


| Basic Information | |
|---|---|
| Family ID | F072535 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LMRMESKNLDESIGMADYDNAMRKASSLDIANTSPSMRH |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.69 % |
| % of genes from short scaffolds (< 2000 bps) | 92.56 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.694 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.017 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01722 | BolA | 66.12 |
| PF03471 | CorC_HlyC | 13.22 |
| PF13671 | AAA_33 | 6.61 |
| PF08433 | KTI12 | 1.65 |
| PF01761 | DHQ_synthase | 1.65 |
| PF00215 | OMPdecase | 0.83 |
| PF01202 | SKI | 0.83 |
| PF00043 | GST_C | 0.83 |
| PF04392 | ABC_sub_bind | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG4088 | tRNA uridine 5-carbamoylmethylation protein Kti12 (Killer toxin insensitivity protein) | Translation, ribosomal structure and biogenesis [J] | 1.65 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.83 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.69 % |
| Unclassified | root | N/A | 3.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2046860001|MiccSOB_F3TY2AH02H3F68 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 2140918008|ConsensusfromContig278512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300001593|JGI12635J15846_10899398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 505 | Open in IMG/M |
| 3300001661|JGI12053J15887_10470307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 601 | Open in IMG/M |
| 3300002155|JGI24033J26618_1042566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 637 | Open in IMG/M |
| 3300002914|JGI25617J43924_10230765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 621 | Open in IMG/M |
| 3300003659|JGI25404J52841_10104947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300005327|Ga0070658_10975747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 737 | Open in IMG/M |
| 3300005328|Ga0070676_10708919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 735 | Open in IMG/M |
| 3300005328|Ga0070676_10983238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300005343|Ga0070687_100468432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 842 | Open in IMG/M |
| 3300005535|Ga0070684_102133370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300005538|Ga0070731_10964360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 565 | Open in IMG/M |
| 3300005598|Ga0066706_10333809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1199 | Open in IMG/M |
| 3300005598|Ga0066706_10493423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 975 | Open in IMG/M |
| 3300005602|Ga0070762_11269328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300005615|Ga0070702_100747574 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005617|Ga0068859_100288289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1734 | Open in IMG/M |
| 3300005618|Ga0068864_102098601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 571 | Open in IMG/M |
| 3300005712|Ga0070764_10895598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 556 | Open in IMG/M |
| 3300005712|Ga0070764_11077141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300006046|Ga0066652_100322397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1380 | Open in IMG/M |
| 3300006047|Ga0075024_100097632 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300006048|Ga0075363_100688936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
| 3300006050|Ga0075028_100869214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300006051|Ga0075364_10148744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1578 | Open in IMG/M |
| 3300006176|Ga0070765_101749035 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006195|Ga0075366_10183721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1270 | Open in IMG/M |
| 3300006195|Ga0075366_10738894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300006353|Ga0075370_10637385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 647 | Open in IMG/M |
| 3300006638|Ga0075522_10032052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3181 | Open in IMG/M |
| 3300009012|Ga0066710_101697029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 961 | Open in IMG/M |
| 3300009094|Ga0111539_10848089 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300009098|Ga0105245_11175367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 815 | Open in IMG/M |
| 3300009649|Ga0105855_1110331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 779 | Open in IMG/M |
| 3300010039|Ga0126309_10015329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3249 | Open in IMG/M |
| 3300010321|Ga0134067_10348920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 582 | Open in IMG/M |
| 3300010375|Ga0105239_12355800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 620 | Open in IMG/M |
| 3300010862|Ga0126348_1146265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300011119|Ga0105246_11339250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 665 | Open in IMG/M |
| 3300012189|Ga0137388_11484374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 615 | Open in IMG/M |
| 3300012203|Ga0137399_10230243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1514 | Open in IMG/M |
| 3300012205|Ga0137362_11659145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300012205|Ga0137362_11756486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300012212|Ga0150985_102841225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
| 3300012212|Ga0150985_107857040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
| 3300012356|Ga0137371_10142871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1875 | Open in IMG/M |
| 3300012582|Ga0137358_10349489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1001 | Open in IMG/M |
| 3300012582|Ga0137358_11098410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300012927|Ga0137416_11395472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300012930|Ga0137407_11099068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 754 | Open in IMG/M |
| 3300013105|Ga0157369_10939201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 886 | Open in IMG/M |
| 3300013105|Ga0157369_12394224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300013297|Ga0157378_12056987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300013308|Ga0157375_10639149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1221 | Open in IMG/M |
| 3300014325|Ga0163163_13150695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 3300015053|Ga0137405_1311183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 942 | Open in IMG/M |
| 3300015160|Ga0167642_1060231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 559 | Open in IMG/M |
| 3300016294|Ga0182041_12182880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 517 | Open in IMG/M |
| 3300018027|Ga0184605_10470981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300019878|Ga0193715_1120930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300019883|Ga0193725_1044722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1146 | Open in IMG/M |
| 3300020062|Ga0193724_1068022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 745 | Open in IMG/M |
| 3300021088|Ga0210404_10856841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300021168|Ga0210406_10994169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
| 3300021170|Ga0210400_11628999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300021404|Ga0210389_10737570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 771 | Open in IMG/M |
| 3300021405|Ga0210387_11051468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 712 | Open in IMG/M |
| 3300022561|Ga0212090_10942552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300022694|Ga0222623_10264010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 663 | Open in IMG/M |
| 3300022908|Ga0247779_1084509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 829 | Open in IMG/M |
| 3300025862|Ga0209483_1003518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10266 | Open in IMG/M |
| 3300025910|Ga0207684_10864667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 762 | Open in IMG/M |
| 3300025961|Ga0207712_10283465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1353 | Open in IMG/M |
| 3300025981|Ga0207640_10664245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 889 | Open in IMG/M |
| 3300025981|Ga0207640_11371935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 633 | Open in IMG/M |
| 3300025986|Ga0207658_10512868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1069 | Open in IMG/M |
| 3300025986|Ga0207658_11611204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300026023|Ga0207677_11723140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 581 | Open in IMG/M |
| 3300026118|Ga0207675_100366014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1415 | Open in IMG/M |
| 3300026222|Ga0209862_1073459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 583 | Open in IMG/M |
| 3300026377|Ga0257171_1049309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 729 | Open in IMG/M |
| 3300026508|Ga0257161_1052366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 826 | Open in IMG/M |
| 3300026508|Ga0257161_1102689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 596 | Open in IMG/M |
| 3300026537|Ga0209157_1190887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 878 | Open in IMG/M |
| 3300027521|Ga0209524_1126915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 531 | Open in IMG/M |
| 3300027546|Ga0208984_1048721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 902 | Open in IMG/M |
| 3300027610|Ga0209528_1115120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300027735|Ga0209261_10170794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 580 | Open in IMG/M |
| 3300027778|Ga0209464_10229373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 667 | Open in IMG/M |
| 3300027894|Ga0209068_10175367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1170 | Open in IMG/M |
| 3300027902|Ga0209048_10306863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1111 | Open in IMG/M |
| 3300027915|Ga0209069_10734371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 583 | Open in IMG/M |
| 3300028047|Ga0209526_10033311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3625 | Open in IMG/M |
| 3300028047|Ga0209526_10107578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1962 | Open in IMG/M |
| 3300028590|Ga0247823_11509369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 504 | Open in IMG/M |
| 3300028819|Ga0307296_10076184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1785 | Open in IMG/M |
| 3300028824|Ga0307310_10164592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1031 | Open in IMG/M |
| 3300028824|Ga0307310_10426309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
| 3300029923|Ga0311347_10981369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300030294|Ga0311349_11094821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 745 | Open in IMG/M |
| 3300030580|Ga0311355_11690564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300030677|Ga0302317_10040309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2400 | Open in IMG/M |
| 3300030737|Ga0302310_10481805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
| 3300030943|Ga0311366_11935218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 502 | Open in IMG/M |
| 3300031027|Ga0302308_10298490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 995 | Open in IMG/M |
| 3300031198|Ga0307500_10122449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 719 | Open in IMG/M |
| 3300031446|Ga0170820_16119347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300031474|Ga0170818_103798945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300031507|Ga0307509_10793517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 612 | Open in IMG/M |
| 3300031616|Ga0307508_10467291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 855 | Open in IMG/M |
| 3300031788|Ga0302319_10577311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1179 | Open in IMG/M |
| 3300031902|Ga0302322_101070923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 973 | Open in IMG/M |
| 3300031903|Ga0307407_11173671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300032002|Ga0307416_103548304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 522 | Open in IMG/M |
| 3300032004|Ga0307414_11421978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
| 3300032211|Ga0310896_10503658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.79% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.13% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.31% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.48% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.65% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.65% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.83% |
| Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2046860001 | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MiccSOB_99650 | 2046860001 | Concrete Drainage Pipe Biofilm | FALSLLGLMRMESKNFDESIAMADYDNATRKASSLDIAKPSLSIRH |
| Bog_all_C_03200270 | 2140918008 | Soil | RMESKNFDESIGMADYDNAMRKASSLDIANTSLSMRH |
| JGI12635J15846_108993981 | 3300001593 | Forest Soil | RMESKNLDESIGMADYDNAMRKASSLDIANTSPSMRH* |
| JGI12053J15887_104703071 | 3300001661 | Forest Soil | RMESKNLDESIGMADYDNAMRKASSLDIAKPSLSMRH* |
| JGI24033J26618_10425663 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLMRMESKNLDESIAMANFDYAIAKASSLDIANTSLRIRH* |
| JGI25617J43924_102307651 | 3300002914 | Grasslands Soil | GLMRMESKNFDESIGIADYDNAMRKASSLDIANTSLSMRH* |
| JGI25404J52841_101049471 | 3300003659 | Tabebuia Heterophylla Rhizosphere | TLLGLMRMESKNLDESIGMADFDYAMPAASSLDIANPSLRWXH* |
| Ga0070658_109757471 | 3300005327 | Corn Rhizosphere | ACCFALSLLGLMRMESKNLDESIGMTDYDNATRKASSLDIANTSLLIRH* |
| Ga0070676_107089193 | 3300005328 | Miscanthus Rhizosphere | LLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0070676_109832383 | 3300005328 | Miscanthus Rhizosphere | LLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRIRH* |
| Ga0070687_1004684321 | 3300005343 | Switchgrass Rhizosphere | FALSLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0070684_1021333701 | 3300005535 | Corn Rhizosphere | LGLMRMESKNLDESIAMTDFDYAMPKASSLDIANTSIRVQD* |
| Ga0070731_109643602 | 3300005538 | Surface Soil | SLLGLMRMESKNFDESIGMADYDNAMLKASSLDIAKPSLPMRH* |
| Ga0066706_103338093 | 3300005598 | Soil | CFALSLLGLMRMESKNFDESIGMADYDNAMRKASSLDIANPSLSMRH* |
| Ga0066706_104934233 | 3300005598 | Soil | CFALSLLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSLSMRH* |
| Ga0070762_112693282 | 3300005602 | Soil | MESKNLDESIGMADYDNAMRKASSLDIANPSLSMRH* |
| Ga0070702_1007475741 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMHH* |
| Ga0068859_1002882891 | 3300005617 | Switchgrass Rhizosphere | MRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0068864_1020986011 | 3300005618 | Switchgrass Rhizosphere | ESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0070764_108955983 | 3300005712 | Soil | LSLLGLMRMESKNLDESIGMADYDYAIPKASSLDIANPSILIRH* |
| Ga0070764_110771412 | 3300005712 | Soil | LALSLFGLIRMESKNLDESMGMADYDNAMRNASSLDIANPSLSMRH* |
| Ga0066652_1003223973 | 3300006046 | Soil | RMESKNLDESIGMADYDNATHKASSLDIANSSLSMGN* |
| Ga0075024_1000976321 | 3300006047 | Watersheds | ESKNLDESIGMADYDNAMRKASSLDIANTSPSMRH* |
| Ga0075363_1006889363 | 3300006048 | Populus Endosphere | LSLLGLMRMESKNLDESIAMANFDYAMPEASSLDIANTSVRMNH* |
| Ga0075028_1008692143 | 3300006050 | Watersheds | LLGLMRMESKNFDESIGMADYDNAMRKASSLDIAKLSLPIRH* |
| Ga0075364_101487444 | 3300006051 | Populus Endosphere | LGLMRMESKNLDESIAMTDFDYAMPVASSLDIANYSVRVRY* |
| Ga0070765_1017490353 | 3300006176 | Soil | ESKNFDESIGMADYDNAMRKASSLDIAKPYLSTRH* |
| Ga0075366_101837214 | 3300006195 | Populus Endosphere | ESKNLDESIAMADFDYAMPEASSLDIANTSVRMRH* |
| Ga0075366_107388942 | 3300006195 | Populus Endosphere | LMRMESKNLDESIGMADFDYAMPAASSLDIANPSLPICH* |
| Ga0075370_106373851 | 3300006353 | Populus Endosphere | SKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0075522_100320521 | 3300006638 | Arctic Peat Soil | SLLGLMRMESKNFDESIGMADYDNAMPKASSLDIAKPSILIRH* |
| Ga0066710_1016970293 | 3300009012 | Grasslands Soil | FALSLLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSLSMRH |
| Ga0111539_108480891 | 3300009094 | Populus Rhizosphere | FALTLLGLMRMESKNLDESIGIADFDYAMRKASSLDIANTSVRMHH* |
| Ga0105245_111753671 | 3300009098 | Miscanthus Rhizosphere | MESKNLDESIGMADFDYAMAKAASLDIAKPSLSMSH* |
| Ga0105855_11103313 | 3300009649 | Permafrost Soil | SLLGLMRMLSKNLDESIGMADYDNATLTASSLDIAKLSSLMRH* |
| Ga0126309_100153295 | 3300010039 | Serpentine Soil | FGLIRMESKNLDESIGMADYDNAMRKASSLDIANTSLSICH* |
| Ga0134067_103489201 | 3300010321 | Grasslands Soil | SLLGLIRMESKNLDESIGMADYDNATHKASSLDIANSSLSMGN* |
| Ga0126370_110725161 | 3300010358 | Tropical Forest Soil | RARASCLAFSLFGLMRMESKNFDVSIGMTDFDYAMRKASSLDIPIP* |
| Ga0105239_123558002 | 3300010375 | Corn Rhizosphere | SLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0126348_11462652 | 3300010862 | Boreal Forest Soil | LLGLMRMESKNLDESIAMSNFDYAMPEASSLDIANTSLRMRH* |
| Ga0105246_113392503 | 3300011119 | Miscanthus Rhizosphere | ACCFALSLLGLMRMESKNLDESIGMADFDYAMPKASSLDIANTSVSIWH* |
| Ga0137388_114843741 | 3300012189 | Vadose Zone Soil | MESKNFDESIGMADYDNAMRKASSLDIAKPSPSMRH* |
| Ga0137399_102302431 | 3300012203 | Vadose Zone Soil | ESKNFDESIGMADYDNAMRKASSLDIAKPSPSMRH* |
| Ga0137362_116591452 | 3300012205 | Vadose Zone Soil | LGLMRIESKNFDESIGMADYDNAMRKASSLDIAKPSLLMRH* |
| Ga0137362_117564862 | 3300012205 | Vadose Zone Soil | ALSLLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSLSMRH* |
| Ga0150985_1028412252 | 3300012212 | Avena Fatua Rhizosphere | SLLGLMRMESKNLDESIGMADFDYAMPEASSLDIANTSLLIRH* |
| Ga0150985_1078570403 | 3300012212 | Avena Fatua Rhizosphere | LGLMRMESKNLDESIGMADYDNATHKASSLDIANSSLSMGN* |
| Ga0137371_101428711 | 3300012356 | Vadose Zone Soil | SKNFDESIGMADYDNAMRKASSLDIANPSLSMRH* |
| Ga0137358_103494893 | 3300012582 | Vadose Zone Soil | LLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSPSMRH* |
| Ga0137358_110984102 | 3300012582 | Vadose Zone Soil | LLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSPSMQH* |
| Ga0137416_113954723 | 3300012927 | Vadose Zone Soil | LGLMRMESKNFDESIGMADYDNAMRKASSLDIAKPSLLMRH* |
| Ga0137407_110990683 | 3300012930 | Vadose Zone Soil | LLGLMRMESKNLDESIGMADFDYATRKASSLDIANTFNSRPRH* |
| Ga0157369_109392011 | 3300013105 | Corn Rhizosphere | LMRMESKNLDESIAMTDFDYAMPVASSLDIANYSVRVRY* |
| Ga0157369_123942242 | 3300013105 | Corn Rhizosphere | GLMRMESKNFDESIGMTDFDYAIPKPSSLDIVNSWIGE* |
| Ga0157378_120569872 | 3300013297 | Miscanthus Rhizosphere | LGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0157375_106391493 | 3300013308 | Miscanthus Rhizosphere | LMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH* |
| Ga0163163_131506952 | 3300014325 | Switchgrass Rhizosphere | CFALSLLGLMRMESKNLDESIGMADFDYAMPEASSLDIANTSLLIRH* |
| Ga0137405_13111831 | 3300015053 | Vadose Zone Soil | SKNLDESIGMADYDNAMQKASSLDIAKLSLPMRH* |
| Ga0167642_10602311 | 3300015160 | Glacier Forefield Soil | LMRMLSKNLDESIGMADYDNAMRKASSLDIAKLSR* |
| Ga0182041_121828801 | 3300016294 | Soil | MLSKNFDESIAMADYDNAMRKASSLDIAITLRFRFADDQFC |
| Ga0184605_104709812 | 3300018027 | Groundwater Sediment | RMESKNLDASIGMADYDYAMPAASSLDIAKPSLPMCH |
| Ga0193715_11209302 | 3300019878 | Soil | LMRMESKNFDESIGMTDYDNAMRKASSLDIANTSPSMRH |
| Ga0193725_10447221 | 3300019883 | Soil | LMRMESKNLDESIGMADYDNAMRKASSLDIANTSPSMRH |
| Ga0193724_10680223 | 3300020062 | Soil | MRMESKNLDESIGMTDYDNAMRKASSLDIANTSPSMRH |
| Ga0210404_108568411 | 3300021088 | Soil | LGLMRIESKNLDESIGMADYDNAMRKASSLDIAKPSPSLRH |
| Ga0210406_109941693 | 3300021168 | Soil | GLIRMESKNLDESIGMADYDNAMRKASSLDIANPSLSMRH |
| Ga0210400_116289992 | 3300021170 | Soil | LSLFGLMRMESKSFDESIGMTDFDYAMQKPSSLDIAKAFKLPARH |
| Ga0210389_107375703 | 3300021404 | Soil | LLGLMRMESKNLDESIGMADYDNAMQKASSLDIAKPSLSMRH |
| Ga0210387_110514683 | 3300021405 | Soil | FALSLLGLMRMESKNLEESIGMADYDNAIGKASSLDIAKPSFSIRH |
| Ga0212090_109425522 | 3300022561 | Glacier Valley | LLGLMRMLSKNLDESIGMADYDNAMRKASSLDIANTSLS |
| Ga0222623_102640103 | 3300022694 | Groundwater Sediment | CACCFALSLLGLMRMESKNFEESIGMADYDNAMRKASSLDIANTSPSMRH |
| Ga0247779_10845091 | 3300022908 | Plant Litter | AFALSLLGLMRMESKNLDESIGMADFDYAMPEASSLDIANTSVRMHH |
| Ga0179591_11870063 | 3300024347 | Vadose Zone Soil | MAEASRACACCFALSLLGLMRMESKNFEESIGMADYDNAMRKASSLDIANTSQSMRH |
| Ga0209483_100351812 | 3300025862 | Arctic Peat Soil | RMESKNFDESIGMADYDNAMPKASSLDIAKPSILIRH |
| Ga0207684_108646671 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ESKNFDESIGMADYDNAMRKASSLDIANTSPSMRH |
| Ga0207712_102834651 | 3300025961 | Switchgrass Rhizosphere | GLMRIESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0207640_106642451 | 3300025981 | Corn Rhizosphere | LMRIESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0207640_113719353 | 3300025981 | Corn Rhizosphere | ESKNFDESIGMADYDNAMRKASSLDIAKPSLPMRH |
| Ga0207658_105128683 | 3300025986 | Switchgrass Rhizosphere | SLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMHH |
| Ga0207658_116112042 | 3300025986 | Switchgrass Rhizosphere | LSLLGLMRIESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0207677_117231401 | 3300026023 | Miscanthus Rhizosphere | MRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMHH |
| Ga0207675_1003660144 | 3300026118 | Switchgrass Rhizosphere | CACCFALSLLGLMRMESKNLDESIAMANFDYAMPEASSLDIANTSVRMNH |
| Ga0209862_10734591 | 3300026222 | Permafrost Soil | SLLGLIRMESKNFDESIGMADYDNAMLKASSLDIAKPSLSMRH |
| Ga0257171_10493093 | 3300026377 | Soil | ESKNFEESIGMADYDNAMRKASSLDIANTSQSMRH |
| Ga0257161_10523661 | 3300026508 | Soil | LMRMESKNFEESIGMADYDNAMRKASSLDIANTSQSMRH |
| Ga0257161_11026893 | 3300026508 | Soil | MESKNFDESIGMTDYDNAMRKASSLDIAKPSLLMRH |
| Ga0209157_11908871 | 3300026537 | Soil | NFDESIAMADFDYAMPAASSLDIANPSSSMAPLTES |
| Ga0209524_11269151 | 3300027521 | Forest Soil | LMRMESKNFDESIGMADFDYAMRNASSLDIANTSPSMRH |
| Ga0208984_10487211 | 3300027546 | Forest Soil | LLGLMRMESKNFDESIGMADYDNAMRKASSLDIANTSPSMRH |
| Ga0209528_11151202 | 3300027610 | Forest Soil | LLGLMRMESKNLDESIGMADYDNATQKASSLDIAKLSLPMRH |
| Ga0209261_101707943 | 3300027735 | Wetland Sediment | GLMRMLSKNLDESIGMADYDNAMRKASSLDIANTSVRVQH |
| Ga0209038_101399733 | 3300027737 | Bog Forest Soil | LTRMESKNFDESIGMMNFDYATRKASSLDIANTFNSVKVG |
| Ga0209464_102293733 | 3300027778 | Wetland Sediment | CFALSLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSLS |
| Ga0209068_101753674 | 3300027894 | Watersheds | SLLGLMRMESKNLDESIGMADYDNAMRKASSLDIANTSPSMRH |
| Ga0209048_103068631 | 3300027902 | Freshwater Lake Sediment | LLGLMRMESKNFDESIAMADYDNAMRKASSLDIANTSLPVRH |
| Ga0209069_107343711 | 3300027915 | Watersheds | SLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0209526_100333111 | 3300028047 | Forest Soil | ESKNFDESIGMADYDNAMRKASSLDIANTSLSMRH |
| Ga0209526_101075781 | 3300028047 | Forest Soil | CACCFALSLLGLMRMESKNFDESIGMADYDNAMRKASSLDIAKLSLPIHH |
| Ga0247823_115093692 | 3300028590 | Soil | GLMRMESKNLDESIAMIDFDYAMPKASSLDIANNSVRIRH |
| Ga0307296_100761841 | 3300028819 | Soil | LMRMESKNLDESIAMADFDYAMPEASSLDIANTSVRMRH |
| Ga0307310_101645923 | 3300028824 | Soil | CCFALSLLGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMHH |
| Ga0307310_104263093 | 3300028824 | Soil | MRMESKNFDESIGMTDYDNAMRKASSLDIANTSPSMRH |
| Ga0311347_109813691 | 3300029923 | Fen | GLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0311349_110948211 | 3300030294 | Fen | MRMESKNLDESIGMADYDNAMPKASSLDIAKPSLSMRH |
| Ga0311355_116905641 | 3300030580 | Palsa | LGLMRMESKNFDESIGMADYDNAMRKASSLDIAKPSPSMRH |
| Ga0302317_100403091 | 3300030677 | Palsa | FGLIRMESKNLDESIGMADYDNAMRKASSLDIANISLPMRH |
| Ga0302310_104818053 | 3300030737 | Palsa | MESKNFDESIGMADYDNAMRKASSLDIAKPSPSMRH |
| Ga0311366_119352181 | 3300030943 | Fen | LGLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0302308_102984901 | 3300031027 | Palsa | RMESKNFDESIGMADYDNAMRKASSLDIAKPSPSMRH |
| Ga0307500_101224493 | 3300031198 | Soil | LLGLMRIESKNLDESIAMTDFDYAMPEASSLDIANTSVRMRH |
| Ga0170820_161193471 | 3300031446 | Forest Soil | MALSLLGLIRMLSKNLDESMGMADYDNAMQKASSLDIAKLSLPMRH |
| Ga0170818_1037989451 | 3300031474 | Forest Soil | LMRMESKNLDESIGMADFDYAMPEASSLDIANTSLPMCH |
| Ga0307509_107935171 | 3300031507 | Ectomycorrhiza | RMESKNLDESIGMADYDNAMRKASSLDIAKPSLSMRH |
| Ga0307508_104672911 | 3300031616 | Ectomycorrhiza | SSRAAACCFALSLLGLMRMESKNLDESIGMADFDYAMPKASSLDIANTSLLMIH |
| Ga0302319_105773113 | 3300031788 | Bog | LSLFGLIRMESKNLDESIGMADYDNAMRKASSLDIAIPSLSMRH |
| Ga0302322_1010709231 | 3300031902 | Fen | GLMRMESKNLDESIAMANFDYAMPKASSLDIANTSFRMRH |
| Ga0307407_111736712 | 3300031903 | Rhizosphere | MESKNLDESIAMTNFDYAMPEASSLDIANTSVRMRH |
| Ga0307416_1035483041 | 3300032002 | Rhizosphere | GLMRMLSKNLDESIAMADYDNAMQKASSLDIANPSLC |
| Ga0307414_114219783 | 3300032004 | Rhizosphere | AFALTLLGLMRMESKNLDESIGMADYDYAMRKASSLDIANTSASDAH |
| Ga0307472_1006476793 | 3300032205 | Hardwood Forest Soil | RARACAFALSLLGLMRMESKNFDESIAMTDFDYAIRKASRLDIAIPSFPGRH |
| Ga0310896_105036581 | 3300032211 | Soil | GLMRMESKNLDESIAMTDFDYAMPEASSLDIANTSVRMHH |
| ⦗Top⦘ |