944 | Vadose Zone Soil | VQLTGALFLKQSMKLFAINTGYQLVCYLVMGAILTAWK* |
| Ga0126375_108888622 | 3300012948 | Tropical Forest Soil | FTGALFTKQSMKLFAINTGYQLLCYLVMGAILGAWK* |
| Ga0164301_109070741 | 3300012960 | Soil | LFTNRPMKLFLINTGYQLCCYLAMGAILGKWVGC* |
| Ga0164301_111565651 | 3300012960 | Soil | TAFLFERKPFRLYAINTGYQLVCYLAMGAILAVWL* |
| Ga0134110_104485152 | 3300012975 | Grasslands Soil | VQLTDALFSKKPFKLYKLYAINTGYQLVCYLVMGTILAAWAS* |
| Ga0164307_116971222 | 3300012987 | Soil | VTTVQLTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAMWPR* |
| Ga0157369_122238131 | 3300013105 | Corn Rhizosphere | FTAFLFERKPFRLYAINTGYQLVCYLAMGAILAVWL* |
| Ga0181534_102855581 | 3300014168 | Bog | DSIFGRKPAKLYLINTGYQLVCFVVMGAIVAAWPR* |
| Ga0163163_113019442 | 3300014325 | Switchgrass Rhizosphere | QFTAFLFERKPFRLYAINTGYQLVCYLAMGAILAVWL* |
| Ga0137405_13279423 | 3300015053 | Vadose Zone Soil | MLGFHVWLGFVATVQFTGALFAKQSMKLCHQHRYQLVCYLVMAVILTVWR* |
| Ga0137420_11960712 | 3300015054 | Vadose Zone Soil | QLTGVLFMKQSMKLFAINTGYQLVCYLVMGTILAAWR* |
| Ga0137420_13008962 | 3300015054 | Vadose Zone Soil | QFTGALFMKQSMKLFAINTSYQLVCYLVMGSILTVWK* |
| Ga0137409_108639622 | 3300015245 | Vadose Zone Soil | MGALFLKQSMKLFAINTGYQLVCYLVMGAILTAWK* |
| Ga0137403_100181599 | 3300015264 | Vadose Zone Soil | TSALFTKQSMKLFAINTGYQLVCYLFMSAILTVWR* |
| Ga0187819_107646392 | 3300017943 | Freshwater Sediment | TGALFSRQPFKLYLINTGYQAVCYLAMGAILGGWR |
| Ga0187863_108717541 | 3300018034 | Peatland | TTVQLTNALFSRQPARLYAINTGYQLVCYVVMGAILAVWR |
| Ga0187855_102235443 | 3300018038 | Peatland | TVQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH |
| Ga0187770_107423262 | 3300018090 | Tropical Peatland | VQLTGALFSKQPARLFLINTGYQLVCYLAMGAILAKWPR |
| Ga0066662_101707231 | 3300018468 | Grasslands Soil | TTVQLTGALFGKQPTKLYLINTGYQLVCYLIMGAILAKWPH |
| Ga0210403_101792981 | 3300020580 | Soil | QLTGVLFMKQSMKLFAINTGYQLVCYLVMGAILGAWS |
| Ga0210406_113491942 | 3300021168 | Soil | VQLTAKLFGNQPTKLYLINTSYQLVCYLVMGAILAVWPR |
| Ga0210408_114885841 | 3300021178 | Soil | LTGVLFMKQSIKLFAINTGYQLVCYLVMGAILAAWQ |
| Ga0210388_102053251 | 3300021181 | Soil | TNSLFSRQPARLYAINTGYQLVCYVVMGAILTVWR |
| Ga0210393_102302951 | 3300021401 | Soil | DVATVQLTGVLFMKQSMKLFAINTGYQLACYLAMGSILTLWR |
| Ga0210390_101375183 | 3300021474 | Soil | LTGVLFMKQSMKLFAINTGYQLVCYLAMAAILSAWR |
| Ga0210402_108229772 | 3300021478 | Soil | TVQLTGALFMKQSMKLFAINTGYQLVCYLVMGVILTAWK |
| Ga0210402_109863602 | 3300021478 | Soil | ATVQLTCVLFMKQSMKLFAINTGYQLVCYLVMGAILGAWS |
| Ga0210402_118168011 | 3300021478 | Soil | TVPLTNALFSRQPARLYAINTGYQLVCYVVMGAILAVWR |
| Ga0210409_113494272 | 3300021559 | Soil | QLTDKLFSNRPLKLFLINTGYQLVCYLVMGAIVGKWAGA |
| Ga0224541_10247872 | 3300022521 | Soil | TGTLFSKQPTKLYLINTGYQLVCYLAMGAILAKWPQ |
| Ga0242660_10098601 | 3300022531 | Soil | TVQFTNALFSRQPFRLYMINTGYQFVCYAVMGAILGAWR |
| Ga0247668_10596332 | 3300024331 | Soil | TVQFTGALFAKQSMKLFGINTGYQLVSYLVMSAILGAWR |
| Ga0208562_10735942 | 3300025460 | Peatland | TGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH |
| Ga0207699_106669952 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ATVQFTGALFQKQSRKLFAINTGYQLVCYLAMGAILAAWT |
| Ga0209350_10969152 | 3300026277 | Grasslands Soil | FTGALFAKQSMRLFAINTGYQLVCYLVMGAILTVWR |
| Ga0209648_107708792 | 3300026551 | Grasslands Soil | GALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPH |
| Ga0209115_10279052 | 3300027567 | Forest Soil | VTTVQLTNALFMRQPAQLYALNTGYQLVCYGVMGAIMAAWR |
| Ga0208988_10315952 | 3300027633 | Forest Soil | ATVQLTGVLFMKQSMKLFAINTGYQLVCYLVMGTILAAWR |
| Ga0209625_11075722 | 3300027635 | Forest Soil | VQFTNALFSRQPFRLYMINTGYQFVCYAVMGTILGAWR |
| Ga0209736_11437672 | 3300027660 | Forest Soil | VQLTGVLFMKQSMKLFAINTGYQLVCYLVMGAILAVWT |
| Ga0209180_104780312 | 3300027846 | Vadose Zone Soil | LTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPQ |
| Ga0209380_103022971 | 3300027889 | Soil | VQLTGALFGKQPAKLYLINTGYQLVSYLVVGAILAKWPR |
| Ga0209067_103723001 | 3300027898 | Watersheds | VQFTSALFTKQSMKLFAINTGYQLVCYLAMGTILALWH |
| Ga0209698_106021441 | 3300027911 | Watersheds | GALFSKQPTKLYLINTGYQLVCYLAMGAILAKWPH |
| Ga0209698_107198871 | 3300027911 | Watersheds | QLTNVLFAKQPVKLYLINTGYQLVCYLAMGAILALWH |
| Ga0137415_104918051 | 3300028536 | Vadose Zone Soil | QFTGALFAKQSMKLFGINTGYQLVCYLVMGAILAVWR |
| Ga0307504_100739271 | 3300028792 | Soil | TVQLTGALFSKQPTKLFLINTGYQLVCYLAMGAILAKWPHP |
| Ga0265459_140587752 | 3300030741 | Soil | VTSVQLTNALFMRQPAKLYAINTGYQLVCYVVMGAIMAAWR |
| Ga0302324_1000660901 | 3300031236 | Palsa | FTMTVQLTAALFSHKNKTLFFIDTGYQLVCYLAMGGILGGWQ |
| Ga0265340_103434662 | 3300031247 | Rhizosphere | QLTGALFGKQPIKLFLINTGYQLVCYLAMGAILAKWPH |
| Ga0310686_1087175803 | 3300031708 | Soil | ATVQLTGVLFANQSGKLFAINTGYQFVCYAAMGAILAVWK |
| Ga0307474_114362171 | 3300031718 | Hardwood Forest Soil | TVQLTYALFGRQATRLYLINTSYLLVSYVAMGAILGAWR |
| Ga0306917_108664921 | 3300031719 | Soil | LTDQMFGHRPFKLFLINTGYQLAAYVAMGAILGKWAGA |
| Ga0307469_121402301 | 3300031720 | Hardwood Forest Soil | VQFTDMLFQKKSLKLFAINTAYQLLCYLAMGAILAAWT |
| Ga0307468_1017985001 | 3300031740 | Hardwood Forest Soil | KLFGKRPMKLFLINTGYQLVCYLAMGAILGKWVGC |
| Ga0307475_108621631 | 3300031754 | Hardwood Forest Soil | QLTNSLFMRQPARLYAINTGYQLICFLAMGAILGTWQ |
| Ga0318509_106871092 | 3300031768 | Soil | VQFTGALFARQSMKLFAINTGYQLACYLVMGAILVLWK |
| Ga0307473_112423401 | 3300031820 | Hardwood Forest Soil | VQLTGTLFTKQPMKLFLINTGYQLVCYMAMGAILAKWPHP |
| Ga0307478_108695981 | 3300031823 | Hardwood Forest Soil | VTTVQLTNALFMRQPAKLYAINTGYQLVCYVVMGAIMAAWR |
| Ga0310917_106282172 | 3300031833 | Soil | TDQMFGHRPFKLFLINTGYQLAAYVAMGAILGKWAGA |
| Ga0318520_110448731 | 3300031897 | Soil | QLTGALFGRQPTRLYLINTGYQLVCYLAMGAILAVWPH |
| Ga0307479_106540861 | 3300031962 | Hardwood Forest Soil | TTVQLTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAVWPH |
| Ga0307479_106619933 | 3300031962 | Hardwood Forest Soil | TGALFMKQSMKLFAINTGYQLVCYLVMGAILAVWQ |
| Ga0307471_1003544011 | 3300032180 | Hardwood Forest Soil | VTTVQLTGALFGKQPTKLYLINTGYQLVCYLAMGAILAKWPQ |
| Ga0307472_1001154401 | 3300032205 | Hardwood Forest Soil | FVTTVQLTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAVWPS |
| Ga0335080_103957483 | 3300032828 | Soil | LTNALFSRQRNRLYMINTGYQLVCYVAMGAILGAWR |
| Ga0335070_113602372 | 3300032829 | Soil | LTAKLFGNQSTKLYLINTGYQLVCYLAMGAILAVWPR |
| Ga0335081_106605931 | 3300032892 | Soil | VQFSNNRFNRKPFQLYLIDTGYQLVCYLAMGAILAAWPR |
| Ga0335083_102878521 | 3300032954 | Soil | FVTTVQLTNGLFSKQPARLYAINTGYQLVCYLASGAILGIWR |
| ⦗Top⦘ |