


| Basic Information | |
|---|---|
| Family ID | F072555 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ALIESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.54 % |
| % of genes near scaffold ends (potentially truncated) | 91.74 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.512 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.620 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.661 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 10.74 |
| PF02518 | HATPase_c | 5.79 |
| PF13796 | Sensor | 4.96 |
| PF13620 | CarboxypepD_reg | 2.48 |
| PF10099 | RskA | 2.48 |
| PF02321 | OEP | 2.48 |
| PF04116 | FA_hydroxylase | 2.48 |
| PF05922 | Inhibitor_I9 | 2.48 |
| PF03551 | PadR | 1.65 |
| PF07879 | PHB_acc_N | 1.65 |
| PF04966 | OprB | 1.65 |
| PF03279 | Lip_A_acyltrans | 1.65 |
| PF13522 | GATase_6 | 1.65 |
| PF00871 | Acetate_kinase | 1.65 |
| PF13442 | Cytochrome_CBB3 | 1.65 |
| PF00196 | GerE | 0.83 |
| PF02878 | PGM_PMM_I | 0.83 |
| PF01979 | Amidohydro_1 | 0.83 |
| PF08281 | Sigma70_r4_2 | 0.83 |
| PF05362 | Lon_C | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF02879 | PGM_PMM_II | 0.83 |
| PF00892 | EamA | 0.83 |
| PF02705 | K_trans | 0.83 |
| PF02607 | B12-binding_2 | 0.83 |
| PF04972 | BON | 0.83 |
| PF03150 | CCP_MauG | 0.83 |
| PF02371 | Transposase_20 | 0.83 |
| PF02954 | HTH_8 | 0.83 |
| PF02583 | Trns_repr_metal | 0.83 |
| PF03448 | MgtE_N | 0.83 |
| PF08327 | AHSA1 | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF04115 | Ureidogly_lyase | 0.83 |
| PF10048 | DUF2282 | 0.83 |
| PF07642 | BBP2 | 0.83 |
| PF00593 | TonB_dep_Rec | 0.83 |
| PF00916 | Sulfate_transp | 0.83 |
| PF02735 | Ku | 0.83 |
| PF02113 | Peptidase_S13 | 0.83 |
| PF05036 | SPOR | 0.83 |
| PF00512 | HisKA | 0.83 |
| PF02687 | FtsX | 0.83 |
| PF00450 | Peptidase_S10 | 0.83 |
| PF01544 | CorA | 0.83 |
| PF08530 | PepX_C | 0.83 |
| PF01047 | MarR | 0.83 |
| PF01814 | Hemerythrin | 0.83 |
| PF13411 | MerR_1 | 0.83 |
| PF13191 | AAA_16 | 0.83 |
| PF00873 | ACR_tran | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 4.96 |
| COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 2.48 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 2.48 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.65 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 1.65 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.65 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 1.65 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.65 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.65 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.65 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 1.65 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.65 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 1.65 |
| COG5394 | Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHA | Signal transduction mechanisms [T] | 1.65 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.83 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.83 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.83 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.83 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.83 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.83 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.83 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.83 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 0.83 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.83 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.51 % |
| Unclassified | root | N/A | 21.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10194715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1089 | Open in IMG/M |
| 3300004080|Ga0062385_10202474 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300004091|Ga0062387_101572135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300004092|Ga0062389_102414942 | Not Available | 696 | Open in IMG/M |
| 3300004092|Ga0062389_102901288 | Not Available | 641 | Open in IMG/M |
| 3300004092|Ga0062389_104353285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300004152|Ga0062386_100175795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1678 | Open in IMG/M |
| 3300005541|Ga0070733_11048980 | Not Available | 547 | Open in IMG/M |
| 3300005542|Ga0070732_10451420 | Not Available | 777 | Open in IMG/M |
| 3300005542|Ga0070732_10844959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005591|Ga0070761_10289957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300005921|Ga0070766_10513960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 797 | Open in IMG/M |
| 3300006176|Ga0070765_100390740 | Not Available | 1297 | Open in IMG/M |
| 3300006176|Ga0070765_100901018 | Not Available | 836 | Open in IMG/M |
| 3300009101|Ga0105247_10382032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 999 | Open in IMG/M |
| 3300009665|Ga0116135_1269487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 666 | Open in IMG/M |
| 3300009672|Ga0116215_1539689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300010341|Ga0074045_10644623 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010361|Ga0126378_11729374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300010877|Ga0126356_10171389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300010877|Ga0126356_11014105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 601 | Open in IMG/M |
| 3300011120|Ga0150983_11301193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300012203|Ga0137399_10602915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 923 | Open in IMG/M |
| 3300012203|Ga0137399_11264276 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012203|Ga0137399_11395902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 586 | Open in IMG/M |
| 3300012363|Ga0137390_10615565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300012929|Ga0137404_11152264 | Not Available | 712 | Open in IMG/M |
| 3300014167|Ga0181528_10377734 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300014325|Ga0163163_10363275 | Not Available | 1504 | Open in IMG/M |
| 3300014501|Ga0182024_11015569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300014657|Ga0181522_10514144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 722 | Open in IMG/M |
| 3300016387|Ga0182040_11523501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300016404|Ga0182037_11905324 | Not Available | 532 | Open in IMG/M |
| 3300017973|Ga0187780_11359042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300018025|Ga0187885_10470566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 561 | Open in IMG/M |
| 3300018037|Ga0187883_10157057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1170 | Open in IMG/M |
| 3300018058|Ga0187766_10530835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 796 | Open in IMG/M |
| 3300018085|Ga0187772_10602673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 781 | Open in IMG/M |
| 3300018086|Ga0187769_10520277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 898 | Open in IMG/M |
| 3300019886|Ga0193727_1013718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3047 | Open in IMG/M |
| 3300019886|Ga0193727_1026778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2006 | Open in IMG/M |
| 3300020199|Ga0179592_10036462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2224 | Open in IMG/M |
| 3300020582|Ga0210395_10259423 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300021168|Ga0210406_10900911 | Not Available | 665 | Open in IMG/M |
| 3300021168|Ga0210406_11086628 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021384|Ga0213876_10596682 | Not Available | 588 | Open in IMG/M |
| 3300021401|Ga0210393_10457870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 1041 | Open in IMG/M |
| 3300021403|Ga0210397_10746077 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300021405|Ga0210387_10205589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1709 | Open in IMG/M |
| 3300021406|Ga0210386_10120601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2169 | Open in IMG/M |
| 3300021420|Ga0210394_10110673 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300021433|Ga0210391_11385329 | Not Available | 541 | Open in IMG/M |
| 3300021474|Ga0210390_10249990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 1502 | Open in IMG/M |
| 3300021477|Ga0210398_10517234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
| 3300021479|Ga0210410_10868188 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021560|Ga0126371_13019540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 570 | Open in IMG/M |
| 3300021560|Ga0126371_13838469 | Not Available | 506 | Open in IMG/M |
| 3300022724|Ga0242665_10219678 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300022917|Ga0247777_1076379 | Not Available | 1149 | Open in IMG/M |
| 3300023101|Ga0224557_1076649 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300023267|Ga0247771_1125134 | Not Available | 764 | Open in IMG/M |
| 3300026508|Ga0257161_1131144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 526 | Open in IMG/M |
| 3300026941|Ga0207741_1012074 | Not Available | 990 | Open in IMG/M |
| 3300027817|Ga0209112_10122383 | Not Available | 856 | Open in IMG/M |
| 3300027826|Ga0209060_10491556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 557 | Open in IMG/M |
| 3300027867|Ga0209167_10194227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300027867|Ga0209167_10658833 | Not Available | 573 | Open in IMG/M |
| 3300027911|Ga0209698_11256087 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300028536|Ga0137415_10505984 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300028747|Ga0302219_10446384 | Not Available | 508 | Open in IMG/M |
| 3300028765|Ga0302198_10447052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 584 | Open in IMG/M |
| 3300028775|Ga0302231_10108392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300028808|Ga0302228_10179361 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300028813|Ga0302157_10355281 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300028813|Ga0302157_10525701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Xylophilus → unclassified Xylophilus → Xylophilus sp. ASV27 | 616 | Open in IMG/M |
| 3300028867|Ga0302146_10178049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300029908|Ga0311341_10789313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300029945|Ga0311330_10531850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 939 | Open in IMG/M |
| 3300029954|Ga0311331_10556326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300029992|Ga0302276_10075830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1868 | Open in IMG/M |
| 3300029997|Ga0302302_1136370 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300030046|Ga0302305_1345954 | Not Available | 504 | Open in IMG/M |
| 3300030051|Ga0302195_10473731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 536 | Open in IMG/M |
| 3300030053|Ga0302177_10385339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 736 | Open in IMG/M |
| 3300030056|Ga0302181_10016454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4319 | Open in IMG/M |
| 3300030503|Ga0311370_10589951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300030617|Ga0311356_10862657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 855 | Open in IMG/M |
| 3300030688|Ga0311345_10221750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1887 | Open in IMG/M |
| 3300031128|Ga0170823_13908710 | Not Available | 606 | Open in IMG/M |
| 3300031546|Ga0318538_10115907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1396 | Open in IMG/M |
| 3300031708|Ga0310686_102800472 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300031713|Ga0318496_10007764 | All Organisms → cellular organisms → Bacteria | 4942 | Open in IMG/M |
| 3300031736|Ga0318501_10003320 | All Organisms → cellular organisms → Bacteria | 5324 | Open in IMG/M |
| 3300031754|Ga0307475_10217339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1529 | Open in IMG/M |
| 3300031765|Ga0318554_10556922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 647 | Open in IMG/M |
| 3300031797|Ga0318550_10180619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 1018 | Open in IMG/M |
| 3300031823|Ga0307478_10591918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 928 | Open in IMG/M |
| 3300031823|Ga0307478_10598661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 922 | Open in IMG/M |
| 3300031835|Ga0318517_10372161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300031845|Ga0318511_10375303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300031890|Ga0306925_12185107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031893|Ga0318536_10156344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1159 | Open in IMG/M |
| 3300031893|Ga0318536_10415606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300031912|Ga0306921_12472083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 540 | Open in IMG/M |
| 3300031945|Ga0310913_10366923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 1020 | Open in IMG/M |
| 3300031946|Ga0310910_10131657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis → Gloeobacter kilaueensis JS1 | 1895 | Open in IMG/M |
| 3300031959|Ga0318530_10456255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300032039|Ga0318559_10249987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300032051|Ga0318532_10201339 | Not Available | 707 | Open in IMG/M |
| 3300032059|Ga0318533_10775368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300032068|Ga0318553_10636942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300032091|Ga0318577_10238287 | Not Available | 871 | Open in IMG/M |
| 3300032828|Ga0335080_11264100 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300032893|Ga0335069_10486882 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300032898|Ga0335072_10562508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300032954|Ga0335083_10534696 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300032955|Ga0335076_11262655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300033545|Ga0316214_1066230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Telmatospirillum → unclassified Telmatospirillum → Telmatospirillum sp. | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.65% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023267 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L197-509C-6 | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_101947152 | 3300004080 | Bog Forest Soil | ALIEIDGLSLNDAHALDLFKNEGLAPDAAKRIAKFFGKPEHPA* |
| Ga0062385_102024743 | 3300004080 | Bog Forest Soil | ALIEIDGLSLNDAHALDLFKNEGLAPDAAKRIAKFFGKPERPA* |
| Ga0062387_1015721351 | 3300004091 | Bog Forest Soil | NKRALIEIDGLSLKDAHGLDLFKNEGLAPDAAERIAKFFARR* |
| Ga0062389_1024149421 | 3300004092 | Bog Forest Soil | SDGLSLRDSHALEIFKNEGLAPDAAQRVQKFLARRKPPA* |
| Ga0062389_1029012882 | 3300004092 | Bog Forest Soil | IEIDGLSLIDAHALDLFKNEGLAPDAAKRIAKFFAKPERPA* |
| Ga0062389_1043532852 | 3300004092 | Bog Forest Soil | SDGLSLRDSHALEIFKNEGLAPDAARRVEKFLARRKPPT* |
| Ga0062386_1001757951 | 3300004152 | Bog Forest Soil | IEIDGLSLHDAHALEMFKNEGLAPDAAQRVAKFFTERDPIA* |
| Ga0070733_110489802 | 3300005541 | Surface Soil | GLSLREAHGLELFKNEGLAPDAARRVEQFFKERKDAGR* |
| Ga0070732_104514201 | 3300005542 | Surface Soil | LLQTDGMTRRDAYALDLFKNEGFAPDAHRRVEAFFRRRKGLD* |
| Ga0070732_108449592 | 3300005542 | Surface Soil | SDGLTLREAHGLNMFKNEGLAPDAAQRVARFFKKHKKGS* |
| Ga0070761_102899571 | 3300005591 | Soil | LSLRDANALEMFKNEGLAPDAEKRVSQFFARSKP* |
| Ga0070766_105139601 | 3300005921 | Soil | VIKRLLIDSDGLTLRDAYALDLFKNEGLAPDAQQRIGKFFKPG* |
| Ga0070765_1003907401 | 3300006176 | Soil | KRALIEVDGLSLHEAHGLEMFKNEGLAPDAAQRVAKFTAKKE* |
| Ga0070765_1009010181 | 3300006176 | Soil | IETDGLSLHDSHALELFKNEGLAPDAAKRIVKFFSRQ* |
| Ga0105247_103820322 | 3300009101 | Switchgrass Rhizosphere | VIKHALLETEGMTLRDAYALDLFKNEGLAPDASKRVAEFFKRPKPEG* |
| Ga0116135_12694871 | 3300009665 | Peatland | KRALVASDKLTLREAHDLEIFKNEGLAPDAHTRVTQFINRKKT* |
| Ga0116215_15396892 | 3300009672 | Peatlands Soil | VNQVNKRALIEIDGLSLQDAHALELFKNEGLAPDAKQRIAKFFAKREPPA* |
| Ga0074045_106446231 | 3300010341 | Bog Forest Soil | IETDGLSLQDSHALELFKNEGLAPDAKQRMAKFFAKRVPPA* |
| Ga0126378_117293742 | 3300010361 | Tropical Forest Soil | IASDGLSLRDAHALEIFKNEGLAPDAAQRVRKFLKRPKSPS* |
| Ga0126356_101713891 | 3300010877 | Boreal Forest Soil | ALIEIDGLSLHDAHALEMFKNEGLAPDASLRVAKFLGKRAP* |
| Ga0126356_110141052 | 3300010877 | Boreal Forest Soil | QVNKRALIEIDGLSLHDAHALELFKNEGLAPDAGQRIARFFAKRRPPT* |
| Ga0150983_113011931 | 3300011120 | Forest Soil | LIEIDGLSLHDAHALELFKNEGLAPDAAKRIAKFFAKRE* |
| Ga0137399_106029152 | 3300012203 | Vadose Zone Soil | NKRALIEIDGLSLHDAHALELFKNEGLAPDAAKRIAKFFAKRE* |
| Ga0137399_112642761 | 3300012203 | Vadose Zone Soil | NQVNKRALLESAGLTLRAAHALELFKNEGLAPDAAQRIAKFFARRKPQA* |
| Ga0137399_113959021 | 3300012203 | Vadose Zone Soil | LTLREAHALELFKNEGLAPDAQQRVAKFFKRDRGPRKP* |
| Ga0137390_106155652 | 3300012363 | Vadose Zone Soil | VNKRALVEIDGLSLHDAHALELFNNEGLAPDAAHRLAKFFTKRA* |
| Ga0137404_111522642 | 3300012929 | Vadose Zone Soil | VNKRALIESDGLTLRAAHALELFKNEGLAPDAPARVAKFFKAGKPPG* |
| Ga0181528_103777342 | 3300014167 | Bog | SLIAIDGLSLRDSHGLELFKNEGLAPDAAKRVEAFFLPRKDGGR* |
| Ga0163163_103632752 | 3300014325 | Switchgrass Rhizosphere | TLHDAYALDLFKNEGLAPDAAKRVADFFKKRKPGG* |
| Ga0182024_110155691 | 3300014501 | Permafrost | VNKRALIEIDGLSLQDADALELFKNEGLAPDAAQRIAKFFARRA* |
| Ga0181522_105141441 | 3300014657 | Bog | ESDGLSLRDAHALEIFKNEGLAPDAAQRIERFFRRKKP* |
| Ga0182040_115235011 | 3300016387 | Soil | NKRALIESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Ga0182037_119053242 | 3300016404 | Soil | LTLREAHALNLFKNEGLAPDAAQRVARFFKARKKGS |
| Ga0187780_113590421 | 3300017973 | Tropical Peatland | KRALTASDGLSLHDAHALEMFKNEGLAPDAARRVAQFAKRRRTDT |
| Ga0187885_104705662 | 3300018025 | Peatland | RALIEIDGLSLHDAHGLEMFKNEGLAPDAQQRVAKFLTKREPSAQ |
| Ga0187883_101570571 | 3300018037 | Peatland | HVNKRALIEIDGLSLRDAHALELFKNEGLAPDAGKRVAKFFKQGKPSV |
| Ga0187766_105308351 | 3300018058 | Tropical Peatland | QVDKRALLESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKKQKKG |
| Ga0187772_106026731 | 3300018085 | Tropical Peatland | VNKRALIEIDGLSLSEAHTLELFKHEALAPDASKRVAKFFARGKPARQ |
| Ga0187769_105202771 | 3300018086 | Tropical Peatland | EIDGLSLSEAHTLELFKHEALAPDASKRVAKFFARGKPARQ |
| Ga0181510_12460791 | 3300019240 | Peatland | GLSLRDSHALELFKNEGLAPDAAQRIAKFFKLDKDHK |
| Ga0193727_10137184 | 3300019886 | Soil | LIETDGLSLHDAHALELFKNEGLAPDAGKRLAKFFLPAS |
| Ga0193727_10267781 | 3300019886 | Soil | ANQVNKRALIETDGLSLHDAHRLELFKNEGLAPDAGKRVAKFFSAGH |
| Ga0179592_100364622 | 3300020199 | Vadose Zone Soil | LTLREAHALELFKNEGLAPDAQQRVAKFFKRDRGPRKP |
| Ga0210395_102594231 | 3300020582 | Soil | DGLSLSDAHALDLFKNEGLAPDAAKRIAKFFAKPERPA |
| Ga0210406_109009111 | 3300021168 | Soil | RALIEIDGLSLHDAHALEMFKNEGLAPDAGQRVARFTEK |
| Ga0210406_110866282 | 3300021168 | Soil | NRVTKQALIAIDGLSLNDAHALEIFKNEGLAPDAAQRVTQFFSKR |
| Ga0213876_105966822 | 3300021384 | Plant Roots | RALIETDGLPLKDAYALDLFKNEGLAPDAPKRVATFLKGRREK |
| Ga0210393_104578702 | 3300021401 | Soil | ANQVNKRALIEIDGLSLQDAHALELFKNEGLAPDAAQRIAKFFARRAPRE |
| Ga0210397_107460771 | 3300021403 | Soil | LTLHDAHALALFKNEGLAPDALARVTKFFKDRKPGN |
| Ga0210387_102055893 | 3300021405 | Soil | KRALIETDGLSLHDSHALELFKNEGLAPDAAKRIAKFFSR |
| Ga0210386_101206014 | 3300021406 | Soil | EGLTLRDAYALDMFKNEGLAPDAAKRVTQFCKKKLKPEG |
| Ga0210394_101106733 | 3300021420 | Soil | IEIDGLSLSDAHALDLFKNEGLAPDAAKRIAKFFAKPERPA |
| Ga0210391_113853291 | 3300021433 | Soil | ETDAMSLHDAHALDLFKNEGLAPDAGKRIAKFFAGEAAKAQ |
| Ga0210390_102499901 | 3300021474 | Soil | GLTLRDAYALDMFKNEGLAPDAAKRVTQFCKKKLKPEG |
| Ga0210398_105172341 | 3300021477 | Soil | DGMSLADAHALELFKNEGLAPDALQRVETFFKRQKPKPT |
| Ga0210410_108681881 | 3300021479 | Soil | IEIDGLSLHDAHALELFKNEGLAPDAAQRIAKFFAKRA |
| Ga0126371_130195401 | 3300021560 | Tropical Forest Soil | VIKRALIETEGMTLRDAYALDLFKNEGLAPDAVKRVQQFLKRPKSGT |
| Ga0126371_138384691 | 3300021560 | Tropical Forest Soil | TLREAHALNLFKNEGLAPDAAQRVARFLKKPKKSS |
| Ga0242665_102196782 | 3300022724 | Soil | RVNKQALIESDKLTLSDAHALELFKNEGVAPDAQQRIAKFFNQGKPAS |
| Ga0247777_10763793 | 3300022917 | Plant Litter | QVIKRALMETDGMALREAYALDLFKNEGLAPDAVKRVAQFVGRRKVT |
| Ga0224557_10766493 | 3300023101 | Soil | KRALIEIDGLSLHEAHGLEMFKNEGLAPDARQRVAKFFTRREPSAQ |
| Ga0247771_11251341 | 3300023267 | Plant Litter | QVIKRALMETDGMTLREAYALDLFKNEGLAPDAVKRVAQFVGRRKVT |
| Ga0257161_11311442 | 3300026508 | Soil | RVNKRALIESDKLTLREAHALELFKNEGMAPDAQQRVAKFFKRDRGPRKP |
| Ga0207741_10120742 | 3300026941 | Tropical Forest Soil | VNKRVLIASDGLTLREAHALEMFKDEGLAPDASARLRRFIAKSGK |
| Ga0209112_101223832 | 3300027817 | Forest Soil | ARVLIETDGLSLHDSHALELFKNEGLAPDAAKRIAKFFTPS |
| Ga0209060_104915561 | 3300027826 | Surface Soil | QALIRSDGLSLRDSHALELFKNEGLAPDAAQRVARFFRRHKPGVQS |
| Ga0209167_101942272 | 3300027867 | Surface Soil | ESSGLTLHEAHALNLFKNEGLAPDAVQRVTRFFNARKSRP |
| Ga0209167_106588332 | 3300027867 | Surface Soil | NKRALIAIDGLSLREAHGLELFKNEGLAPDAARRVEQFFKERKDAGR |
| Ga0209698_112560872 | 3300027911 | Watersheds | LLASDGMSLADAHELELFKNEGLAPDALQRVDAFFKRRKS |
| Ga0137415_105059841 | 3300028536 | Vadose Zone Soil | AGLTLRAAHALELFKNEGLAPDAAQRIAKFFARRKPQA |
| Ga0302219_104463842 | 3300028747 | Palsa | KRALIEIDGLSLHDAHGLELFKNEGLAPDAAQRIEKFLSKQKRPA |
| Ga0302198_104470521 | 3300028765 | Bog | NKRALIEIDGLSLHDAHGLELFKNEGLAPDAAQRIEKFLAQHKTPE |
| Ga0302231_101083922 | 3300028775 | Palsa | GLSLKEAHGLELFKNEGLAPDAAQRISKFLAKGEPSA |
| Ga0302223_103146123 | 3300028781 | Palsa | GLTLHDAHALELFKNDGLAPDARQRVEKFFEQHKPGS |
| Ga0302228_101793611 | 3300028808 | Palsa | LETDGLSLSDSHALEFFKNEGLAPDAAQRVAKFFAK |
| Ga0302157_103552812 | 3300028813 | Bog | CDGLSLEEAHAMELFKNEGLAPDALQRVEAFFSRRRT |
| Ga0302157_105257012 | 3300028813 | Bog | LSLHDAHALEMFKNEGLAPDAAERVAKFALRKPLTG |
| Ga0302146_101780492 | 3300028867 | Bog | RALIEIDGLSLRNAHRLDLFKNEGLAPDAVKRLETFFTRRDPSAGS |
| Ga0311341_107893132 | 3300029908 | Bog | KRALMQIDGLSLHDAHSLELFKNEGLAPDAEQRVARYFEKGKAPR |
| Ga0311330_105318503 | 3300029945 | Bog | RALIEIDGLSLRAAHALELFKNEGLAPDAGQRVADFLAKRTPST |
| Ga0311331_105563262 | 3300029954 | Bog | RALMQIDGLSLHDAHALELFKNEGLAPDAEQRVARFFEKHKPHP |
| Ga0302276_100758301 | 3300029992 | Bog | IEIDGLSLHDAHALELFKNEGLAPDAALRVAKFMAKASRR |
| Ga0302302_11363701 | 3300029997 | Palsa | NKRALIEVDGLSLQEAHGLEMFKNEGLAPDAAQRIGKFTTPSE |
| Ga0302305_13459541 | 3300030046 | Palsa | RALMASHGLTLHDAHALELFKNDGLAPDARQRVEKFFEQHKPGS |
| Ga0302195_104737312 | 3300030051 | Bog | KRALIAIDGLSLKAAHGLELFKNEGLAPDAAQRIEKFLTKGQPD |
| Ga0302177_103853392 | 3300030053 | Palsa | RALIEIDGLNLQDAHGLELFKNEGLAPDAAQRVAKFLARRGPAA |
| Ga0302181_100164544 | 3300030056 | Palsa | LQESDGLSLRDAHALELFKNEGLAPDAAQRIERFFRRDKP |
| Ga0311370_105899513 | 3300030503 | Palsa | ALIASDGLTLKAAHALELFKNEGLAPDAQKRIARFFDKHKPKA |
| Ga0311356_108626571 | 3300030617 | Palsa | TDGLSLSDAHALDLFKNEGLAPDAKHRIAQFFTTHEPST |
| Ga0311345_102217503 | 3300030688 | Bog | IDGLSLKAAHGLELFKNEGLAPDAAQRIEKFLTKGQPD |
| Ga0170823_139087102 | 3300031128 | Forest Soil | QVNKRALIETDGLSLNDAHSLELFKNEGLAPDAAKRIAKFFSH |
| Ga0318538_101159071 | 3300031546 | Soil | GLTLRDAHALSLFKNEGLAPDAPQRVARFFKQRKPGP |
| Ga0310686_1028004723 | 3300031708 | Soil | IEIDGLSLHDAHALELFKNEGLAPDAARRIAKFFDKRE |
| Ga0318496_100077643 | 3300031713 | Soil | GLTLRDAHALNLFKNEGLAPDAAQRVARFFKTRKKGA |
| Ga0318501_100033201 | 3300031736 | Soil | TLREAHALNLFKNEGLAPDAAQRVARFFKARKKGS |
| Ga0307475_102173392 | 3300031754 | Hardwood Forest Soil | VDKRALLESDGLTLREAHGLNMFKNEGLAPDAAQRVARFFKKHKKGS |
| Ga0318554_105569221 | 3300031765 | Soil | LESAGLTLREAHALSMFKNEGLAPDAAQRVARFFKRHKT |
| Ga0318550_101806191 | 3300031797 | Soil | ALIESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Ga0307478_105919182 | 3300031823 | Hardwood Forest Soil | ALIETEGLTLRDAYALDMFKNEGLAPDAAKRVTQFCKKKLKPEG |
| Ga0307478_105986611 | 3300031823 | Hardwood Forest Soil | LREAYALDLFKNEGLAPDAAKRVAKFCKKQPKSQG |
| Ga0318517_103721612 | 3300031835 | Soil | LLESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKKRKT |
| Ga0318511_103753031 | 3300031845 | Soil | IESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Ga0306925_121851071 | 3300031890 | Soil | RALLESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKKRKT |
| Ga0318536_101563442 | 3300031893 | Soil | DKRALIESDGLTLRDAHSLSLFKNEGLAPDAAQRVARFFKPRKPGP |
| Ga0318536_104156061 | 3300031893 | Soil | LTLHDAHALRMFKNEGLAPDALQRVTRFFKARKKGS |
| Ga0306921_124720832 | 3300031912 | Soil | ESDGLTLRDAHDLRLFKNEGLAPDAAQRVARFFKKKGP |
| Ga0310913_103669231 | 3300031945 | Soil | RVDKRALIESDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Ga0310910_101316571 | 3300031946 | Soil | DKRALLESDGLTLRAAHALSLFKNEGLAPDAAQRVARFFKRHKT |
| Ga0318530_104562551 | 3300031959 | Soil | LESDGLTLRDAHALNLFKNEGLAPDAAQRVARFFKTRKKGA |
| Ga0307479_100357762 | 3300031962 | Hardwood Forest Soil | MTLSNAHALELFKNEGVAPDAQQRIAKFFKQGKQTN |
| Ga0318559_102499871 | 3300032039 | Soil | ESDGLTLRESHALSLFKNEGLAPDAAQRVARFFKRAKPSG |
| Ga0318532_102013391 | 3300032051 | Soil | GLTLREAHALNLFKNEGLAPDAAQRVARFFKARKKGS |
| Ga0318533_107753682 | 3300032059 | Soil | SDGLTLRDAHALSLFKNEGLAPDAAQRVARFFKQRKPGP |
| Ga0318553_106369421 | 3300032068 | Soil | SDGLTLRDAHALSLFKNEGLAPDAAQRVAHFFKQRKPG |
| Ga0318577_102382871 | 3300032091 | Soil | ASDGLTLREAHALNLFKNEGLAPDAAQRVARFFKARKKGS |
| Ga0335080_112641002 | 3300032828 | Soil | LQACDGLTLRDAHALEMFKNEGLAPDAEKRVSQFFARSKPPTG |
| Ga0335069_104868822 | 3300032893 | Soil | LIESDGLSLRDAHSLELFKNEGLAPDAAERTRAFFKRMKNHRN |
| Ga0335072_105625081 | 3300032898 | Soil | VNKRVLIATAGLTMKEAHALDLFKNEGLAPDAEDRVENFMKRQR |
| Ga0335083_105346961 | 3300032954 | Soil | QQAGLIGGGGLSLRDAHALELFKNDGLVPDAAKRVDRFLKRRRRAG |
| Ga0335076_112626551 | 3300032955 | Soil | VSDGLALNDAHALEIFKNEGLAPDAAERVARFLARRKTAG |
| Ga0316214_10662301 | 3300033545 | Roots | NKRALIETDGLSLHDSHALELFKNEGLAPDAAKRIAKFFSR |
| ⦗Top⦘ |