


| Basic Information | |
|---|---|
| Family ID | F072553 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPPRIKSGAGFFGIMR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.06 % |
| % of genes near scaffold ends (potentially truncated) | 45.45 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.992 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.983 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.48% β-sheet: 0.00% Coil/Unstructured: 94.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF02653 | BPD_transp_2 | 4.13 |
| PF00296 | Bac_luciferase | 3.31 |
| PF00912 | Transgly | 2.48 |
| PF02606 | LpxK | 2.48 |
| PF00528 | BPD_transp_1 | 2.48 |
| PF03602 | Cons_hypoth95 | 2.48 |
| PF01925 | TauE | 1.65 |
| PF03480 | DctP | 1.65 |
| PF00156 | Pribosyltran | 1.65 |
| PF00005 | ABC_tran | 1.65 |
| PF00857 | Isochorismatase | 1.65 |
| PF00557 | Peptidase_M24 | 1.65 |
| PF00378 | ECH_1 | 1.65 |
| PF00749 | tRNA-synt_1c | 1.65 |
| PF00753 | Lactamase_B | 1.65 |
| PF00034 | Cytochrom_C | 1.65 |
| PF07811 | TadE | 1.65 |
| PF12847 | Methyltransf_18 | 0.83 |
| PF07331 | TctB | 0.83 |
| PF00775 | Dioxygenase_C | 0.83 |
| PF00155 | Aminotran_1_2 | 0.83 |
| PF13586 | DDE_Tnp_1_2 | 0.83 |
| PF02233 | PNTB | 0.83 |
| PF01183 | Glyco_hydro_25 | 0.83 |
| PF03989 | DNA_gyraseA_C | 0.83 |
| PF01053 | Cys_Met_Meta_PP | 0.83 |
| PF02355 | SecD_SecF | 0.83 |
| PF06144 | DNA_pol3_delta | 0.83 |
| PF01625 | PMSR | 0.83 |
| PF01098 | FTSW_RODA_SPOVE | 0.83 |
| PF13193 | AMP-binding_C | 0.83 |
| PF13378 | MR_MLE_C | 0.83 |
| PF01370 | Epimerase | 0.83 |
| PF01351 | RNase_HII | 0.83 |
| PF03652 | RuvX | 0.83 |
| PF01037 | AsnC_trans_reg | 0.83 |
| PF01668 | SmpB | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF13183 | Fer4_8 | 0.83 |
| PF09459 | EB_dh | 0.83 |
| PF01040 | UbiA | 0.83 |
| PF02698 | DUF218 | 0.83 |
| PF13377 | Peripla_BP_3 | 0.83 |
| PF01479 | S4 | 0.83 |
| PF14602 | Hexapep_2 | 0.83 |
| PF09898 | DUF2125 | 0.83 |
| PF03960 | ArsC | 0.83 |
| PF00565 | SNase | 0.83 |
| PF04452 | Methyltrans_RNA | 0.83 |
| PF00909 | Ammonium_transp | 0.83 |
| PF07992 | Pyr_redox_2 | 0.83 |
| PF00043 | GST_C | 0.83 |
| PF04107 | GCS2 | 0.83 |
| PF07045 | DUF1330 | 0.83 |
| PF01842 | ACT | 0.83 |
| PF08450 | SGL | 0.83 |
| PF01227 | GTP_cyclohydroI | 0.83 |
| PF11239 | DUF3040 | 0.83 |
| PF08299 | Bac_DnaA_C | 0.83 |
| PF01381 | HTH_3 | 0.83 |
| PF01923 | Cob_adeno_trans | 0.83 |
| PF07883 | Cupin_2 | 0.83 |
| PF08240 | ADH_N | 0.83 |
| PF04390 | LptE | 0.83 |
| PF13277 | YmdB | 0.83 |
| PF05681 | Fumerase | 0.83 |
| PF03099 | BPL_LplA_LipB | 0.83 |
| PF03702 | AnmK | 0.83 |
| PF00383 | dCMP_cyt_deam_1 | 0.83 |
| PF01243 | Putative_PNPOx | 0.83 |
| PF14561 | TPR_20 | 0.83 |
| PF11737 | DUF3300 | 0.83 |
| PF01027 | Bax1-I | 0.83 |
| PF13404 | HTH_AsnC-type | 0.83 |
| PF03330 | DPBB_1 | 0.83 |
| PF13365 | Trypsin_2 | 0.83 |
| PF03466 | LysR_substrate | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.31 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 2.48 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.48 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 2.48 |
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 2.48 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 2.48 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 2.48 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.48 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 2.48 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 2.48 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.65 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.65 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.65 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.65 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.83 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.83 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.83 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.83 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.83 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.83 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.83 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.83 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.83 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.83 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.83 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.83 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
| COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.83 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.83 |
| COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.83 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1951 | Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain | Energy production and conversion [C] | 0.83 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.83 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.83 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.83 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.83 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.83 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.83 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.83 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.82 % |
| Unclassified | root | N/A | 18.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001402|JGI20195J14853_1038898 | Not Available | 654 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100023708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5329 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100088074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2894 | Open in IMG/M |
| 3300003321|soilH1_10218729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2842 | Open in IMG/M |
| 3300005167|Ga0066672_10975141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300005171|Ga0066677_10782745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 529 | Open in IMG/M |
| 3300005178|Ga0066688_10774224 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005187|Ga0066675_10827334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300005332|Ga0066388_100448017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1933 | Open in IMG/M |
| 3300005332|Ga0066388_100505714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1844 | Open in IMG/M |
| 3300005332|Ga0066388_101553245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1161 | Open in IMG/M |
| 3300005332|Ga0066388_103576357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300005332|Ga0066388_105163479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 663 | Open in IMG/M |
| 3300005332|Ga0066388_106404579 | Not Available | 594 | Open in IMG/M |
| 3300005332|Ga0066388_107338266 | Not Available | 554 | Open in IMG/M |
| 3300005434|Ga0070709_11544886 | Not Available | 540 | Open in IMG/M |
| 3300005529|Ga0070741_10001765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 62594 | Open in IMG/M |
| 3300005543|Ga0070672_100625983 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005554|Ga0066661_10189093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1272 | Open in IMG/M |
| 3300005560|Ga0066670_10179708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1259 | Open in IMG/M |
| 3300005561|Ga0066699_10916223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300005764|Ga0066903_100532533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2006 | Open in IMG/M |
| 3300005764|Ga0066903_102523890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300005764|Ga0066903_104548635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300005764|Ga0066903_108885742 | Not Available | 509 | Open in IMG/M |
| 3300006028|Ga0070717_10158055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1965 | Open in IMG/M |
| 3300006031|Ga0066651_10385352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 749 | Open in IMG/M |
| 3300006176|Ga0070765_100408927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1268 | Open in IMG/M |
| 3300006755|Ga0079222_10243747 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300006794|Ga0066658_10728854 | Not Available | 551 | Open in IMG/M |
| 3300006893|Ga0073928_10324746 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300006903|Ga0075426_10439037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300006903|Ga0075426_10733686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300006914|Ga0075436_100339034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1082 | Open in IMG/M |
| 3300009029|Ga0066793_10391649 | Not Available | 798 | Open in IMG/M |
| 3300009156|Ga0111538_11108373 | Not Available | 1001 | Open in IMG/M |
| 3300010048|Ga0126373_12027570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300010366|Ga0126379_11737970 | Not Available | 728 | Open in IMG/M |
| 3300010366|Ga0126379_11884481 | Not Available | 701 | Open in IMG/M |
| 3300010366|Ga0126379_12313963 | Not Available | 637 | Open in IMG/M |
| 3300010379|Ga0136449_101699249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300010398|Ga0126383_10191353 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300011120|Ga0150983_11788538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300012206|Ga0137380_10840141 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012210|Ga0137378_10944964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
| 3300012210|Ga0137378_11079692 | Not Available | 717 | Open in IMG/M |
| 3300012210|Ga0137378_11529278 | Not Available | 578 | Open in IMG/M |
| 3300012922|Ga0137394_11283913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300012971|Ga0126369_10644711 | Not Available | 1133 | Open in IMG/M |
| 3300012985|Ga0164308_11887795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 557 | Open in IMG/M |
| 3300013307|Ga0157372_11952288 | Not Available | 675 | Open in IMG/M |
| 3300013770|Ga0120123_1106898 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300014969|Ga0157376_11990071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 619 | Open in IMG/M |
| 3300015264|Ga0137403_11493518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300017928|Ga0187806_1062564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1146 | Open in IMG/M |
| 3300017932|Ga0187814_10047129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1588 | Open in IMG/M |
| 3300017959|Ga0187779_10721179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300017975|Ga0187782_10339257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300017975|Ga0187782_10345214 | Not Available | 1126 | Open in IMG/M |
| 3300017975|Ga0187782_10376158 | Not Available | 1077 | Open in IMG/M |
| 3300017975|Ga0187782_10408250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300017975|Ga0187782_10723215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300017975|Ga0187782_10834671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300017975|Ga0187782_10854459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 705 | Open in IMG/M |
| 3300018062|Ga0187784_10002561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 14576 | Open in IMG/M |
| 3300018062|Ga0187784_11314751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300018085|Ga0187772_10186721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1387 | Open in IMG/M |
| 3300018086|Ga0187769_10991765 | Not Available | 636 | Open in IMG/M |
| 3300018088|Ga0187771_10895797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 752 | Open in IMG/M |
| 3300018468|Ga0066662_11354447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300018468|Ga0066662_11805494 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300019284|Ga0187797_1393605 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 978 | Open in IMG/M |
| 3300019888|Ga0193751_1000038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 112858 | Open in IMG/M |
| 3300020581|Ga0210399_10913353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 711 | Open in IMG/M |
| 3300021088|Ga0210404_10591933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300021170|Ga0210400_10211489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1579 | Open in IMG/M |
| 3300021171|Ga0210405_11162651 | Not Available | 574 | Open in IMG/M |
| 3300021374|Ga0213881_10161582 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300021384|Ga0213876_10017517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3783 | Open in IMG/M |
| 3300021384|Ga0213876_10246402 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300021384|Ga0213876_10273424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300021384|Ga0213876_10357653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300021388|Ga0213875_10504886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300021388|Ga0213875_10613187 | Not Available | 526 | Open in IMG/M |
| 3300021432|Ga0210384_10326891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1381 | Open in IMG/M |
| 3300021476|Ga0187846_10044686 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300021559|Ga0210409_11333712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300022531|Ga0242660_1219413 | Not Available | 530 | Open in IMG/M |
| 3300022557|Ga0212123_10276477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C-145 | 1188 | Open in IMG/M |
| 3300025320|Ga0209171_10125567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
| 3300025926|Ga0207659_11187207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300025939|Ga0207665_10222907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1382 | Open in IMG/M |
| 3300025940|Ga0207691_10001869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20575 | Open in IMG/M |
| 3300026121|Ga0207683_10115510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2406 | Open in IMG/M |
| 3300026317|Ga0209154_1034892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2296 | Open in IMG/M |
| 3300026317|Ga0209154_1283645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300026550|Ga0209474_10034426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3759 | Open in IMG/M |
| 3300026552|Ga0209577_10603257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300027099|Ga0208726_103833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300027521|Ga0209524_1117559 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027537|Ga0209419_1061516 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027605|Ga0209329_1020294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1337 | Open in IMG/M |
| 3300027605|Ga0209329_1025472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
| 3300027727|Ga0209328_10074209 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300029636|Ga0222749_10041727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1995 | Open in IMG/M |
| 3300029636|Ga0222749_10059680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1706 | Open in IMG/M |
| 3300029636|Ga0222749_10383540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300031543|Ga0318516_10000009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 34094 | Open in IMG/M |
| 3300031573|Ga0310915_11287024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0182 | 504 | Open in IMG/M |
| 3300031718|Ga0307474_10609072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300031744|Ga0306918_10049813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2775 | Open in IMG/M |
| 3300031754|Ga0307475_10794600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300031754|Ga0307475_11507358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Blastochloridaceae → Blastochloris → Blastochloris sulfoviridis | 516 | Open in IMG/M |
| 3300031819|Ga0318568_10642939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300031821|Ga0318567_10005346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 5604 | Open in IMG/M |
| 3300031962|Ga0307479_11866699 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 552 | Open in IMG/M |
| 3300032163|Ga0315281_11711861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
| 3300032892|Ga0335081_12516421 | Not Available | 531 | Open in IMG/M |
| 3300033158|Ga0335077_10984293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 843 | Open in IMG/M |
| 3300033158|Ga0335077_12044251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300033290|Ga0318519_10529032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 712 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 4.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF026 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20195J14853_10388982 | 3300001402 | Arctic Peat Soil | MIFPDLPSPAEAGFAKAGNRSPSRIKSGTGFFGITLKNESTPIMTGEPAGLR* |
| JGIcombinedJ26739_1000237083 | 3300002245 | Forest Soil | MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPPRIKCGAGFFGIMV* |
| JGIcombinedJ26739_1000880743 | 3300002245 | Forest Soil | MSMIFSDLPTPAEALVHTTRTCQGFAQAGNRFPPWIKSGAGFFGIIL* |
| soilH1_102187292 | 3300003321 | Sugarcane Root And Bulk Soil | MILSDLPSPAEALVHAKGSCQGFAQAGNRFTPRIASGAGFFGIMR* |
| Ga0066672_109751412 | 3300005167 | Soil | MIFSDLPSPAEAPSQTAISAMGFAQAGNRYPPRIKCGASFFGIML |
| Ga0066677_107827452 | 3300005171 | Soil | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPPRIKSGAGFFGIMR* |
| Ga0066688_107742241 | 3300005178 | Soil | WSMIFSDLPSPAEASSQTMSGARGFAQAGNRCPPRIKCGAGFFGIML* |
| Ga0066675_108273341 | 3300005187 | Soil | MRLRMILSDLPSPAEASGRVKNAGQGFAQAGNRYPPRIKSGAGFFGIMH |
| Ga0066388_1004480173 | 3300005332 | Tropical Forest Soil | MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPPRIESGVGFFGIML* |
| Ga0066388_1005057144 | 3300005332 | Tropical Forest Soil | MIFSDLPSPAEASSHTTDGAKGFAQAGNRLPPLIKSGAGFFGIML* |
| Ga0066388_1015532453 | 3300005332 | Tropical Forest Soil | MIFSDLPPPAEASSHTTDRAKGFAQAGNRYPPRLKAGAGFS |
| Ga0066388_1035763572 | 3300005332 | Tropical Forest Soil | MIFSDLPSPAEALSHTVGLCKGFAQAGNRCPPRIKCGAGFFG |
| Ga0066388_1051634792 | 3300005332 | Tropical Forest Soil | MIFSDLPSPAEASALERRQRQGFAQAGNRFTPRIECGAGFFGIMLEERMR* |
| Ga0066388_1064045791 | 3300005332 | Tropical Forest Soil | MIFPDLPSPAEALSQRIGCAKGFAQAGNRFPPRIKCGAGF |
| Ga0066388_1073382661 | 3300005332 | Tropical Forest Soil | MIFSDLPSPAEASSQVKVSSQGFAQAGNRYPPRIKSGAGFFGIM |
| Ga0070709_115448862 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSPKGEFAKGFAQAGNRYPPRIGCGAGFFGIML* |
| Ga0070741_1000176540 | 3300005529 | Surface Soil | MILSDLPSPAEASSNTRGLAVGFAQAGNRNPPRIKSGAGFFGIMR* |
| Ga0070672_1006259832 | 3300005543 | Miscanthus Rhizosphere | MIFSDLPSPAEASILNRRQCQGFAQAGNRYPSRVKPGTCFLGIMR* |
| Ga0066661_101890933 | 3300005554 | Soil | LRMIFSDLPSPAEAPSYTNEPWQGFAQAGNRYPPRIKYRAGFFGIMHYTA* |
| Ga0066670_101797082 | 3300005560 | Soil | MRLRMILSDLPSPAEASGRVKNAGQGFAQAGNRYPPRIKSGAGFFGITR* |
| Ga0066699_109162231 | 3300005561 | Soil | MIFPDLASPAEASSQTTNGAKGFAQAGNRYPPRIKCGAGFFGIML |
| Ga0066903_1005325332 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAETSSQMMKRGMGFAQAGNRFPPRIKCGAGFFGIMLEMRTCLRERSIS* |
| Ga0066903_1025238902 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASGQTTIGATGFAQAENRFPPRIKCGAGFFGIMR* |
| Ga0066903_1045486352 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPPRVKPGAGFFGIVL* |
| Ga0066903_1088857422 | 3300005764 | Tropical Forest Soil | MIFSDLPSPAEASSGPKSGYQGFAQAGNRHPPRIASRAGFFGIVL* |
| Ga0070717_101580551 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASIQTTKRAEGFAQAGNRFPPRIKCGAGFFGIMR |
| Ga0066651_103853521 | 3300006031 | Soil | PAEASNESRGRSLGFAQAGNRDPPRIKSGAGFFGIML* |
| Ga0070765_1004089271 | 3300006176 | Soil | MIFSDLPSPAEAPGQMTSPYQGFAQAGNRYPPRIKSGAGF |
| Ga0079222_102437472 | 3300006755 | Agricultural Soil | MRLRMILSDLPSPAEASNQPASGGRGFAQAGNRRPPRIKSGAGFFGIMR* |
| Ga0066658_107288541 | 3300006794 | Soil | MIFSDLPSPAEASDESANGYQSFAQAGNRPPARIRSGPGFFGIMLEMKTPRA* |
| Ga0073928_103247461 | 3300006893 | Iron-Sulfur Acid Spring | MIFSDLPSPAEASSRMPNQATGFAQVENRYTPPIGSGQAFSDHAFVHSA* |
| Ga0075426_104390371 | 3300006903 | Populus Rhizosphere | LSMILSDLPSPAEASSQMAGHTKGFAQAGNRYPPRIKCGAGFFGIML |
| Ga0075426_107336861 | 3300006903 | Populus Rhizosphere | YCWSMMFSDLPSPAEASSQMNEPSRGFAQAGNRYPPRIKSGAGFFGIMR* |
| Ga0075436_1003390342 | 3300006914 | Populus Rhizosphere | MILSDLPSPAEAPSYTNEPWQGFAQAGNRYPPRIKYRAGFFGIMRYPA* |
| Ga0066793_103916492 | 3300009029 | Prmafrost Soil | FESESDPNILLSALIFSDLPSPAEAGFAKAENRFPPRIKSGAGFFGIIR* |
| Ga0111538_111083733 | 3300009156 | Populus Rhizosphere | MIFSDLPPPAEALIHARGACQGFAQAGNRCPPRIKSGAGFFGIMRI |
| Ga0126373_120275702 | 3300010048 | Tropical Forest Soil | MIFSDLPSPAEASSQMSKLSQGFAQAGNPHPPRITCGAGFFGIML* |
| Ga0126379_117379701 | 3300010366 | Tropical Forest Soil | MIFSDLPSPAEASSRMKGWLGGFAQAGNRCTPRITSGAGFF |
| Ga0126379_118844811 | 3300010366 | Tropical Forest Soil | SDLPSPAEASSHTTDRAKGFAQAGNRYPPRVKPGAGFFGIVL* |
| Ga0126379_123139633 | 3300010366 | Tropical Forest Soil | MIFSDLPSPAEASNHTTDGAKGFAQAGNRLPPLIKSGAGFFGIML* |
| Ga0136449_1016992491 | 3300010379 | Peatlands Soil | IFSDLPSPAEAGFAKAGNRLPPRIKSGAGFFRIMLWGTTGHVG* |
| Ga0126383_101913532 | 3300010398 | Tropical Forest Soil | MVFSDLPSPAEASSHTTDRAKGFAQAGNRYPPRVKTGAGFFGIVL* |
| Ga0150983_117885381 | 3300011120 | Forest Soil | MIFSDLPSPAEASSTMRTHTKGFAQAGNRYPPRIKCGAGFFG |
| Ga0137380_108401412 | 3300012206 | Vadose Zone Soil | LSVIFSDLPSPAEASSQTMSRAKGFAQAGNRFPPRIKCGAGFFGIML |
| Ga0137378_109449642 | 3300012210 | Vadose Zone Soil | MIFSDLASPAEASSRMTSRAKGFAQAGNRFPPRIKCGAGFFGIML* |
| Ga0137378_110796922 | 3300012210 | Vadose Zone Soil | MIFLRMIFSDLPSPAEAASETTSRATGFAQAGNRYPPRIKSGAGFFGIMR* |
| Ga0137378_115292781 | 3300012210 | Vadose Zone Soil | MFSDLPSPAEASSQTTGSAFAQAGNRYPPRITCGAGL |
| Ga0137394_112839133 | 3300012922 | Vadose Zone Soil | LGMIFSDLPTPAEASVHTIGLRQGFAQAGNRYPSRIKSGTGFFGIMP* |
| Ga0126369_106447113 | 3300012971 | Tropical Forest Soil | MIFSDLPSPAEASIHKCGLRRGFAQAGNRFPSRIKSGTGFFGIML* |
| Ga0164308_118877952 | 3300012985 | Soil | MYAWSMIFSDLPSPAEASFHMAGACKRFAQAGNRFTPRITCGAGFFGIML* |
| Ga0157372_119522882 | 3300013307 | Corn Rhizosphere | MIFSDLPSPAEASSRSEKACKGFAQAGNRYPPRIKSGAGFFGI |
| Ga0120123_11068982 | 3300013770 | Permafrost | MILSDLPSPAEASNAMRSARQGFAQAGNRFPPRIKSGAGFFGIM |
| Ga0157376_119900711 | 3300014969 | Miscanthus Rhizosphere | MIFSDLPSPAEASFHLAAARQGFAQAGNRFPPRIKCGAGFFG |
| Ga0137403_114935182 | 3300015264 | Vadose Zone Soil | MTFSDLPTPAEALIQRTRMCEGFAQAGNRCPPWIKSGACFF |
| Ga0187806_10625641 | 3300017928 | Freshwater Sediment | MIFSDLASPAVASVERLGRLHGFAQAGNRYPPRIKSGAGFFGIMR |
| Ga0187814_100471291 | 3300017932 | Freshwater Sediment | MIFSDLAWPTVASAERLGRLHGFAKAGNLCSLRVKSG |
| Ga0187779_107211791 | 3300017959 | Tropical Peatland | MMLSDLPSPAEASIDHDDQSDGFAQAGNRHPPRIRSGAGFCRDMR |
| Ga0187782_103392573 | 3300017975 | Tropical Peatland | MIFSDLSPPAEASIQHQRQCEGFAQAGNRYTPRIKSGAGIFGIMR |
| Ga0187782_103452142 | 3300017975 | Tropical Peatland | MIFSDLPSPAEASSQTIVRAKGFAQAENRYPLFGIMLWLQLPAFGPEAEPLR |
| Ga0187782_103761583 | 3300017975 | Tropical Peatland | MIFSDLASPAEASSLTTQPAKGFAQAGNRFPPRINSGAGFFGIMRY |
| Ga0187782_104082502 | 3300017975 | Tropical Peatland | YWRMIFSDLASPAEASGQTTNHPVGFAQAGNRYPPRAKSGAGFFGIMR |
| Ga0187782_107232152 | 3300017975 | Tropical Peatland | MILSDLPSPAEASTYGESRREGFAQAGNRHPSRIKSGTGFSGIML |
| Ga0187782_108346711 | 3300017975 | Tropical Peatland | SCWSMIFSNLPSPAEASSRTTVGAKGFAQAGNRYPPRVKPGAGFFGIML |
| Ga0187782_108544591 | 3300017975 | Tropical Peatland | VILSDLPSPAEASTYHENRHEGFAQAGNRYPPRIKRGAGI |
| Ga0187784_100025616 | 3300018062 | Tropical Peatland | MIFSDLPSPAEALNQTTNRAKGFAQAGNRYPPRIKCGAGFFGIMH |
| Ga0187784_113147512 | 3300018062 | Tropical Peatland | MRIIVRLLWRTYRWSMMFSDLPSPAKASSQTTGNAKGFAQVGNRYPPRIKCGAGFFGIMR |
| Ga0187772_101867212 | 3300018085 | Tropical Peatland | MIFSDLPSPAEASSQTMNRPKGFAQAENRYPLFGIMLWLQLPAFGPEAEPLR |
| Ga0187769_109917651 | 3300018086 | Tropical Peatland | MIFSDLPSPAEASNQTTNRAKGFAQAGNRYPPRIKCGAGFFGIMH |
| Ga0187771_108957972 | 3300018088 | Tropical Peatland | MIFSDLPSPAEASRQVMNGCQGFAQAGNRCPPPITSGAGFFGIML |
| Ga0066662_113544472 | 3300018468 | Grasslands Soil | LAGYSWSMIFSDLASPAEASSQTMTGATGFAQAGNRYPPRIKSGASFIGIMR |
| Ga0066662_118054941 | 3300018468 | Grasslands Soil | MIFSDLPSPAEAPSYTNEPWQGFAQAGNRYPPRIKYRAGFFGIMHYTA |
| Ga0187797_13936052 | 3300019284 | Peatland | MMFPDLASPAEASRNTMNRAKGFAQAGNRYPPRIESGAGFFGIML |
| Ga0193751_100003837 | 3300019888 | Soil | MFCDLPSPAEAPSQMMSRNQGFAQAGTRYPPRIKSGAGFFAIML |
| Ga0210399_109133532 | 3300020581 | Soil | MIRSDLPSPAEASRENISRYDGFAQAGNRFPPRIKSGAGFFRIML |
| Ga0210404_105919332 | 3300021088 | Soil | MIFSDLPSPAEASRQMTEPSQGFAQAGNRFPPRIKCGAGFFGIMLESP |
| Ga0210400_102114892 | 3300021170 | Soil | MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPPRTKCGACFFGIML |
| Ga0210405_111626512 | 3300021171 | Soil | MIFSDLPSPAEAPSHTMKPTKGFAQAGNRFPPRIKCGAGFFGIMR |
| Ga0213881_101615822 | 3300021374 | Exposed Rock | MIFSDLPSPAEASIRYEGRCEGFAQAGNRCTPRIKSGAGFFGIMR |
| Ga0213876_100175176 | 3300021384 | Plant Roots | DFSSNRHHALTSSWSMIFSDLASPAEASSQTTGRAKGFAQAGNRYPPRNKCGAGFFGIVL |
| Ga0213876_102464022 | 3300021384 | Plant Roots | MIFSDLPSPAEASIRYEGRCEGFAQAGNRCTPRIKSGA |
| Ga0213876_102734241 | 3300021384 | Plant Roots | IFSDLPSPAEASTSSEGRCDGFAQAGNRYPPRIKSGASFFGIMR |
| Ga0213876_103576532 | 3300021384 | Plant Roots | MRTDFLCMIFSDLPSPAEASSQMMIRAQGFAQAGNRYPPRIKCGAGFFGIMH |
| Ga0213875_105048862 | 3300021388 | Plant Roots | MMFSDLASPAEAPSHTTKGNKGFAQAGNRCPSRIKCGTGFFGIML |
| Ga0213875_106131871 | 3300021388 | Plant Roots | MIFSDLASPAEASNQMTNRATGFAQAGNRYPPRIKSGAGFFGIML |
| Ga0210384_103268912 | 3300021432 | Soil | MIFSDLPSPAEASSQTMSRAKGFAQAGNGFPPRIKCGAGFFGIML |
| Ga0187846_100446864 | 3300021476 | Biofilm | MMFSDLPSPAEASSQTMNRSEGFAQAGNRYPPRIKCGAGFFGIML |
| Ga0210409_113337122 | 3300021559 | Soil | MVSWSMIFSDLPSPAEAPSHTMKPTKGFAQAGNRFPPRIKCGARFFGIML |
| Ga0242660_12194132 | 3300022531 | Soil | MTLLRTLALSFCWRMIFSDLPSPAEALSQTEGPSQGFAQAGNRSTPRIKC |
| Ga0212123_102764772 | 3300022557 | Iron-Sulfur Acid Spring | MIFSDLPSPAEASSRMPNQATGFAQVENRYTPPIGSGQAFSDHAFVHSA |
| Ga0209171_101255672 | 3300025320 | Iron-Sulfur Acid Spring | MILSDLPSPDEAGFAKAGNRFHPRIKSKDKLFGITLRYLRLLHCETAPPNF |
| Ga0207659_111872072 | 3300025926 | Miscanthus Rhizosphere | VPLRKSRRVIDIPESYHGIYLSMILSDLPSPAEAGFAKAGNRCPPRIKSGAGFFGIMR |
| Ga0207665_102229072 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFSDLPSPAEASSQTMSRAKGFAQAGNRFPPRIKCGAGFFGIML |
| Ga0207691_1000186915 | 3300025940 | Miscanthus Rhizosphere | MISSDLPPPAEALIHARGPCQGFAQAGNRSPPRIKSGAGFFGIMRRD |
| Ga0207683_101155101 | 3300026121 | Miscanthus Rhizosphere | MIFSDLPPPAEALIHARGACQGFAQAGNRCPPRIKSGAGFFGIMRIYRRNAGATRNGVM |
| Ga0209154_10348922 | 3300026317 | Soil | MIFLRMIFSDLPSPAEAASETTSRATGFAQAGNRYPPRIKSGAGFFGIMR |
| Ga0209154_12836451 | 3300026317 | Soil | MIFSDLPSPAEAPSQTAISAMGFAQAGNRYPPRIKCGASFFGIMLYFFCSFPPSRR |
| Ga0209474_100344262 | 3300026550 | Soil | MRLRMILSDLPSPAEASGRVKNAGQGFAQAGNRYPPRIKSGAGFFGITR |
| Ga0209577_106032572 | 3300026552 | Soil | MIFSDLPSPAEAPSHTNEPKQGFAQAGNRYPPRIKCGAGFFGIML |
| Ga0208726_1038332 | 3300027099 | Forest Soil | MIFSDLPSPAEASSQTMSRAKGFAQAGNGFPPRIKCGAGFFGITL |
| Ga0209524_11175592 | 3300027521 | Forest Soil | MMFSDLPSPAEAPIEMTTGAMGFAQAGNPDPPRLNRGAGFFGIML |
| Ga0209419_10615161 | 3300027537 | Forest Soil | MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPPRIKCGAGFFGIMV |
| Ga0209329_10202943 | 3300027605 | Forest Soil | RYCWSMIFSDLPSPAEASSQMTEQLQGFAQAGNRSPPRIKCGAGFFGIMV |
| Ga0209329_10254723 | 3300027605 | Forest Soil | MMLSDLPSPAEASTGTMNDAGGFAQAGNRYAPRIKSGAGFFGIM |
| Ga0209328_100742092 | 3300027727 | Forest Soil | MIFSDLPSPAEASSYTMNLAKGFAQAGNRYPPRIKCGAGFVGIML |
| Ga0222749_100417272 | 3300029636 | Soil | MILSDLPSPAEASSQMMERATGFAQAGNRYPPRIECGAGFFGIMF |
| Ga0222749_100596803 | 3300029636 | Soil | MIFSDLPSPAEASSQMTEQLQGFAQAGNRSPPRIKCGAGFFGIML |
| Ga0222749_103835402 | 3300029636 | Soil | MIFSDLPSPAEASSQMMDRATGFAQAGNRYPPRIAPGAGFFGIML |
| Ga0318516_1000000928 | 3300031543 | Soil | MIFSDLPSPAEASTGTMSCGQGFAQAENRYPPQIKSGAGFFGIMR |
| Ga0310915_112870241 | 3300031573 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPPRLKTGGK |
| Ga0307474_106090721 | 3300031718 | Hardwood Forest Soil | FFDLASPAEALNETASGWRGFAQAGNRYPPRITSGAGLFGIVL |
| Ga0306918_100498131 | 3300031744 | Soil | IRTYLTPAEARYEGTSGHRGFAQAGNRSLPRIKSGAGFFRIML |
| Ga0307475_107946002 | 3300031754 | Hardwood Forest Soil | FSDLPSPAEASSQTDQRCQGFAQAGNRYPARIKCGAGFFGIMP |
| Ga0307475_115073581 | 3300031754 | Hardwood Forest Soil | MIFPDLPSPAEASSQTDQRCQGFAQAGNRYPARIKCGAGFFGIMP |
| Ga0318568_106429391 | 3300031819 | Soil | MIFSDLPSPAEASSHTTDRAKGFAQAGNRYPPRLKTGGKLFRDHA |
| Ga0318567_100053466 | 3300031821 | Soil | MIFSDLPSPAEAMSCGQGFAQAENRYPPQNKSGAGFFGIMR |
| Ga0307479_118666992 | 3300031962 | Hardwood Forest Soil | MIFSDLPSPAEASSQMTEQLQGFAQTGNRSPPRTKCGACFFGI |
| Ga0315281_117118611 | 3300032163 | Sediment | MIFSDLPSPAEAGFAKAGNRFPPRIKSGAGFFGIMRSVRRHRLLHV |
| Ga0335081_125164212 | 3300032892 | Soil | MIFSDLPSPAEASNHTKNLAEGFAQAGNRFPSRIKSGTGFFGIMLRVANPGGP |
| Ga0335077_109842933 | 3300033158 | Soil | ITYSWSMIFSDLPSPAEASSQATNRATGFAQAGNRFPPRIECGAGFFGMML |
| Ga0335077_120442512 | 3300033158 | Soil | MILSDLPSPAEASSQTMASTKGFAQAGNRYPPRIASGAGFFGIML |
| Ga0318519_105290322 | 3300033290 | Soil | MIFSDLPSSAEASSHTTDRAKGFAQAGNRYPPRVKPGAGFFGIVL |
| ⦗Top⦘ |